F486146

General Info

Members Datasets Scaffolds Average Seq Length
935 372 1870 213

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100272594|Ga0070660_1002725941
Length 255
Sequence VYCTRAFRGWKALPDKKRPYVVSAQRGIRRTLGAPAAILPTVLSSVRLSPADRVLAAIDHALRALSTTPQPARPKPLASQPESSLDEVERREAGALMRVNHVGEVCAQALYSAQALATSDPQLRRQFQQAAAEETDHLAWTAERLAELGARPSLLNPLWYAGAFAIGLVAARTGDARSLGFLVETERQVEQHLXXXXDRLPAADASSRAIVAQMRDDEAAHAMAAERAGATALPLPVRWAMRAAAKVMTTTAHYV

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
368 2643221556 Massilia sp. Root1485 Isolate Unclassified
369 2643221684 Massilia sp. Root133 Isolate Unclassified
370 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
371 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
372 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.32
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.66
Nodule 0.32
Rhizoplane 3.32
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100272594 3300005339 Bacteria 1383
2 JGI25156J39149_1000005 3300002705 Bacteria 263980
3 JGI25154J39366_1000017 3300002738 Bacteria 252448
4 JGI25157J39369_1000003 3300002741 Bacteria 274935
5 JGI25157J39369_1000054 3300002741 Bacteria 108825
6 JGI25150J39212_1004275 3300002774 Bacteria 3201
7 JGI25159J45721_1001021 3300002987 Bacteria 12039
8 JGI25159J45721_1004551 3300002987 Bacteria 4577
9 JGI25151J46595_10010433 3300003187 Bacteria 4318
10 JGI25160J50197_1000904 3300003354 Bacteria 15618
11 JGI25161J50226_1000098 3300003374 Bacteria 71121
12 Ga0032354_1048063 3300003693 Bacteria 1266
13 Ga0055525_1000006 3300003759 Bacteria 642912
14 Ga0055526_1000687 3300003771 Bacteria 25833
15 Ga0055526_1018534 3300003771 Bacteria 2593
16 Ga0055537_1001789 3300003773 Bacteria 7836
17 Ga0055537_1019896 3300003773 Bacteria 1032
18 Ga0055524_1000111 3300003775 Bacteria 96812
19 Ga0055536_1009963 3300003781 Bacteria 3845
20 Ga0055536_1022523 3300003781 Bacteria 1878
21 Ga0055534_1004295 3300003784 Bacteria 4178
22 Ga0055528_1002416 3300003790 Bacteria 10034
23 Ga0055530_10003020 3300003791 Bacteria 10068
24 Ga0055530_10053716 3300003791 Bacteria 924
25 Ga0055540_1000059 3300003792 Bacteria 132075
26 Ga0055531_10001080 3300003794 Bacteria 21409
27 Ga0055531_10001578 3300003794 Bacteria 16647
28 Ga0055543_1000144 3300004625 Bacteria 59417
29 Ga0065165_1014482 3300005262 Bacteria 3059
30 Ga0065165_1014526 3300005262 Bacteria 3052
31 Ga0065165_1018270 3300005262 Bacteria 2544
32 Ga0065165_1036589 3300005262 Bacteria 1496
33 Ga0065715_10527971 3300005293 Bacteria 758
34 Ga0070658_10225337 3300005327 Bacteria 1586
35 Ga0070658_10699872 3300005327 Bacteria 879
36 Ga0070676_10013766 3300005328 Bacteria 4435
37 Ga0070690_100024780 3300005330 Bacteria 3692
38 Ga0070670_100006305 3300005331 Bacteria 10039
39 Ga0070670_100116637 3300005331 Bacteria 2302
40 Ga0070670_100123059 3300005331 Bacteria 2238
41 Ga0070670_100368834 3300005331 Bacteria 1263
42 Ga0070677_10150498 3300005333 Bacteria 1082
43 Ga0068869_100064225 3300005334 Bacteria 2700
44 Ga0068869_100108635 3300005334 Bacteria 2108
45 Ga0070666_10085414 3300005335 Bacteria 2161
46 Ga0070666_10253567 3300005335 Bacteria 1246
47 Ga0070666_10295264 3300005335 Bacteria 1153
48 Ga0070666_10397516 3300005335 Bacteria 990
49 Ga0070680_100027256 3300005336 Bacteria 4575
50 Ga0070680_100068768 3300005336 Bacteria 2907
51 Ga0068868_100018409 3300005338 Bacteria 5223
52 Ga0068868_100108205 3300005338 Bacteria 2256
53 Ga0068868_100282759 3300005338 Bacteria 1404
54 Ga0068868_100398368 3300005338 Bacteria 1187
55 Ga0070660_100002557 3300005339 Bacteria 12469
56 Ga0070660_100009788 3300005339 Bacteria 6755
57 Ga0070689_100000624 3300005340 Bacteria 21405
58 Ga0070689_100199393 3300005340 Bacteria 1633
59 Ga0070687_100035247 3300005343 Bacteria 2483
60 Ga0070661_100071272 3300005344 Unclassified 2557
61 Ga0070668_100230863 3300005347 Bacteria 1530
62 Ga0070668_100238038 3300005347 Bacteria 1507
63 Ga0070668_100411477 3300005347 Bacteria 1156
64 Ga0070669_100065706 3300005353 Bacteria 2672
65 Ga0070669_100171152 3300005353 Bacteria 1693
66 Ga0070669_100326072 3300005353 Bacteria 1241
67 Ga0070669_100334658 3300005353 Bacteria 1225
68 Ga0070675_100014471 3300005354 Bacteria 6222
69 Ga0070675_100139096 3300005354 Bacteria 2074
70 Ga0070675_100217508 3300005354 Bacteria 1663
71 Ga0070675_100435111 3300005354 Bacteria 1175
72 Ga0070671_100185860 3300005355 Bacteria 1760
73 Ga0070671_100345424 3300005355 Bacteria 1270
74 Ga0070674_100136852 3300005356 Bacteria 1833
75 Ga0070674_100402961 3300005356 Bacteria 1118
76 Ga0070674_100511777 3300005356 Bacteria 1001
77 Ga0070673_100031836 3300005364 Bacteria 3963
78 Ga0070673_100110895 3300005364 Bacteria 2275
79 Ga0070673_100290085 3300005364 Bacteria 1437
80 Ga0070673_100292640 3300005364 Bacteria 1431
81 Ga0070659_100006694 3300005366 Bacteria 8331
82 Ga0070659_100961633 3300005366 Bacteria 748
83 Ga0070667_100007815 3300005367 Bacteria 8868
84 Ga0070667_100009258 3300005367 Bacteria 8159
85 Ga0070667_100219092 3300005367 Bacteria 1694
86 Ga0070667_100317055 3300005367 Bacteria 1406
87 Ga0070667_100380306 3300005367 Bacteria 1282
88 Ga0070709_10025893 3300005434 Bacteria 3470
89 Ga0070701_10306550 3300005438 Bacteria 978
90 Ga0070663_100034987 3300005455 Bacteria 3482
91 Ga0070663_100133030 3300005455 Bacteria 1891
92 Ga0070678_100007969 3300005456 Bacteria 6315
93 Ga0070678_100259245 3300005456 Bacteria 1461
94 Ga0070662_100014951 3300005457 Bacteria 5190
95 Ga0070662_100085270 3300005457 Bacteria 2360
96 Ga0070662_100106904 3300005457 Bacteria 2126
97 Ga0070662_100171761 3300005457 Bacteria 1703
98 Ga0070662_100909080 3300005457 Bacteria 751
99 Ga0070681_10108402 3300005458 Bacteria 2717
100 Ga0068867_100080860 3300005459 Bacteria 2448
101 Ga0068867_100181061 3300005459 Bacteria 1676
102 Ga0068867_100223528 3300005459 Bacteria 1518
103 Ga0068867_100700712 3300005459 Bacteria 894
104 Ga0070706_100006620 3300005467 Bacteria 10929
105 Ga0070707_100038174 3300005468 Bacteria 4587
106 Ga0068853_100015198 3300005539 Bacteria 6327
107 Ga0068853_100421537 3300005539 Bacteria 1251
108 Ga0068853_100528825 3300005539 Bacteria 1115
109 Ga0068853_100597820 3300005539 Bacteria 1047
110 Ga0068853_100701297 3300005539 Bacteria 965
111 Ga0070672_100031116 3300005543 Bacteria 4014
112 Ga0070672_100063689 3300005543 Bacteria 2911
113 Ga0070672_100104446 3300005543 Bacteria 2302
114 Ga0070672_100105106 3300005543 Bacteria 2295
115 Ga0070672_100303104 3300005543 Bacteria 1355
116 Ga0070672_100312006 3300005543 Bacteria 1335
117 Ga0070672_100596830 3300005543 Bacteria 961
118 Ga0070672_100636700 3300005543 Bacteria 931
119 Ga0070686_100133490 3300005544 Bacteria 1720
120 Ga0070693_100007174 3300005547 Bacteria 5437
121 Ga0070665_100065950 3300005548 Bacteria 3631
122 Ga0068855_100013718 3300005563 Bacteria 9769
123 Ga0068855_100042439 3300005563 Bacteria 5389
124 Ga0068855_100095346 3300005563 Bacteria 3429
125 Ga0068855_100420597 3300005563 Bacteria 1462
126 Ga0070664_100080541 3300005564 Unclassified 2805
127 Ga0070664_100120831 3300005564 Bacteria 2294
128 Ga0070664_100255061 3300005564 Bacteria 1577
129 Ga0070664_100482413 3300005564 Bacteria 1141
130 Ga0070664_100604099 3300005564 Bacteria 1017
131 Ga0068857_100248419 3300005577 Bacteria 1630
132 Ga0068856_100037428 3300005614 Bacteria 4761
133 Ga0068856_100042007 3300005614 Bacteria 4496
134 Ga0068856_100204026 3300005614 Bacteria 1991
135 Ga0068856_100236318 3300005614 Bacteria 1843
136 Ga0068856_100393020 3300005614 Bacteria 1406
137 Ga0068856_100530192 3300005614 Bacteria 1199
138 Ga0068852_100011576 3300005616 Bacteria 6651
139 Ga0068852_100042300 3300005616 Bacteria 3857
140 Ga0068852_100045985 3300005616 Bacteria 3716
141 Ga0068852_100162631 3300005616 Bacteria 2085
142 Ga0068852_100192386 3300005616 Bacteria 1926
143 Ga0068852_100558651 3300005616 Bacteria 1145
144 Ga0068859_100039064 3300005617 Bacteria 4760
145 Ga0068859_100065307 3300005617 Bacteria 3673
146 Ga0068859_100234388 3300005617 Bacteria 1924
147 Ga0068859_100394040 3300005617 Bacteria 1480
148 Ga0068864_100013754 3300005618 Bacteria 6712
149 Ga0068864_100019788 3300005618 Bacteria 5628
150 Ga0068864_100707622 3300005618 Bacteria 984
151 Ga0068866_10257098 3300005718 Bacteria 1071
152 Ga0068861_100002738 3300005719 Bacteria 11545
153 Ga0068861_100031672 3300005719 Bacteria 3887
154 Ga0068861_100056852 3300005719 Bacteria 2987
155 Ga0068851_10025723 3300005834 Bacteria 2888
156 Ga0068851_10124697 3300005834 Bacteria 1387
157 Ga0068851_10309789 3300005834 Bacteria 910
158 Ga0068863_100020785 3300005841 Bacteria 6270
159 Ga0068863_100137358 3300005841 Bacteria 2335
160 Ga0068863_100242578 3300005841 Bacteria 1739
161 Ga0068863_100436673 3300005841 Bacteria 1283
162 Ga0068863_100763049 3300005841 Bacteria 963
163 Ga0068858_100001185 3300005842 Bacteria 26988
164 Ga0068858_100034648 3300005842 Bacteria 4683
165 Ga0068858_100113584 3300005842 Bacteria 2529
166 Ga0068860_100004815 3300005843 Bacteria 13742
167 Ga0068860_100026517 3300005843 Bacteria 5585
168 Ga0068860_100034324 3300005843 Bacteria 4864
169 Ga0068860_100154427 3300005843 Bacteria 2211
170 Ga0068860_100604203 3300005843 Bacteria 1102
171 Ga0068862_100047648 3300005844 Bacteria 3658
172 Ga0068862_100180853 3300005844 Bacteria 1892
173 Ga0075368_10018128 3300006042 Bacteria 2642
174 Ga0075368_10113227 3300006042 Bacteria 1119
175 Ga0075368_10127234 3300006042 Bacteria 1057
176 Ga0075363_100026519 3300006048 Bacteria 2965
177 Ga0075363_100210630 3300006048 Bacteria 1112
178 Ga0075363_100224502 3300006048 Bacteria 1077
179 Ga0075363_100327878 3300006048 Bacteria 891
180 Ga0075364_10041436 3300006051 Bacteria 2990
181 Ga0075364_10041630 3300006051 Bacteria 2983
182 Ga0075364_10245141 3300006051 Bacteria 1217
183 Ga0075432_10012582 3300006058 Bacteria 2874
184 Ga0070712_100109979 3300006175 Bacteria 2055
185 Ga0075362_10058601 3300006177 Bacteria 1737
186 Ga0075367_10026044 3300006178 Bacteria 3312
187 Ga0075367_10026896 3300006178 Bacteria 3267
188 Ga0075367_10185800 3300006178 Bacteria 1296
189 Ga0075366_10001380 3300006195 Bacteria 12168
190 Ga0075366_10019684 3300006195 Bacteria 3910
191 Ga0075366_10027839 3300006195 Bacteria 3317
192 Ga0075366_10043612 3300006195 Bacteria 2657
193 Ga0075366_10077278 3300006195 Bacteria 1987
194 Ga0075366_10083628 3300006195 Bacteria 1907
195 Ga0075366_10276674 3300006195 Bacteria 1026
196 Ga0075366_10348202 3300006195 Bacteria 909
197 Ga0097621_100171187 3300006237 Bacteria 1872
198 Ga0097621_100209765 3300006237 Bacteria 1694
199 Ga0075370_10040034 3300006353 Bacteria 2642
200 Ga0075370_10293335 3300006353 Bacteria 967
201 Ga0068871_100094146 3300006358 Bacteria 2500
202 Ga0068871_100123953 3300006358 Bacteria 2185
203 Ga0075430_100117398 3300006846 Bacteria 2218
204 Ga0068865_100031610 3300006881 Bacteria 3530
205 Ga0068865_100107097 3300006881 Bacteria 2056
206 Ga0068865_100609721 3300006881 Bacteria 923
207 Ga0097620_100039061 3300006931 Bacteria 4760
208 Ga0097620_100065308 3300006931 Bacteria 3673
209 Ga0097620_100234381 3300006931 Bacteria 1924
210 Ga0097620_100394034 3300006931 Bacteria 1480
211 Ga0079104_1006920 3300006946 Bacteria 4192
212 Ga0099826_10083699 3300006948 Bacteria 1977
213 Ga0105240_10002070 3300009093 Bacteria 32876
214 Ga0105240_10123742 3300009093 Bacteria 3111
215 Ga0105240_10644699 3300009093 Bacteria 1162
216 Ga0111539_10215275 3300009094 Bacteria 2238
217 Ga0105245_10206809 3300009098 Bacteria 1887
218 Ga0105245_10341275 3300009098 Bacteria 1481
219 Ga0105243_10354089 3300009148 Bacteria 1349
220 Ga0105243_10446156 3300009148 Bacteria 1213
221 Ga0105241_10020687 3300009174 Bacteria 4862
222 Ga0105241_10129050 3300009174 Bacteria 2045
223 Ga0105241_10855172 3300009174 Bacteria 842
224 Ga0105242_10118759 3300009176 Bacteria 2266
225 Ga0105242_10690301 3300009176 Bacteria 997
226 Ga0105248_10065552 3300009177 Bacteria 4078
227 Ga0105248_10088911 3300009177 Bacteria 3477
228 Ga0105248_10217938 3300009177 Bacteria 2149
229 Ga0105248_10244015 3300009177 Bacteria 2022
230 Ga0105248_10538103 3300009177 Bacteria 1318
231 Ga0105237_10022027 3300009545 Bacteria 6540
232 Ga0105237_10064875 3300009545 Bacteria 3648
233 Ga0105238_10077712 3300009551 Bacteria 3310
234 Ga0105238_10157136 3300009551 Bacteria 2249
235 Ga0105238_10467490 3300009551 Bacteria 1259
236 Ga0105249_10022314 3300009553 Bacteria 5670
237 Ga0105249_10413675 3300009553 Bacteria 1381
238 Ga0105249_10623764 3300009553 Bacteria 1134
239 Ga0105239_10068683 3300010375 Bacteria 3894
240 Ga0105239_10379575 3300010375 Bacteria 1598
241 Ga0105239_10831227 3300010375 Bacteria 1059
242 Ga0105239_11076803 3300010375 Bacteria 925
243 Ga0157373_10018543 3300013100 Bacteria 5064
244 Ga0157371_10086471 3300013102 Bacteria 2220
245 Ga0157371_10228487 3300013102 Bacteria 1337
246 Ga0157370_10273944 3300013104 Bacteria 1559
247 Ga0157369_10192610 3300013105 Bacteria 2142
248 Ga0157369_10617220 3300013105 Bacteria 1119
249 Ga0157374_10127551 3300013296 Bacteria 2460
250 Ga0157374_10275973 3300013296 Bacteria 1658
251 Ga0157374_10779375 3300013296 Bacteria 971
252 Ga0157378_10072895 3300013297 Bacteria 3086
253 Ga0163162_10059623 3300013306 Bacteria 3849
254 Ga0163162_10118583 3300013306 Bacteria 2748
255 Ga0163162_10151222 3300013306 Bacteria 2439
256 Ga0163162_10318675 3300013306 Bacteria 1687
257 Ga0163162_10394781 3300013306 Bacteria 1516
258 Ga0163162_11029133 3300013306 Bacteria 932
259 Ga0157372_10178311 3300013307 Bacteria 2460
260 Ga0157372_10275812 3300013307 Bacteria 1955
261 Ga0157372_10311104 3300013307 Bacteria 1833
262 Ga0157372_10324813 3300013307 Bacteria 1792
263 Ga0157375_10049453 3300013308 Bacteria 4120
264 Ga0157375_10052547 3300013308 Bacteria 4006
265 Ga0157375_10187658 3300013308 Bacteria 2221
266 Ga0157375_10222778 3300013308 Bacteria 2045
267 Ga0157375_10389776 3300013308 Bacteria 1560
268 Ga0157375_10419655 3300013308 Bacteria 1504
269 Ga0157375_10422967 3300013308 Bacteria 1498
270 Ga0163163_10024646 3300014325 Bacteria 5727
271 Ga0163163_10049795 3300014325 Bacteria 4124
272 Ga0157380_10001295 3300014326 Bacteria 16258
273 Ga0157380_10064987 3300014326 Bacteria 2930
274 Ga0157380_10072977 3300014326 Bacteria 2781
275 Ga0157380_10078486 3300014326 Bacteria 2693
276 Ga0157377_10042238 3300014745 Bacteria 2532
277 Ga0157379_10031145 3300014968 Bacteria 4751
278 Ga0157379_10077699 3300014968 Bacteria 2972
279 Ga0157379_10090193 3300014968 Bacteria 2750
280 Ga0157379_10101526 3300014968 Bacteria 2582
281 Ga0157379_10105494 3300014968 Bacteria 2529
282 Ga0157379_10266754 3300014968 Bacteria 1556
283 Ga0157379_10303119 3300014968 Bacteria 1456
284 Ga0157379_10923074 3300014968 Bacteria 829
285 Ga0157376_10002116 3300014969 Bacteria 13365
286 Ga0157376_10038774 3300014969 Bacteria 3879
287 Ga0157376_10071904 3300014969 Bacteria 2941
288 Ga0157376_10509087 3300014969 Bacteria 1184
289 Ga0157376_10719139 3300014969 Bacteria 1005
290 Ga0182006_1083651 3300015261 Bacteria 1160
291 Ga0163161_10074141 3300017792 Bacteria 2495
292 Ga0163161_10172145 3300017792 Bacteria 1656
293 Ga0163161_10214799 3300017792 Bacteria 1487
294 Ga0163161_10323631 3300017792 Bacteria 1219
295 Ga0163161_10502091 3300017792 Bacteria 988
296 Ga0209435_100002 3300025206 Bacteria 794178
297 Ga0209563_100022 3300025230 Bacteria 643318
298 Ga0207425_1002730 3300025245 Bacteria 6009
299 Ga0207425_1003093 3300025245 Bacteria 5500
300 Ga0209646_1000001 3300025246 Bacteria 3092932
301 Ga0209026_1000001 3300025250 Bacteria 1228671
302 Ga0209677_102311 3300025253 Bacteria 7323
303 Ga0209759_1000001 3300025256 Bacteria 2799452
304 Ga0209129_1008061 3300025258 Bacteria 2997
305 Ga0209565_1000016 3300025263 Bacteria 477707
306 Ga0209565_1000923 3300025263 Bacteria 15607
307 Ga0209673_1000008 3300025273 Bacteria 626013
308 Ga0209130_1000104 3300025284 Bacteria 136694
309 Ga0209130_1000161 3300025284 Bacteria 100375
310 Ga0209130_1028024 3300025284 Bacteria 1189
311 Ga0209675_1000099 3300025291 Bacteria 128911
312 Ga0209675_1001851 3300025291 Bacteria 11492
313 Ga0209675_1011520 3300025291 Bacteria 2927
314 Ga0209676_1000023 3300025292 Bacteria 589732
315 Ga0209676_1002377 3300025292 Bacteria 13514
316 Ga0209025_1006841 3300025294 Bacteria 8704
317 Ga0209025_1010184 3300025294 Bacteria 6414
318 Ga0209025_1029251 3300025294 Bacteria 2673
319 Ga0209564_1000555 3300025295 Bacteria 59942
320 Ga0209564_1002809 3300025295 Bacteria 12946
321 Ga0209758_1018095 3300025297 Bacteria 3472
322 Ga0209050_1000022 3300025298 Bacteria 565239
323 Ga0209050_1021294 3300025298 Bacteria 2369
324 Ga0209050_1028106 3300025298 Bacteria 1833
325 Ga0209256_1000001 3300025299 Bacteria 2166974
326 Ga0209256_1014236 3300025299 Bacteria 2880
327 Ga0207426_1000156 3300025302 Bacteria 178646
328 Ga0207426_1001121 3300025302 Bacteria 24462
329 Ga0209051_1000013 3300025303 Bacteria 565239
330 Ga0209257_1000042 3300025304 Bacteria 537149
331 Ga0209257_1005881 3300025304 Bacteria 8277
332 Ga0207656_10046409 3300025321 Bacteria 1864
333 Ga0207656_10138562 3300025321 Unclassified 1145
334 Ga0207655_1092064 3300025728 Bacteria 1064
335 Ga0207682_10031528 3300025893 Bacteria 2127
336 Ga0207682_10040018 3300025893 Bacteria 1908
337 Ga0207682_10046967 3300025893 Bacteria 1776
338 Ga0207642_10087850 3300025899 Bacteria 1528
339 Ga0207688_10051169 3300025901 Bacteria 2314
340 Ga0207680_10008314 3300025903 Bacteria 5085
341 Ga0207680_10025898 3300025903 Bacteria 3242
342 Ga0207680_10065415 3300025903 Bacteria 2232
343 Ga0207680_10404619 3300025903 Bacteria 965
344 Ga0207699_10097406 3300025906 Bacteria 1859
345 Ga0207645_10003724 3300025907 Bacteria 11470
346 Ga0207645_10019669 3300025907 Bacteria 4426
347 Ga0207643_10304639 3300025908 Bacteria 992
348 Ga0207705_10011758 3300025909 Bacteria 6324
349 Ga0207705_10051365 3300025909 Bacteria 2967
350 Ga0207705_10135912 3300025909 Bacteria 1833
351 Ga0207705_10167930 3300025909 Bacteria 1651
352 Ga0207705_10465415 3300025909 Bacteria 981
353 Ga0207684_10000714 3300025910 Bacteria 39062
354 Ga0207654_10007718 3300025911 Bacteria 5429
355 Ga0207654_10055478 3300025911 Bacteria 2294
356 Ga0207695_10026604 3300025913 Bacteria 6456
357 Ga0207695_10153021 3300025913 Bacteria 2244
358 Ga0207695_10354456 3300025913 Bacteria 1354
359 Ga0207671_10051806 3300025914 Bacteria 3041
360 Ga0207671_10137781 3300025914 Bacteria 1878
361 Ga0207693_10022272 3300025915 Bacteria 5035
362 Ga0207663_10227436 3300025916 Bacteria 1361
363 Ga0207660_10053451 3300025917 Bacteria 2879
364 Ga0207662_10044666 3300025918 Bacteria 2616
365 Ga0207662_10056513 3300025918 Bacteria 2344
366 Ga0207662_10077373 3300025918 Bacteria 2024
367 Ga0207657_10006245 3300025919 Bacteria 12388
368 Ga0207657_10006432 3300025919 Bacteria 12181
369 Ga0207657_10017764 3300025919 Bacteria 6809
370 Ga0207657_10169575 3300025919 Bacteria 1769
371 Ga0207657_10185157 3300025919 Bacteria 1682
372 Ga0207657_10469957 3300025919 Bacteria 986
373 Ga0207649_10090317 3300025920 Bacteria 2004
374 Ga0207649_10414651 3300025920 Bacteria 1010
375 Ga0207649_10549636 3300025920 Bacteria 883
376 Ga0207649_10599679 3300025920 Bacteria 847
377 Ga0207652_10051193 3300025921 Bacteria 3540
378 Ga0207652_10081838 3300025921 Bacteria 2824
379 Ga0207652_10976883 3300025921 Bacteria 745
380 Ga0207646_10576156 3300025922 Bacteria 1011
381 Ga0207681_10006662 3300025923 Bacteria 7092
382 Ga0207681_10196498 3300025923 Bacteria 1546
383 Ga0207681_10213240 3300025923 Bacteria 1489
384 Ga0207681_10635375 3300025923 Bacteria 884
385 Ga0207694_10043930 3300025924 Bacteria 3449
386 Ga0207694_10104234 3300025924 Bacteria 2250
387 Ga0207650_10000680 3300025925 Bacteria 26724
388 Ga0207650_10019281 3300025925 Bacteria 4790
389 Ga0207650_10159413 3300025925 Bacteria 1787
390 Ga0207650_10168742 3300025925 Bacteria 1738
391 Ga0207659_10028246 3300025926 Bacteria 3810
392 Ga0207659_10225077 3300025926 Bacteria 1510
393 Ga0207687_10213141 3300025927 Bacteria 1516
394 Ga0207687_10333001 3300025927 Bacteria 1232
395 Ga0207644_10037119 3300025931 Bacteria 3425
396 Ga0207644_10280584 3300025931 Bacteria 1337
397 Ga0207690_10361500 3300025932 Bacteria 1150
398 Ga0207690_10628490 3300025932 Bacteria 878
399 Ga0207706_10005882 3300025933 Bacteria 11409
400 Ga0207706_10102249 3300025933 Bacteria 2521
401 Ga0207706_10195211 3300025933 Bacteria 1776
402 Ga0207686_10025634 3300025934 Bacteria 3432
403 Ga0207709_10370529 3300025935 Bacteria 1087
404 Ga0207670_10050971 3300025936 Bacteria 2777
405 Ga0207669_10004122 3300025937 Bacteria 6368
406 Ga0207704_10215709 3300025938 Bacteria 1416
407 Ga0207704_10380962 3300025938 Bacteria 1107
408 Ga0207691_10010380 3300025940 Bacteria 8935
409 Ga0207691_10024632 3300025940 Bacteria 5660
410 Ga0207691_10033480 3300025940 Bacteria 4784
411 Ga0207691_10057116 3300025940 Bacteria 3553
412 Ga0207691_10074408 3300025940 Bacteria 3064
413 Ga0207691_10118166 3300025940 Bacteria 2352
414 Ga0207691_10300645 3300025940 Bacteria 1379
415 Ga0207711_10014147 3300025941 Bacteria 6629
416 Ga0207711_10026013 3300025941 Bacteria 4908
417 Ga0207711_10256528 3300025941 Bacteria 1606
418 Ga0207711_10778621 3300025941 Bacteria 891
419 Ga0207689_10099857 3300025942 Bacteria 2385
420 Ga0207689_10280123 3300025942 Bacteria 1381
421 Ga0207689_10294495 3300025942 Bacteria 1344
422 Ga0207661_10045183 3300025944 Bacteria 3485
423 Ga0207679_10032033 3300025945 Bacteria 3686
424 Ga0207679_10090050 3300025945 Bacteria 2370
425 Ga0207679_10163686 3300025945 Bacteria 1824
426 Ga0207679_10324085 3300025945 Bacteria 1335
427 Ga0207679_10450481 3300025945 Unclassified 1141
428 Ga0207667_10020314 3300025949 Bacteria 7392
429 Ga0207667_10063367 3300025949 Bacteria 3862
430 Ga0207667_10071410 3300025949 Bacteria 3609
431 Ga0207667_10140766 3300025949 Bacteria 2484
432 Ga0207667_10439969 3300025949 Bacteria 1326
433 Ga0207667_10497225 3300025949 Bacteria 1237
434 Ga0207651_10013033 3300025960 Bacteria 4737
435 Ga0207651_10102907 3300025960 Bacteria 2124
436 Ga0207668_10005465 3300025972 Bacteria 7484
437 Ga0207668_10060655 3300025972 Bacteria 2656
438 Ga0207668_10086208 3300025972 Bacteria 2293
439 Ga0207668_10519152 3300025972 Bacteria 1027
440 Ga0207640_10296328 3300025981 Bacteria 1277
441 Ga0207640_10366628 3300025981 Bacteria 1162
442 Ga0207658_10009315 3300025986 Bacteria 6658
443 Ga0207658_10012592 3300025986 Bacteria 5774
444 Ga0207658_10605997 3300025986 Bacteria 984
445 Ga0207677_10008465 3300026023 Bacteria 5750
446 Ga0207677_10100771 3300026023 Bacteria 2124
447 Ga0207677_10169391 3300026023 Bacteria 1706
448 Ga0207677_10429130 3300026023 Bacteria 1128
449 Ga0207677_10497277 3300026023 Bacteria 1053
450 Ga0207703_10122841 3300026035 Bacteria 2231
451 Ga0207703_10191042 3300026035 Bacteria 1813
452 Ga0207639_10038545 3300026041 Bacteria 3555
453 Ga0207639_10110468 3300026041 Bacteria 2239
454 Ga0207639_10129500 3300026041 Bacteria 2087
455 Ga0207639_10354551 3300026041 Bacteria 1311
456 Ga0207639_10475342 3300026041 Bacteria 1138
457 Ga0207639_10610632 3300026041 Bacteria 1006
458 Ga0207639_10669502 3300026041 Bacteria 961
459 Ga0207639_10783503 3300026041 Bacteria 888
460 Ga0207678_10022150 3300026067 Bacteria 5568
461 Ga0207678_10072306 3300026067 Bacteria 2955
462 Ga0207678_10125445 3300026067 Bacteria 2190
463 Ga0207678_10162233 3300026067 Bacteria 1909
464 Ga0207678_10237600 3300026067 Bacteria 1560
465 Ga0207678_10484780 3300026067 Bacteria 1077
466 Ga0207708_10001498 3300026075 Bacteria 17400
467 Ga0207708_10023675 3300026075 Bacteria 4643
468 Ga0207702_10073004 3300026078 Bacteria 2958
469 Ga0207702_10141102 3300026078 Bacteria 2180
470 Ga0207702_10573578 3300026078 Bacteria 1105
471 Ga0207702_10906079 3300026078 Bacteria 874
472 Ga0207641_10002127 3300026088 Bacteria 18727
473 Ga0207641_10006110 3300026088 Bacteria 10193
474 Ga0207641_10023137 3300026088 Bacteria 5119
475 Ga0207641_10161619 3300026088 Bacteria 2037
476 Ga0207648_10018058 3300026089 Bacteria 6391
477 Ga0207648_10052892 3300026089 Bacteria 3550
478 Ga0207648_10068675 3300026089 Bacteria 3088
479 Ga0207648_10128996 3300026089 Bacteria 2225
480 Ga0207648_10680334 3300026089 Bacteria 952
481 Ga0207648_10796090 3300026089 Bacteria 880
482 Ga0207676_10011792 3300026095 Bacteria 6252
483 Ga0207676_10016687 3300026095 Bacteria 5318
484 Ga0207676_10180031 3300026095 Bacteria 1850
485 Ga0207674_10117751 3300026116 Bacteria 2627
486 Ga0207674_10282263 3300026116 Bacteria 1609
487 Ga0207675_100006084 3300026118 Bacteria 11481
488 Ga0207675_100034556 3300026118 Bacteria 4714
489 Ga0207675_100191173 3300026118 Bacteria 1963
490 Ga0207675_100199544 3300026118 Bacteria 1921
491 Ga0207683_10024352 3300026121 Bacteria 5212
492 Ga0207683_10308206 3300026121 Bacteria 1449
493 Ga0207683_10417148 3300026121 Bacteria 1236
494 Ga0207698_10023051 3300026142 Bacteria 4343
495 Ga0207698_10056283 3300026142 Bacteria 3036
496 Ga0207698_10088371 3300026142 Bacteria 2527
497 Ga0207698_10103288 3300026142 Bacteria 2368
498 Ga0207698_10165058 3300026142 Bacteria 1942
499 Ga0207698_10222983 3300026142 Bacteria 1705
500 Ga0207698_10557547 3300026142 Bacteria 1124
501 Ga0207698_10628705 3300026142 Bacteria 1061
502 Ga0207698_10660150 3300026142 Bacteria 1037
503 Ga0209281_1007740 3300027111 Bacteria 2668
504 Ga0268266_10197381 3300028379 Bacteria 1840
505 Ga0268265_10021553 3300028380 Bacteria 4517
506 Ga0268265_10333911 3300028380 Bacteria 1378
507 Ga0268265_10499498 3300028380 Bacteria 1146
508 Ga0268264_10022298 3300028381 Bacteria 5171
509 Ga0268264_10101692 3300028381 Bacteria 2499
510 Ga0268264_10162451 3300028381 Bacteria 2013
511 Ga0268264_10284382 3300028381 Bacteria 1551
512 Ga0307515_10386323 3300028794 Bacteria 1030
513 Ga0265332_10005179 3300031238 Bacteria 6034
514 Ga0265331_10100709 3300031250 Bacteria 1329
515 Ga0265327_10000147 3300031251 Bacteria 153254
516 Ga0307513_10000038 3300031456 Bacteria 174780
517 Ga0307408_100005019 3300031548 Bacteria 8877
518 Ga0307408_100185949 3300031548 Bacteria 1670
519 Ga0307508_10011561 3300031616 Bacteria 8067
520 Ga0307514_10219979 3300031649 Bacteria 1166
521 Ga0265314_10004558 3300031711 Bacteria 12795
522 Ga0265342_10170590 3300031712 Bacteria 1197
523 Ga0307516_10072178 3300031730 Bacteria 3312
524 Ga0307405_10482915 3300031731 Bacteria 989
525 Ga0307413_10504703 3300031824 Bacteria 972
526 Ga0307406_10028586 3300031901 Bacteria 3370
527 Ga0307412_10403397 3300031911 Bacteria 1114
528 Ga0307412_10468455 3300031911 Bacteria 1042
529 Ga0307409_100001596 3300031995 Bacteria 11334
530 Ga0307416_100012247 3300032002 Bacteria 5766
531 Ga0307416_100142552 3300032002 Bacteria 2181
532 Ga0307415_100000346 3300032126 Bacteria 19904
533 Ga0373942_0171038 3300035207 Bacteria 707
534 Ga0373931_0000300 3300035691 Bacteria 20785
535 Ga0373931_0097185 3300035691 Bacteria 1651
536 Ga0373935_0235596 3300035692 Bacteria 1276
537 Ga0373935_0307557 3300035692 Bacteria 1122
538 Ga0373937_0205232 3300036401 Bacteria 1853
539 Ga0373937_0233417 3300036401 Bacteria 1733
540 Ga0373937_0707173 3300036401 Unclassified 954
541 Ga0373925_0150218 3300037068 Bacteria 1829
542 Ga0373925_0351948 3300037068 Bacteria 1196
543 Ga0395899_0005223 3300037312 Bacteria 10100
544 Ga0395899_0029143 3300037312 Bacteria 4151
545 Ga0395899_0067036 3300037312 Bacteria 2634
546 Ga0395899_0090559 3300037312 Bacteria 2217
547 Ga0395900_0013506 3300037418 Bacteria 8344
548 Ga0395900_0024828 3300037418 Bacteria 6134
549 Ga0395900_0053083 3300037418 Bacteria 4171
550 Ga0395900_0068694 3300037418 Bacteria 3641
551 Ga0395900_0131330 3300037418 Bacteria 2566
552 Ga0395900_0136448 3300037418 Bacteria 2513
553 Ga0395900_0148594 3300037418 Bacteria 2395
554 Ga0395900_0265889 3300037418 Bacteria 1711
555 Ga0395900_0286769 3300037418 Bacteria 1636
556 Ga0395900_1008186 3300037418 Bacteria 752
557 Ga0395898_0014120 3300037466 Bacteria 8210
558 Ga0395898_0048219 3300037466 Bacteria 4178
559 Ga0395898_0084143 3300037466 Bacteria 3066
560 Ga0395898_0271496 3300037466 Bacteria 1617
561 Ga0395905_0001406 3300037471 Bacteria 29134
562 Ga0395905_0063052 3300037471 Bacteria 3467
563 Ga0395905_0088556 3300037471 Bacteria 2901
564 Ga0395905_0105995 3300037471 Bacteria 2639
565 Ga0395905_0140028 3300037471 Bacteria 2276
566 Ga0395905_0180643 3300037471 Bacteria 1981
567 Ga0395905_0196292 3300037471 Bacteria 1892
568 Ga0395905_0557024 3300037471 Bacteria 1048
569 Ga0395901_0041433 3300038443 Bacteria 4772
570 Ga0395901_0097087 3300038443 Bacteria 3088
571 Ga0395901_0177094 3300038443 Bacteria 2236
572 Ga0395901_0179643 3300038443 Bacteria 2219
573 Ga0395901_0191123 3300038443 Bacteria 2147
574 Ga0395901_0300754 3300038443 Bacteria 1663
575 Ga0395901_0326044 3300038443 Bacteria 1588
576 Ga0395901_0380636 3300038443 Bacteria 1452
577 Ga0395901_1104704 3300038443 Bacteria 763
578 Ga0451807_2210824 3300041486 Bacteria 895
579 Ga0451835_1109056 3300041492 Bacteria 939
580 Ga0439433_0026758 3300041999 Bacteria 1306
581 Ga0439448_0000585 3300042005 Bacteria 8553
582 Ga0439449_0029676 3300042007 Bacteria 2038
583 Ga0439450_021047 3300042008 Bacteria 1397
584 Ga0439455_0031602 3300042012 Bacteria 1319
585 Ga0450903_013516 3300042138 Bacteria 1298
586 Ga0451577_0011213 3300042876 Bacteria 8498
587 Ga0466969_0071528 3300044656 Bacteria 1667
588 Ga0466972_0140292 3300044658 Bacteria 1137
589 Ga0453683_0001915 3300044673 Bacteria 16995
590 Ga0453683_0005625 3300044673 Bacteria 8709
591 Ga0466965_0000612 3300044683 Bacteria 13033
592 Ga0466965_0054489 3300044683 Bacteria 1988
593 Ga0466966_0016157 3300044684 Bacteria 4934
594 Ga0466966_0070888 3300044684 Bacteria 2184
595 Ga0466966_0101534 3300044684 Bacteria 1778
596 Ga0466966_0157064 3300044684 Bacteria 1385
597 Ga0466963_0076777 3300044694 Bacteria 2256
598 Ga0466964_0007906 3300044706 Bacteria 3983
599 Ga0453684_0232843 3300044712 Bacteria 2125
600 Ga0466970_0233824 3300044765 Bacteria 1027
601 Ga0466957_0000323 3300044842 Bacteria 23196
602 Ga0466957_0007570 3300044842 Bacteria 6138
603 Ga0466957_0051695 3300044842 Bacteria 2501
604 Ga0466959_0032599 3300045049 Bacteria 3856
605 Ga0466959_0035301 3300045049 Bacteria 3699
606 Ga0466959_0041813 3300045049 Bacteria 3383
607 Ga0451576_0002636 3300045051 Bacteria 26218
608 Ga0451576_0006746 3300045051 Bacteria 13978
609 Ga0451576_0020764 3300045051 Bacteria 7148
610 Ga0451576_0697400 3300045051 Bacteria 1067
611 Ga0466958_0073580 3300045836 Bacteria 2093
612 Ga0466958_0292432 3300045836 Bacteria 1045
613 Ga0466967_0020822 3300045976 Bacteria 5311
614 Ga0466967_0025547 3300045976 Bacteria 4873
615 Ga0495617_000046 3300046452 Bacteria 115430
616 Ga0495627_001455 3300046453 Bacteria 13878
617 Ga0495627_020297 3300046453 Bacteria 2215
618 Ga0495590_0000144 3300046457 Bacteria 43127
619 Ga0495590_0034882 3300046457 Bacteria 1757
620 Ga0495591_000444 3300046458 Bacteria 33698
621 Ga0495591_036948 3300046458 Bacteria 1417
622 Ga0495638_0064750 3300046460 Bacteria 2251
623 Ga0495653_0122229 3300046463 Bacteria 1853
624 Ga0495650_0000248 3300046471 Bacteria 106527
625 Ga0495650_0000825 3300046471 Bacteria 37485
626 Ga0495650_0006291 3300046471 Bacteria 7428
627 Ga0495650_0017149 3300046471 Bacteria 3640
628 Ga0495580_0039286 3300046472 Bacteria 3385
629 Ga0495582_0009309 3300046473 Bacteria 5417
630 Ga0495605_0003469 3300046474 Bacteria 9385
631 Ga0495605_0007418 3300046474 Bacteria 6221
632 Ga0495605_0009661 3300046474 Bacteria 5420
633 Ga0495605_0058448 3300046474 Bacteria 1853
634 Ga0495584_0002608 3300046491 Bacteria 10156
635 Ga0495584_0008298 3300046491 Bacteria 5380
636 Ga0495584_0026763 3300046491 Bacteria 2923
637 Ga0495584_0027184 3300046491 Bacteria 2899
638 Ga0495584_0068327 3300046491 Bacteria 1785
639 Ga0495584_0089944 3300046491 Bacteria 1547
640 Ga0495585_0000380 3300046492 Bacteria 42602
641 Ga0495585_0021715 3300046492 Bacteria 3685
642 Ga0495585_0069006 3300046492 Bacteria 1930
643 Ga0495594_0007112 3300046499 Bacteria 5756
644 Ga0495596_0000955 3300046500 Bacteria 17265
645 Ga0495596_0004609 3300046500 Bacteria 6678
646 Ga0495596_0015566 3300046500 Bacteria 3180
647 Ga0495596_0021141 3300046500 Bacteria 2658
648 Ga0495596_0021462 3300046500 Bacteria 2635
649 Ga0495607_0002356 3300046501 Bacteria 15441
650 Ga0495607_0011324 3300046501 Bacteria 5944
651 Ga0495607_0012235 3300046501 Bacteria 5671
652 Ga0495607_0025769 3300046501 Bacteria 3654
653 Ga0495607_0029860 3300046501 Bacteria 3353
654 Ga0495607_0029921 3300046501 Bacteria 3349
655 Ga0495607_0046386 3300046501 Bacteria 2552
656 Ga0495607_0109731 3300046501 Bacteria 1464
657 Ga0495583_0009058 3300046506 Bacteria 5996
658 Ga0495583_0010736 3300046506 Bacteria 5313
659 Ga0495583_0085688 3300046506 Bacteria 1363
660 Ga0495583_0087528 3300046506 Bacteria 1345
661 Ga0495583_0143884 3300046506 Bacteria 991
662 Ga0495606_0309779 3300046507 Bacteria 852
663 Ga0495610_0000331 3300046512 Bacteria 50101
664 Ga0495616_0002503 3300046513 Bacteria 12153
665 Ga0495616_0010413 3300046513 Bacteria 5382
666 Ga0495616_0019536 3300046513 Bacteria 3696
667 Ga0495616_0042857 3300046513 Bacteria 2301
668 Ga0495616_0060158 3300046513 Bacteria 1866
669 Ga0495616_0129558 3300046513 Bacteria 1157
670 Ga0495616_0140709 3300046513 Bacteria 1098
671 Ga0495630_0571396 3300046517 Bacteria 867
672 Ga0495631_0006224 3300046518 Bacteria 6181
673 Ga0495631_0011979 3300046518 Bacteria 4250
674 Ga0495631_0014477 3300046518 Bacteria 3808
675 Ga0495631_0018273 3300046518 Bacteria 3303
676 Ga0495631_0060139 3300046518 Bacteria 1649
677 Ga0495631_0061239 3300046518 Bacteria 1632
678 Ga0495632_0000280 3300046519 Bacteria 50071
679 Ga0495632_0002237 3300046519 Bacteria 14928
680 Ga0495632_0003131 3300046519 Bacteria 11970
681 Ga0495632_0005246 3300046519 Bacteria 8617
682 Ga0495632_0008312 3300046519 Bacteria 6390
683 Ga0495632_0033797 3300046519 Bacteria 2622
684 Ga0495632_0047013 3300046519 Bacteria 2142
685 Ga0495637_0000029 3300046520 Bacteria 143929
686 Ga0495637_0022477 3300046520 Bacteria 2875
687 Ga0495637_0044319 3300046520 Bacteria 1894
688 Ga0495643_0000514 3300046522 Bacteria 48210
689 Ga0495643_0003982 3300046522 Bacteria 10560
690 Ga0495643_0024993 3300046522 Bacteria 3384
691 Ga0495643_0044633 3300046522 Bacteria 2407
692 Ga0495643_0062232 3300046522 Bacteria 1976
693 Ga0495643_0209672 3300046522 Bacteria 930
694 Ga0495644_0003853 3300046523 Bacteria 5907
695 Ga0495644_0028033 3300046523 Bacteria 2132
696 Ga0495644_0031087 3300046523 Bacteria 2016
697 Ga0495644_0066157 3300046523 Bacteria 1357
698 Ga0495648_0001486 3300046524 Bacteria 22929
699 Ga0495648_0007529 3300046524 Bacteria 8703
700 Ga0495648_0010091 3300046524 Bacteria 7233
701 Ga0495648_0013250 3300046524 Bacteria 6107
702 Ga0495648_0052908 3300046524 Bacteria 2463
703 Ga0495648_0110232 3300046524 Bacteria 1499
704 Ga0495666_0003799 3300046526 Bacteria 7636
705 Ga0495642_0000726 3300046528 Bacteria 16365
706 Ga0495642_0000987 3300046528 Bacteria 13239
707 Ga0495642_0001846 3300046528 Bacteria 9065
708 Ga0495642_0008902 3300046528 Bacteria 3840
709 Ga0495642_0016964 3300046528 Bacteria 2843
710 Ga0495642_0097744 3300046528 Bacteria 1247
711 Ga0495642_0168755 3300046528 Bacteria 950
712 Ga0495642_0217338 3300046528 Bacteria 834
713 Ga0495654_0004629 3300046530 Bacteria 8116
714 Ga0495654_0006758 3300046530 Bacteria 6485
715 Ga0495654_0021303 3300046530 Bacteria 3373
716 Ga0495654_0057046 3300046530 Bacteria 1887
717 Ga0495654_0174570 3300046530 Bacteria 934
718 Ga0495665_0000417 3300046531 Bacteria 21644
719 Ga0495665_0017434 3300046531 Bacteria 3862
720 Ga0495586_0026023 3300046535 Bacteria 3130
721 Ga0495586_0058220 3300046535 Bacteria 2098
722 Ga0495587_0053648 3300046536 Bacteria 2376
723 Ga0495587_0124784 3300046536 Bacteria 1473
724 Ga0495609_0007416 3300046538 Bacteria 5481
725 Ga0495609_0033190 3300046538 Bacteria 2343
726 Ga0495609_0078542 3300046538 Bacteria 1444
727 Ga0495609_0082892 3300046538 Bacteria 1400
728 Ga0495609_0113009 3300046538 Bacteria 1171
729 Ga0495609_0130084 3300046538 Bacteria 1078
730 Ga0495609_0168571 3300046538 Bacteria 925
731 Ga0495621_0061697 3300046539 Bacteria 1362
732 Ga0495597_0000038 3300046542 Bacteria 113027
733 Ga0495597_0002142 3300046542 Bacteria 13064
734 Ga0495597_0002168 3300046542 Bacteria 12887
735 Ga0495597_0010872 3300046542 Bacteria 4429
736 Ga0495597_0011852 3300046542 Bacteria 4220
737 Ga0495597_0031876 3300046542 Bacteria 2395
738 Ga0495597_0056093 3300046542 Bacteria 1726
739 Ga0495645_0097557 3300046543 Bacteria 2093
740 Ga0495645_0280327 3300046543 Bacteria 1096
741 Ga0495622_0012728 3300046557 Bacteria 3901
742 Ga0495622_0052125 3300046557 Bacteria 1898
743 Ga0495633_0011001 3300046558 Bacteria 4911
744 Ga0495633_0033063 3300046558 Bacteria 2495
745 Ga0495633_0219443 3300046558 Bacteria 870
746 Ga0495656_0031428 3300046615 Bacteria 2153
747 Ga0495656_0078973 3300046615 Bacteria 1480
748 Ga0495668_0002824 3300046616 Bacteria 13809
749 Ga0495668_0003288 3300046616 Bacteria 12264
750 Ga0495668_0012840 3300046616 Bacteria 4960
751 Ga0495668_0014100 3300046616 Bacteria 4696
752 Ga0495668_0047510 3300046616 Bacteria 2383
753 Ga0495668_0129337 3300046616 Bacteria 1382
754 Ga0495668_0247750 3300046616 Bacteria 975
755 Ga0495634_0006070 3300046642 Bacteria 9216
756 Ga0495611_0002451 3300046648 Bacteria 8473
757 Ga0495611_0004179 3300046648 Bacteria 6282
758 Ga0495611_0061992 3300046648 Bacteria 1700
759 Ga0495611_0097663 3300046648 Bacteria 1361
760 Ga0495625_0068216 3300046660 Bacteria 2501
761 Ga0495625_0068750 3300046660 Bacteria 2489
762 Ga0495625_0098544 3300046660 Bacteria 2010
763 Ga0495625_0356869 3300046660 Bacteria 922
764 Ga0495661_0001352 3300046665 Bacteria 20780
765 Ga0495661_0003089 3300046665 Bacteria 12500
766 Ga0495661_0012791 3300046665 Bacteria 5662
767 Ga0495661_0020551 3300046665 Bacteria 4308
768 Ga0495661_0034939 3300046665 Bacteria 3158
769 Ga0495588_0000059 3300046674 Bacteria 263358
770 Ga0495588_0103418 3300046674 Bacteria 1497
771 Ga0495588_0291559 3300046674 Bacteria 859
772 Ga0495623_0018892 3300046679 Bacteria 4450
773 Ga0495623_0237632 3300046679 Bacteria 1030
774 Ga0495646_0362796 3300046680 Bacteria 757
775 Ga0495658_0051716 3300046683 Bacteria 2328
776 Ga0495658_0191361 3300046683 Bacteria 1272
777 Ga0495669_0001076 3300046684 Bacteria 11355
778 Ga0495669_0001136 3300046684 Bacteria 11017
779 Ga0495669_0039918 3300046684 Bacteria 2079
780 Ga0495613_0026964 3300046689 Bacteria 4277
781 Ga0495670_0017930 3300046691 Bacteria 3486
782 Ga0495670_0040674 3300046691 Bacteria 2318
783 Ga0495671_0002191 3300046692 Bacteria 12437
784 Ga0495671_0009512 3300046692 Bacteria 5428
785 Ga0495649_0000401 3300046694 Bacteria 37516
786 Ga0495649_0001525 3300046694 Bacteria 17403
787 Ga0495649_0005324 3300046694 Bacteria 8208
788 Ga0495649_0034148 3300046694 Bacteria 2799
789 Ga0495649_0050486 3300046694 Bacteria 2257
790 Ga0495649_0308614 3300046694 Bacteria 804
791 Ga0495589_0001429 3300046794 Bacteria 13778
792 Ga0495589_0021536 3300046794 Bacteria 3293
793 Ga0495589_0041718 3300046794 Bacteria 2288
794 Ga0495589_0065875 3300046794 Bacteria 1775
795 Ga0495589_0094961 3300046794 Bacteria 1446
796 Ga0495660_0000610 3300046810 Bacteria 28168
797 Ga0495660_0008012 3300046810 Bacteria 6204
798 Ga0495660_0062788 3300046810 Bacteria 1990
799 Ga0495581_0002458 3300047315 Bacteria 10479
800 Ga0495581_0021512 3300047315 Bacteria 3737
801 Ga0495604_0008585 3300047317 Bacteria 8071
802 Ga0495636_0053259 3300047318 Bacteria 1699
803 Ga0495672_0004226 3300047320 Bacteria 11872
804 Ga0495672_0005753 3300047320 Bacteria 9763
805 Ga0495672_0006204 3300047320 Bacteria 9320
806 Ga0495672_0016628 3300047320 Bacteria 4947
807 Ga0495676_0039478 3300047321 Bacteria 3909
808 Ga0495680_0013436 3300047322 Bacteria 7144
809 Ga0495683_0001034 3300047323 Bacteria 19338
810 Ga0495683_0015345 3300047323 Bacteria 3987
811 Ga0495683_0062274 3300047323 Bacteria 1846
812 Ga0495683_0123876 3300047323 Bacteria 1224
813 Ga0495683_0164584 3300047323 Bacteria 1023
814 Ga0495687_000146 3300047443 Bacteria 107228
815 Ga0495687_000174 3300047443 Bacteria 95031
816 Ga0495687_001049 3300047443 Bacteria 27391
817 Ga0495687_002447 3300047443 Bacteria 14903
818 Ga0495687_002970 3300047443 Bacteria 12841
819 Ga0495687_009091 3300047443 Bacteria 5596
820 Ga0495675_0064564 3300047444 Bacteria 2315
821 Ga0495675_0135963 3300047444 Bacteria 1526
822 Ga0495677_0001082 3300047445 Bacteria 10920
823 Ga0495677_0002141 3300047445 Bacteria 7817
824 Ga0495677_0012628 3300047445 Bacteria 3078
825 Ga0495677_0014680 3300047445 Bacteria 2849
826 Ga0495677_0020707 3300047445 Bacteria 2383
827 Ga0495677_0042366 3300047445 Bacteria 1667
828 Ga0495677_0078618 3300047445 Bacteria 1234
829 Ga0495679_004496 3300047446 Bacteria 6405
830 Ga0495679_008174 3300047446 Bacteria 4280
831 Ga0495685_018894 3300047447 Bacteria 2366
832 Ga0495685_042494 3300047447 Bacteria 1551
833 Ga0495685_043831 3300047447 Bacteria 1526
834 Ga0495685_080966 3300047447 Bacteria 1081
835 Ga0495673_0003618 3300047469 Bacteria 10113
836 Ga0495681_0001847 3300047470 Bacteria 15559
837 Ga0495681_0002580 3300047470 Bacteria 12869
838 Ga0495681_0044613 3300047470 Bacteria 2128
839 Ga0495686_0000240 3300047472 Bacteria 99258
840 Ga0495686_0052459 3300047472 Bacteria 2557
841 Ga0495686_0269812 3300047472 Bacteria 949
842 Ga0495686_0381251 3300047472 Bacteria 760
843 Ga0495602_0008566 3300048088 Bacteria 10680
844 Ga0495614_0003072 3300048089 Bacteria 7434
845 Ga0495626_0000058 3300048091 Bacteria 147007
846 Ga0495626_0009749 3300048091 Bacteria 5175
847 Ga0495626_0010350 3300048091 Bacteria 4981
848 Ga0495626_0036691 3300048091 Bacteria 2333
849 Ga0495626_0088488 3300048091 Bacteria 1365
850 Ga0496102_0013788 3300048905 Bacteria 7011
851 Ga0496102_0096713 3300048905 Bacteria 2738
852 Ga0496102_0258365 3300048905 Bacteria 1642
853 Ga0496103_0015377 3300048906 Bacteria 4552
854 Ga0496103_0043644 3300048906 Bacteria 2761
855 Ga0496103_0143482 3300048906 Bacteria 1528
856 Ga0496103_0348406 3300048906 Bacteria 952
857 Ga0496104_0202086 3300048907 Bacteria 1899
858 Ga0496104_0593685 3300048907 Bacteria 1018
859 Ga0496104_0643176 3300048907 Bacteria 970
860 Ga0496105_0051253 3300048908 Bacteria 3410
861 Ga0496106_0003307 3300048909 Bacteria 12022
862 Ga0496106_0783229 3300048909 Bacteria 757
863 Ga0496107_0111117 3300048910 Bacteria 2014
864 Ga0496107_0187489 3300048910 Bacteria 1536
865 Ga0496108_0008901 3300048911 Bacteria 8138
866 Ga0496108_0032815 3300048911 Bacteria 4312
867 Ga0496108_0584994 3300048911 Bacteria 973
868 Ga0496109_0097368 3300048912 Bacteria 2727
869 Ga0496109_0175508 3300048912 Bacteria 2011
870 Ga0496110_0193882 3300048913 Bacteria 1845
871 Ga0496110_0456902 3300048913 Bacteria 1164
872 Ga0496110_1121206 3300048913 Bacteria 695
873 Ga0496111_0359722 3300048914 Bacteria 1077
874 Ga0496112_0522245 3300048915 Bacteria 1122
875 Ga0496112_1149775 3300048915 Bacteria 694
876 Ga0496113_0017014 3300048916 Bacteria 5037
877 Ga0496114_0141727 3300048917 Bacteria 2082
878 Ga0496114_0892102 3300048917 Bacteria 770
879 Ga0496115_0067339 3300048918 Bacteria 2896
880 Ga0496122_0021291 3300048925 Bacteria 5810
881 Ga0496123_0012930 3300048926 Bacteria 7059
882 Ga0496123_0143781 3300048926 Bacteria 1299
883 Ga0496124_0023780 3300048927 Bacteria 5585
884 Ga0501304_004113 3300049160 Bacteria 1095
885 Ga0495678_000146 3300049459 Bacteria 85995
886 Ga0495678_001792 3300049459 Bacteria 15868
887 Ga0495678_003975 3300049459 Bacteria 8841
888 Ga0495678_042532 3300049459 Bacteria 1810
889 Ga0495682_0004888 3300049460 Bacteria 5648
890 Ga0495682_0063271 3300049460 Bacteria 1334
891 Ga0495682_0116596 3300049460 Bacteria 957
892 Ga0501036_0181821 3300049572 Bacteria 1770
893 Ga0501043_0118611 3300049579 Bacteria 2075
894 Ga0501046_0011663 3300049580 Bacteria 7512
895 Ga0501047_0042109 3300049581 Bacteria 4413
896 Ga0501035_0012463 3300049822 Bacteria 7857
897 Ga0501044_0052615 3300049823 Bacteria 4195
898 nmdc:mga03683_165397_c1 3300050489 Bacteria 1004
899 nmdc:mga03683_21791_c1 3300050489 Bacteria 1093
900 nmdc:mga03683_6483_c1 3300050489 Bacteria 4010
901 nmdc:mga03n38_145997_c1 3300050490 Bacteria 1186
902 nmdc:mga03n38_163995_c1 3300050490 Bacteria 1127
903 nmdc:mga00v17_37254_c1 3300050491 Bacteria 2903
904 nmdc:mga0k408_1189_c1 3300050493 Bacteria 13937
905 nmdc:mga0k408_252228_c1 3300050493 Bacteria 1054
906 nmdc:mga0k408_343972_c1 3300050493 Bacteria 889
907 nmdc:mga0k408_360_c1 3300050493 Bacteria 25004
908 nmdc:mga0k408_3630_c1 3300050493 Bacteria 8166
909 nmdc:mga0k408_6365_c1 3300050493 Bacteria 6302
910 nmdc:mga06z11_255062_c1 3300050494 Bacteria 1034
911 nmdc:mga06z11_272001_c1 3300050494 Bacteria 1002
912 nmdc:mga04h51_121831_c1 3300050495 Bacteria 972
913 nmdc:mga07m45_1323_c1 3300050496 Bacteria 11285
914 nmdc:mga09592_161702_c1 3300050508 Bacteria 1934
915 nmdc:mga0qj67_327172_c1 3300050509 Bacteria 1240
916 nmdc:mga08y16_132737_c1 3300050511 Bacteria 2588
917 nmdc:mga0sz30_123724_c1 3300050516 Bacteria 1137
918 Ga0500578_0133823 3300053086 Bacteria 1553
919 Ga0500641_0058269 3300053096 Bacteria 1604
920 Ga0500650_0055189 3300053098 Bacteria 1850
921 Ga0500650_0101992 3300053098 Bacteria 1342
922 Ga0500658_0002943 3300053134 Bacteria 6536
923 Ga0500616_0197740 3300053153 Bacteria 893
924 Ga0500645_002171 3300053730 Bacteria 8985
925 Ga0500645_012633 3300053730 Bacteria 2727
926 Ga0500645_016743 3300053730 Bacteria 2305
927 Ga0500645_026767 3300053730 Bacteria 1753
928 Ga0587083_0012162 3300059505 Bacteria 1438
929 Ga0466962_0131293 3300061719 Bacteria 1210
930 2511246909 2511231002 Bacteria 5042903
931 2643797098 2643221556 Bacteria 7251154
932 2644469798 2643221684 Bacteria 7145183
933 2809147402 2808606418 Bacteria 6724496
934 2857552301 2857547612 Bacteria 6179999
935 8047676616 8047673197 Bacteria 7395230
936 Ga0070660_100272594
937 JGI25156J39149_1000005
938 JGI25154J39366_1000017
939 JGI25157J39369_1000003
940 JGI25157J39369_1000054
941 JGI25150J39212_1004275
942 JGI25159J45721_1001021
943 JGI25159J45721_1004551
944 JGI25151J46595_10010433
945 JGI25160J50197_1000904
946 JGI25161J50226_1000098
947 Ga0032354_1048063
948 Ga0055525_1000006
949 Ga0055526_1000687
950 Ga0055526_1018534
951 Ga0055537_1001789
952 Ga0055537_1019896
953 Ga0055524_1000111
954 Ga0055536_1009963
955 Ga0055536_1022523
956 Ga0055534_1004295
957 Ga0055528_1002416
958 Ga0055530_10003020
959 Ga0055530_10053716
960 Ga0055540_1000059
961 Ga0055531_10001080
962 Ga0055531_10001578
963 Ga0055543_1000144
964 Ga0065165_1014482
965 Ga0065165_1014526
966 Ga0065165_1018270
967 Ga0065165_1036589
968 Ga0065715_10527971
969 Ga0070658_10225337
970 Ga0070658_10699872
971 Ga0070676_10013766
972 Ga0070690_100024780
973 Ga0070670_100006305
974 Ga0070670_100116637
975 Ga0070670_100123059
976 Ga0070670_100368834
977 Ga0070677_10150498
978 Ga0068869_100064225
979 Ga0068869_100108635
980 Ga0070666_10085414
981 Ga0070666_10253567
982 Ga0070666_10295264
983 Ga0070666_10397516
984 Ga0070680_100027256
985 Ga0070680_100068768
986 Ga0068868_100018409
987 Ga0068868_100108205
988 Ga0068868_100282759
989 Ga0068868_100398368
990 Ga0070660_100002557
991 Ga0070660_100009788
992 Ga0070689_100000624
993 Ga0070689_100199393
994 Ga0070687_100035247
995 Ga0070661_100071272
996 Ga0070668_100230863
997 Ga0070668_100238038
998 Ga0070668_100411477
999 Ga0070669_100065706
1000 Ga0070669_100171152
1001 Ga0070669_100326072
1002 Ga0070669_100334658
1003 Ga0070675_100014471
1004 Ga0070675_100139096
1005 Ga0070675_100217508
1006 Ga0070675_100435111
1007 Ga0070671_100185860
1008 Ga0070671_100345424
1009 Ga0070674_100136852
1010 Ga0070674_100402961
1011 Ga0070674_100511777
1012 Ga0070673_100031836
1013 Ga0070673_100110895
1014 Ga0070673_100290085
1015 Ga0070673_100292640
1016 Ga0070659_100006694
1017 Ga0070659_100961633
1018 Ga0070667_100007815
1019 Ga0070667_100009258
1020 Ga0070667_100219092
1021 Ga0070667_100317055
1022 Ga0070667_100380306
1023 Ga0070709_10025893
1024 Ga0070701_10306550
1025 Ga0070663_100034987
1026 Ga0070663_100133030
1027 Ga0070678_100007969
1028 Ga0070678_100259245
1029 Ga0070662_100014951
1030 Ga0070662_100085270
1031 Ga0070662_100106904
1032 Ga0070662_100171761
1033 Ga0070662_100909080
1034 Ga0070681_10108402
1035 Ga0068867_100080860
1036 Ga0068867_100181061
1037 Ga0068867_100223528
1038 Ga0068867_100700712
1039 Ga0070706_100006620
1040 Ga0070707_100038174
1041 Ga0068853_100015198
1042 Ga0068853_100421537
1043 Ga0068853_100528825
1044 Ga0068853_100597820
1045 Ga0068853_100701297
1046 Ga0070672_100031116
1047 Ga0070672_100063689
1048 Ga0070672_100104446
1049 Ga0070672_100105106
1050 Ga0070672_100303104
1051 Ga0070672_100312006
1052 Ga0070672_100596830
1053 Ga0070672_100636700
1054 Ga0070686_100133490
1055 Ga0070693_100007174
1056 Ga0070665_100065950
1057 Ga0068855_100013718
1058 Ga0068855_100042439
1059 Ga0068855_100095346
1060 Ga0068855_100420597
1061 Ga0070664_100080541
1062 Ga0070664_100120831
1063 Ga0070664_100255061
1064 Ga0070664_100482413
1065 Ga0070664_100604099
1066 Ga0068857_100248419
1067 Ga0068856_100037428
1068 Ga0068856_100042007
1069 Ga0068856_100204026
1070 Ga0068856_100236318
1071 Ga0068856_100393020
1072 Ga0068856_100530192
1073 Ga0068852_100011576
1074 Ga0068852_100042300
1075 Ga0068852_100045985
1076 Ga0068852_100162631
1077 Ga0068852_100192386
1078 Ga0068852_100558651
1079 Ga0068859_100039064
1080 Ga0068859_100065307
1081 Ga0068859_100234388
1082 Ga0068859_100394040
1083 Ga0068864_100013754
1084 Ga0068864_100019788
1085 Ga0068864_100707622
1086 Ga0068866_10257098
1087 Ga0068861_100002738
1088 Ga0068861_100031672
1089 Ga0068861_100056852
1090 Ga0068851_10025723
1091 Ga0068851_10124697
1092 Ga0068851_10309789
1093 Ga0068863_100020785
1094 Ga0068863_100137358
1095 Ga0068863_100242578
1096 Ga0068863_100436673
1097 Ga0068863_100763049
1098 Ga0068858_100001185
1099 Ga0068858_100034648
1100 Ga0068858_100113584
1101 Ga0068860_100004815
1102 Ga0068860_100026517
1103 Ga0068860_100034324
1104 Ga0068860_100154427
1105 Ga0068860_100604203
1106 Ga0068862_100047648
1107 Ga0068862_100180853
1108 Ga0075368_10018128
1109 Ga0075368_10113227
1110 Ga0075368_10127234
1111 Ga0075363_100026519
1112 Ga0075363_100210630
1113 Ga0075363_100224502
1114 Ga0075363_100327878
1115 Ga0075364_10041436
1116 Ga0075364_10041630
1117 Ga0075364_10245141
1118 Ga0075432_10012582
1119 Ga0070712_100109979
1120 Ga0075362_10058601
1121 Ga0075367_10026044
1122 Ga0075367_10026896
1123 Ga0075367_10185800
1124 Ga0075366_10001380
1125 Ga0075366_10019684
1126 Ga0075366_10027839
1127 Ga0075366_10043612
1128 Ga0075366_10077278
1129 Ga0075366_10083628
1130 Ga0075366_10276674
1131 Ga0075366_10348202
1132 Ga0097621_100171187
1133 Ga0097621_100209765
1134 Ga0075370_10040034
1135 Ga0075370_10293335
1136 Ga0068871_100094146
1137 Ga0068871_100123953
1138 Ga0075430_100117398
1139 Ga0068865_100031610
1140 Ga0068865_100107097
1141 Ga0068865_100609721
1142 Ga0097620_100039061
1143 Ga0097620_100065308
1144 Ga0097620_100234381
1145 Ga0097620_100394034
1146 Ga0079104_1006920
1147 Ga0099826_10083699
1148 Ga0105240_10002070
1149 Ga0105240_10123742
1150 Ga0105240_10644699
1151 Ga0111539_10215275
1152 Ga0105245_10206809
1153 Ga0105245_10341275
1154 Ga0105243_10354089
1155 Ga0105243_10446156
1156 Ga0105241_10020687
1157 Ga0105241_10129050
1158 Ga0105241_10855172
1159 Ga0105242_10118759
1160 Ga0105242_10690301
1161 Ga0105248_10065552
1162 Ga0105248_10088911
1163 Ga0105248_10217938
1164 Ga0105248_10244015
1165 Ga0105248_10538103
1166 Ga0105237_10022027
1167 Ga0105237_10064875
1168 Ga0105238_10077712
1169 Ga0105238_10157136
1170 Ga0105238_10467490
1171 Ga0105249_10022314
1172 Ga0105249_10413675
1173 Ga0105249_10623764
1174 Ga0105239_10068683
1175 Ga0105239_10379575
1176 Ga0105239_10831227
1177 Ga0105239_11076803
1178 Ga0157373_10018543
1179 Ga0157371_10086471
1180 Ga0157371_10228487
1181 Ga0157370_10273944
1182 Ga0157369_10192610
1183 Ga0157369_10617220
1184 Ga0157374_10127551
1185 Ga0157374_10275973
1186 Ga0157374_10779375
1187 Ga0157378_10072895
1188 Ga0163162_10059623
1189 Ga0163162_10118583
1190 Ga0163162_10151222
1191 Ga0163162_10318675
1192 Ga0163162_10394781
1193 Ga0163162_11029133
1194 Ga0157372_10178311
1195 Ga0157372_10275812
1196 Ga0157372_10311104
1197 Ga0157372_10324813
1198 Ga0157375_10049453
1199 Ga0157375_10052547
1200 Ga0157375_10187658
1201 Ga0157375_10222778
1202 Ga0157375_10389776
1203 Ga0157375_10419655
1204 Ga0157375_10422967
1205 Ga0163163_10024646
1206 Ga0163163_10049795
1207 Ga0157380_10001295
1208 Ga0157380_10064987
1209 Ga0157380_10072977
1210 Ga0157380_10078486
1211 Ga0157377_10042238
1212 Ga0157379_10031145
1213 Ga0157379_10077699
1214 Ga0157379_10090193
1215 Ga0157379_10101526
1216 Ga0157379_10105494
1217 Ga0157379_10266754
1218 Ga0157379_10303119
1219 Ga0157379_10923074
1220 Ga0157376_10002116
1221 Ga0157376_10038774
1222 Ga0157376_10071904
1223 Ga0157376_10509087
1224 Ga0157376_10719139
1225 Ga0182006_1083651
1226 Ga0163161_10074141
1227 Ga0163161_10172145
1228 Ga0163161_10214799
1229 Ga0163161_10323631
1230 Ga0163161_10502091
1231 Ga0209435_100002
1232 Ga0209563_100022
1233 Ga0207425_1002730
1234 Ga0207425_1003093
1235 Ga0209646_1000001
1236 Ga0209026_1000001
1237 Ga0209677_102311
1238 Ga0209759_1000001
1239 Ga0209129_1008061
1240 Ga0209565_1000016
1241 Ga0209565_1000923
1242 Ga0209673_1000008
1243 Ga0209130_1000104
1244 Ga0209130_1000161
1245 Ga0209130_1028024
1246 Ga0209675_1000099
1247 Ga0209675_1001851
1248 Ga0209675_1011520
1249 Ga0209676_1000023
1250 Ga0209676_1002377
1251 Ga0209025_1006841
1252 Ga0209025_1010184
1253 Ga0209025_1029251
1254 Ga0209564_1000555
1255 Ga0209564_1002809
1256 Ga0209758_1018095
1257 Ga0209050_1000022
1258 Ga0209050_1021294
1259 Ga0209050_1028106
1260 Ga0209256_1000001
1261 Ga0209256_1014236
1262 Ga0207426_1000156
1263 Ga0207426_1001121
1264 Ga0209051_1000013
1265 Ga0209257_1000042
1266 Ga0209257_1005881
1267 Ga0207656_10046409
1268 Ga0207656_10138562
1269 Ga0207655_1092064
1270 Ga0207682_10031528
1271 Ga0207682_10040018
1272 Ga0207682_10046967
1273 Ga0207642_10087850
1274 Ga0207688_10051169
1275 Ga0207680_10008314
1276 Ga0207680_10025898
1277 Ga0207680_10065415
1278 Ga0207680_10404619
1279 Ga0207699_10097406
1280 Ga0207645_10003724
1281 Ga0207645_10019669
1282 Ga0207643_10304639
1283 Ga0207705_10011758
1284 Ga0207705_10051365
1285 Ga0207705_10135912
1286 Ga0207705_10167930
1287 Ga0207705_10465415
1288 Ga0207684_10000714
1289 Ga0207654_10007718
1290 Ga0207654_10055478
1291 Ga0207695_10026604
1292 Ga0207695_10153021
1293 Ga0207695_10354456
1294 Ga0207671_10051806
1295 Ga0207671_10137781
1296 Ga0207693_10022272
1297 Ga0207663_10227436
1298 Ga0207660_10053451
1299 Ga0207662_10044666
1300 Ga0207662_10056513
1301 Ga0207662_10077373
1302 Ga0207657_10006245
1303 Ga0207657_10006432
1304 Ga0207657_10017764
1305 Ga0207657_10169575
1306 Ga0207657_10185157
1307 Ga0207657_10469957
1308 Ga0207649_10090317
1309 Ga0207649_10414651
1310 Ga0207649_10549636
1311 Ga0207649_10599679
1312 Ga0207652_10051193
1313 Ga0207652_10081838
1314 Ga0207652_10976883
1315 Ga0207646_10576156
1316 Ga0207681_10006662
1317 Ga0207681_10196498
1318 Ga0207681_10213240
1319 Ga0207681_10635375
1320 Ga0207694_10043930
1321 Ga0207694_10104234
1322 Ga0207650_10000680
1323 Ga0207650_10019281
1324 Ga0207650_10159413
1325 Ga0207650_10168742
1326 Ga0207659_10028246
1327 Ga0207659_10225077
1328 Ga0207687_10213141
1329 Ga0207687_10333001
1330 Ga0207644_10037119
1331 Ga0207644_10280584
1332 Ga0207690_10361500
1333 Ga0207690_10628490
1334 Ga0207706_10005882
1335 Ga0207706_10102249
1336 Ga0207706_10195211
1337 Ga0207686_10025634
1338 Ga0207709_10370529
1339 Ga0207670_10050971
1340 Ga0207669_10004122
1341 Ga0207704_10215709
1342 Ga0207704_10380962
1343 Ga0207691_10010380
1344 Ga0207691_10024632
1345 Ga0207691_10033480
1346 Ga0207691_10057116
1347 Ga0207691_10074408
1348 Ga0207691_10118166
1349 Ga0207691_10300645
1350 Ga0207711_10014147
1351 Ga0207711_10026013
1352 Ga0207711_10256528
1353 Ga0207711_10778621
1354 Ga0207689_10099857
1355 Ga0207689_10280123
1356 Ga0207689_10294495
1357 Ga0207661_10045183
1358 Ga0207679_10032033
1359 Ga0207679_10090050
1360 Ga0207679_10163686
1361 Ga0207679_10324085
1362 Ga0207679_10450481
1363 Ga0207667_10020314
1364 Ga0207667_10063367
1365 Ga0207667_10071410
1366 Ga0207667_10140766
1367 Ga0207667_10439969
1368 Ga0207667_10497225
1369 Ga0207651_10013033
1370 Ga0207651_10102907
1371 Ga0207668_10005465
1372 Ga0207668_10060655
1373 Ga0207668_10086208
1374 Ga0207668_10519152
1375 Ga0207640_10296328
1376 Ga0207640_10366628
1377 Ga0207658_10009315
1378 Ga0207658_10012592
1379 Ga0207658_10605997
1380 Ga0207677_10008465
1381 Ga0207677_10100771
1382 Ga0207677_10169391
1383 Ga0207677_10429130
1384 Ga0207677_10497277
1385 Ga0207703_10122841
1386 Ga0207703_10191042
1387 Ga0207639_10038545
1388 Ga0207639_10110468
1389 Ga0207639_10129500
1390 Ga0207639_10354551
1391 Ga0207639_10475342
1392 Ga0207639_10610632
1393 Ga0207639_10669502
1394 Ga0207639_10783503
1395 Ga0207678_10022150
1396 Ga0207678_10072306
1397 Ga0207678_10125445
1398 Ga0207678_10162233
1399 Ga0207678_10237600
1400 Ga0207678_10484780
1401 Ga0207708_10001498
1402 Ga0207708_10023675
1403 Ga0207702_10073004
1404 Ga0207702_10141102
1405 Ga0207702_10573578
1406 Ga0207702_10906079
1407 Ga0207641_10002127
1408 Ga0207641_10006110
1409 Ga0207641_10023137
1410 Ga0207641_10161619
1411 Ga0207648_10018058
1412 Ga0207648_10052892
1413 Ga0207648_10068675
1414 Ga0207648_10128996
1415 Ga0207648_10680334
1416 Ga0207648_10796090
1417 Ga0207676_10011792
1418 Ga0207676_10016687
1419 Ga0207676_10180031
1420 Ga0207674_10117751
1421 Ga0207674_10282263
1422 Ga0207675_100006084
1423 Ga0207675_100034556
1424 Ga0207675_100191173
1425 Ga0207675_100199544
1426 Ga0207683_10024352
1427 Ga0207683_10308206
1428 Ga0207683_10417148
1429 Ga0207698_10023051
1430 Ga0207698_10056283
1431 Ga0207698_10088371
1432 Ga0207698_10103288
1433 Ga0207698_10165058
1434 Ga0207698_10222983
1435 Ga0207698_10557547
1436 Ga0207698_10628705
1437 Ga0207698_10660150
1438 Ga0209281_1007740
1439 Ga0268266_10197381
1440 Ga0268265_10021553
1441 Ga0268265_10333911
1442 Ga0268265_10499498
1443 Ga0268264_10022298
1444 Ga0268264_10101692
1445 Ga0268264_10162451
1446 Ga0268264_10284382
1447 Ga0307515_10386323
1448 Ga0265332_10005179
1449 Ga0265331_10100709
1450 Ga0265327_10000147
1451 Ga0307513_10000038
1452 Ga0307408_100005019
1453 Ga0307408_100185949
1454 Ga0307508_10011561
1455 Ga0307514_10219979
1456 Ga0265314_10004558
1457 Ga0265342_10170590
1458 Ga0307516_10072178
1459 Ga0307405_10482915
1460 Ga0307413_10504703
1461 Ga0307406_10028586
1462 Ga0307412_10403397
1463 Ga0307412_10468455
1464 Ga0307409_100001596
1465 Ga0307416_100012247
1466 Ga0307416_100142552
1467 Ga0307415_100000346
1468 Ga0373942_0171038
1469 Ga0373931_0000300
1470 Ga0373931_0097185
1471 Ga0373935_0235596
1472 Ga0373935_0307557
1473 Ga0373937_0205232
1474 Ga0373937_0233417
1475 Ga0373937_0707173
1476 Ga0373925_0150218
1477 Ga0373925_0351948
1478 Ga0395899_0005223
1479 Ga0395899_0029143
1480 Ga0395899_0067036
1481 Ga0395899_0090559
1482 Ga0395900_0013506
1483 Ga0395900_0024828
1484 Ga0395900_0053083
1485 Ga0395900_0068694
1486 Ga0395900_0131330
1487 Ga0395900_0136448
1488 Ga0395900_0148594
1489 Ga0395900_0265889
1490 Ga0395900_0286769
1491 Ga0395900_1008186
1492 Ga0395898_0014120
1493 Ga0395898_0048219
1494 Ga0395898_0084143
1495 Ga0395898_0271496
1496 Ga0395905_0001406
1497 Ga0395905_0063052
1498 Ga0395905_0088556
1499 Ga0395905_0105995
1500 Ga0395905_0140028
1501 Ga0395905_0180643
1502 Ga0395905_0196292
1503 Ga0395905_0557024
1504 Ga0395901_0041433
1505 Ga0395901_0097087
1506 Ga0395901_0177094
1507 Ga0395901_0179643
1508 Ga0395901_0191123
1509 Ga0395901_0300754
1510 Ga0395901_0326044
1511 Ga0395901_0380636
1512 Ga0395901_1104704
1513 Ga0451807_2210824
1514 Ga0451835_1109056
1515 Ga0439433_0026758
1516 Ga0439448_0000585
1517 Ga0439449_0029676
1518 Ga0439450_021047
1519 Ga0439455_0031602
1520 Ga0450903_013516
1521 Ga0451577_0011213
1522 Ga0466969_0071528
1523 Ga0466972_0140292
1524 Ga0453683_0001915
1525 Ga0453683_0005625
1526 Ga0466965_0000612
1527 Ga0466965_0054489
1528 Ga0466966_0016157
1529 Ga0466966_0070888
1530 Ga0466966_0101534
1531 Ga0466966_0157064
1532 Ga0466963_0076777
1533 Ga0466964_0007906
1534 Ga0453684_0232843
1535 Ga0466970_0233824
1536 Ga0466957_0000323
1537 Ga0466957_0007570
1538 Ga0466957_0051695
1539 Ga0466959_0032599
1540 Ga0466959_0035301
1541 Ga0466959_0041813
1542 Ga0451576_0002636
1543 Ga0451576_0006746
1544 Ga0451576_0020764
1545 Ga0451576_0697400
1546 Ga0466958_0073580
1547 Ga0466958_0292432
1548 Ga0466967_0020822
1549 Ga0466967_0025547
1550 Ga0495617_000046
1551 Ga0495627_001455
1552 Ga0495627_020297
1553 Ga0495590_0000144
1554 Ga0495590_0034882
1555 Ga0495591_000444
1556 Ga0495591_036948
1557 Ga0495638_0064750
1558 Ga0495653_0122229
1559 Ga0495650_0000248
1560 Ga0495650_0000825
1561 Ga0495650_0006291
1562 Ga0495650_0017149
1563 Ga0495580_0039286
1564 Ga0495582_0009309
1565 Ga0495605_0003469
1566 Ga0495605_0007418
1567 Ga0495605_0009661
1568 Ga0495605_0058448
1569 Ga0495584_0002608
1570 Ga0495584_0008298
1571 Ga0495584_0026763
1572 Ga0495584_0027184
1573 Ga0495584_0068327
1574 Ga0495584_0089944
1575 Ga0495585_0000380
1576 Ga0495585_0021715
1577 Ga0495585_0069006
1578 Ga0495594_0007112
1579 Ga0495596_0000955
1580 Ga0495596_0004609
1581 Ga0495596_0015566
1582 Ga0495596_0021141
1583 Ga0495596_0021462
1584 Ga0495607_0002356
1585 Ga0495607_0011324
1586 Ga0495607_0012235
1587 Ga0495607_0025769
1588 Ga0495607_0029860
1589 Ga0495607_0029921
1590 Ga0495607_0046386
1591 Ga0495607_0109731
1592 Ga0495583_0009058
1593 Ga0495583_0010736
1594 Ga0495583_0085688
1595 Ga0495583_0087528
1596 Ga0495583_0143884
1597 Ga0495606_0309779
1598 Ga0495610_0000331
1599 Ga0495616_0002503
1600 Ga0495616_0010413
1601 Ga0495616_0019536
1602 Ga0495616_0042857
1603 Ga0495616_0060158
1604 Ga0495616_0129558
1605 Ga0495616_0140709
1606 Ga0495630_0571396
1607 Ga0495631_0006224
1608 Ga0495631_0011979
1609 Ga0495631_0014477
1610 Ga0495631_0018273
1611 Ga0495631_0060139
1612 Ga0495631_0061239
1613 Ga0495632_0000280
1614 Ga0495632_0002237
1615 Ga0495632_0003131
1616 Ga0495632_0005246
1617 Ga0495632_0008312
1618 Ga0495632_0033797
1619 Ga0495632_0047013
1620 Ga0495637_0000029
1621 Ga0495637_0022477
1622 Ga0495637_0044319
1623 Ga0495643_0000514
1624 Ga0495643_0003982
1625 Ga0495643_0024993
1626 Ga0495643_0044633
1627 Ga0495643_0062232
1628 Ga0495643_0209672
1629 Ga0495644_0003853
1630 Ga0495644_0028033
1631 Ga0495644_0031087
1632 Ga0495644_0066157
1633 Ga0495648_0001486
1634 Ga0495648_0007529
1635 Ga0495648_0010091
1636 Ga0495648_0013250
1637 Ga0495648_0052908
1638 Ga0495648_0110232
1639 Ga0495666_0003799
1640 Ga0495642_0000726
1641 Ga0495642_0000987
1642 Ga0495642_0001846
1643 Ga0495642_0008902
1644 Ga0495642_0016964
1645 Ga0495642_0097744
1646 Ga0495642_0168755
1647 Ga0495642_0217338
1648 Ga0495654_0004629
1649 Ga0495654_0006758
1650 Ga0495654_0021303
1651 Ga0495654_0057046
1652 Ga0495654_0174570
1653 Ga0495665_0000417
1654 Ga0495665_0017434
1655 Ga0495586_0026023
1656 Ga0495586_0058220
1657 Ga0495587_0053648
1658 Ga0495587_0124784
1659 Ga0495609_0007416
1660 Ga0495609_0033190
1661 Ga0495609_0078542
1662 Ga0495609_0082892
1663 Ga0495609_0113009
1664 Ga0495609_0130084
1665 Ga0495609_0168571
1666 Ga0495621_0061697
1667 Ga0495597_0000038
1668 Ga0495597_0002142
1669 Ga0495597_0002168
1670 Ga0495597_0010872
1671 Ga0495597_0011852
1672 Ga0495597_0031876
1673 Ga0495597_0056093
1674 Ga0495645_0097557
1675 Ga0495645_0280327
1676 Ga0495622_0012728
1677 Ga0495622_0052125
1678 Ga0495633_0011001
1679 Ga0495633_0033063
1680 Ga0495633_0219443
1681 Ga0495656_0031428
1682 Ga0495656_0078973
1683 Ga0495668_0002824
1684 Ga0495668_0003288
1685 Ga0495668_0012840
1686 Ga0495668_0014100
1687 Ga0495668_0047510
1688 Ga0495668_0129337
1689 Ga0495668_0247750
1690 Ga0495634_0006070
1691 Ga0495611_0002451
1692 Ga0495611_0004179
1693 Ga0495611_0061992
1694 Ga0495611_0097663
1695 Ga0495625_0068216
1696 Ga0495625_0068750
1697 Ga0495625_0098544
1698 Ga0495625_0356869
1699 Ga0495661_0001352
1700 Ga0495661_0003089
1701 Ga0495661_0012791
1702 Ga0495661_0020551
1703 Ga0495661_0034939
1704 Ga0495588_0000059
1705 Ga0495588_0103418
1706 Ga0495588_0291559
1707 Ga0495623_0018892
1708 Ga0495623_0237632
1709 Ga0495646_0362796
1710 Ga0495658_0051716
1711 Ga0495658_0191361
1712 Ga0495669_0001076
1713 Ga0495669_0001136
1714 Ga0495669_0039918
1715 Ga0495613_0026964
1716 Ga0495670_0017930
1717 Ga0495670_0040674
1718 Ga0495671_0002191
1719 Ga0495671_0009512
1720 Ga0495649_0000401
1721 Ga0495649_0001525
1722 Ga0495649_0005324
1723 Ga0495649_0034148
1724 Ga0495649_0050486
1725 Ga0495649_0308614
1726 Ga0495589_0001429
1727 Ga0495589_0021536
1728 Ga0495589_0041718
1729 Ga0495589_0065875
1730 Ga0495589_0094961
1731 Ga0495660_0000610
1732 Ga0495660_0008012
1733 Ga0495660_0062788
1734 Ga0495581_0002458
1735 Ga0495581_0021512
1736 Ga0495604_0008585
1737 Ga0495636_0053259
1738 Ga0495672_0004226
1739 Ga0495672_0005753
1740 Ga0495672_0006204
1741 Ga0495672_0016628
1742 Ga0495676_0039478
1743 Ga0495680_0013436
1744 Ga0495683_0001034
1745 Ga0495683_0015345
1746 Ga0495683_0062274
1747 Ga0495683_0123876
1748 Ga0495683_0164584
1749 Ga0495687_000146
1750 Ga0495687_000174
1751 Ga0495687_001049
1752 Ga0495687_002447
1753 Ga0495687_002970
1754 Ga0495687_009091
1755 Ga0495675_0064564
1756 Ga0495675_0135963
1757 Ga0495677_0001082
1758 Ga0495677_0002141
1759 Ga0495677_0012628
1760 Ga0495677_0014680
1761 Ga0495677_0020707
1762 Ga0495677_0042366
1763 Ga0495677_0078618
1764 Ga0495679_004496
1765 Ga0495679_008174
1766 Ga0495685_018894
1767 Ga0495685_042494
1768 Ga0495685_043831
1769 Ga0495685_080966
1770 Ga0495673_0003618
1771 Ga0495681_0001847
1772 Ga0495681_0002580
1773 Ga0495681_0044613
1774 Ga0495686_0000240
1775 Ga0495686_0052459
1776 Ga0495686_0269812
1777 Ga0495686_0381251
1778 Ga0495602_0008566
1779 Ga0495614_0003072
1780 Ga0495626_0000058
1781 Ga0495626_0009749
1782 Ga0495626_0010350
1783 Ga0495626_0036691
1784 Ga0495626_0088488
1785 Ga0496102_0013788
1786 Ga0496102_0096713
1787 Ga0496102_0258365
1788 Ga0496103_0015377
1789 Ga0496103_0043644
1790 Ga0496103_0143482
1791 Ga0496103_0348406
1792 Ga0496104_0202086
1793 Ga0496104_0593685
1794 Ga0496104_0643176
1795 Ga0496105_0051253
1796 Ga0496106_0003307
1797 Ga0496106_0783229
1798 Ga0496107_0111117
1799 Ga0496107_0187489
1800 Ga0496108_0008901
1801 Ga0496108_0032815
1802 Ga0496108_0584994
1803 Ga0496109_0097368
1804 Ga0496109_0175508
1805 Ga0496110_0193882
1806 Ga0496110_0456902
1807 Ga0496110_1121206
1808 Ga0496111_0359722
1809 Ga0496112_0522245
1810 Ga0496112_1149775
1811 Ga0496113_0017014
1812 Ga0496114_0141727
1813 Ga0496114_0892102
1814 Ga0496115_0067339
1815 Ga0496122_0021291
1816 Ga0496123_0012930
1817 Ga0496123_0143781
1818 Ga0496124_0023780
1819 Ga0501304_004113
1820 Ga0495678_000146
1821 Ga0495678_001792
1822 Ga0495678_003975
1823 Ga0495678_042532
1824 Ga0495682_0004888
1825 Ga0495682_0063271
1826 Ga0495682_0116596
1827 Ga0501036_0181821
1828 Ga0501043_0118611
1829 Ga0501046_0011663
1830 Ga0501047_0042109
1831 Ga0501035_0012463
1832 Ga0501044_0052615
1833 nmdc:mga03683_165397_c1
1834 nmdc:mga03683_21791_c1
1835 nmdc:mga03683_6483_c1
1836 nmdc:mga03n38_145997_c1
1837 nmdc:mga03n38_163995_c1
1838 nmdc:mga00v17_37254_c1
1839 nmdc:mga0k408_1189_c1
1840 nmdc:mga0k408_252228_c1
1841 nmdc:mga0k408_343972_c1
1842 nmdc:mga0k408_360_c1
1843 nmdc:mga0k408_3630_c1
1844 nmdc:mga0k408_6365_c1
1845 nmdc:mga06z11_255062_c1
1846 nmdc:mga06z11_272001_c1
1847 nmdc:mga04h51_121831_c1
1848 nmdc:mga07m45_1323_c1
1849 nmdc:mga09592_161702_c1
1850 nmdc:mga0qj67_327172_c1
1851 nmdc:mga08y16_132737_c1
1852 nmdc:mga0sz30_123724_c1
1853 Ga0500578_0133823
1854 Ga0500641_0058269
1855 Ga0500650_0055189
1856 Ga0500650_0101992
1857 Ga0500658_0002943
1858 Ga0500616_0197740
1859 Ga0500645_002171
1860 Ga0500645_012633
1861 Ga0500645_016743
1862 Ga0500645_026767
1863 Ga0587083_0012162
1864 Ga0466962_0131293
1865 2511246909
1866 2643797098
1867 2644469798
1868 2809147402
1869 2857552301
1870 8047676616

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03232

COQ7

Ubiquinone biosynthesis protein COQ7

91

252

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sss-assembly1.cif.gz_H structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy 0.8827 44 209
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.8685 45 209
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.8569 44 181
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.8538 45 209
7sss-assembly1.cif.gz_H structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy 0.8448 44 209
ID Description Score Start End Superfamily
af_Q54VB3_38_194_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9401 42 184 1.20.1260.10
af_Q9W3W4_54_201_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9052 51 189 1.20.1260.10
af_P41735_52_233_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.8784 48 209 3.15.10.10
af_Q4E674_25_205_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8773 47 209 1.20.1260.10
af_Q54VB3_38_194_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8542 42 184 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1J5P641-F1-model_v4 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) 0.9954 60 209 GO:0004497
GO:0005886
GO:0006744
GO:0046872
AF-A0A7I8BNG7-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9929 39 209 GO:0005886
GO:0006744
GO:0008682
GO:0046872
AF-A0A4S3KL16-F1-model_v4 Demethoxyubiquinone hydroxylase family protein 0.9927 50 209 GO:0004497
GO:0005886
GO:0006744
GO:0046872
AF-A0A3B9XXC9-F1-model_v4 Demethoxyubiquinone hydroxylase family protein 0.9915 43 209 GO:0004497
GO:0005886
GO:0006744
GO:0046872
AF-A0A1H7SPT3-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9894 26 209 GO:0005886
GO:0006744
GO:0008682
GO:0046872

Map