F486146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 372 | 1870 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100272594|Ga0070660_1002725941 |
| Length | 255 |
| Sequence | VYCTRAFRGWKALPDKKRPYVVSAQRGIRRTLGAPAAILPTVLSSVRLSPADRVLAAIDHALRALSTTPQPARPKPLASQPESSLDEVERREAGALMRVNHVGEVCAQALYSAQALATSDPQLRRQFQQAAAEETDHLAWTAERLAELGARPSLLNPLWYAGAFAIGLVAARTGDARSLGFLVETERQVEQHLXXXXDRLPAADASSRAIVAQMRDDEAAHAMAAERAGATALPLPVRWAMRAAAKVMTTTAHYV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 368 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 369 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 370 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 371 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 372 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.32 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.66 |
| Nodule | 0.32 |
| Rhizoplane | 3.32 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100272594 | 3300005339 | Bacteria | 1383 |
| 2 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 3 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 4 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 5 | JGI25157J39369_1000054 | 3300002741 | Bacteria | 108825 |
| 6 | JGI25150J39212_1004275 | 3300002774 | Bacteria | 3201 |
| 7 | JGI25159J45721_1001021 | 3300002987 | Bacteria | 12039 |
| 8 | JGI25159J45721_1004551 | 3300002987 | Bacteria | 4577 |
| 9 | JGI25151J46595_10010433 | 3300003187 | Bacteria | 4318 |
| 10 | JGI25160J50197_1000904 | 3300003354 | Bacteria | 15618 |
| 11 | JGI25161J50226_1000098 | 3300003374 | Bacteria | 71121 |
| 12 | Ga0032354_1048063 | 3300003693 | Bacteria | 1266 |
| 13 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 14 | Ga0055526_1000687 | 3300003771 | Bacteria | 25833 |
| 15 | Ga0055526_1018534 | 3300003771 | Bacteria | 2593 |
| 16 | Ga0055537_1001789 | 3300003773 | Bacteria | 7836 |
| 17 | Ga0055537_1019896 | 3300003773 | Bacteria | 1032 |
| 18 | Ga0055524_1000111 | 3300003775 | Bacteria | 96812 |
| 19 | Ga0055536_1009963 | 3300003781 | Bacteria | 3845 |
| 20 | Ga0055536_1022523 | 3300003781 | Bacteria | 1878 |
| 21 | Ga0055534_1004295 | 3300003784 | Bacteria | 4178 |
| 22 | Ga0055528_1002416 | 3300003790 | Bacteria | 10034 |
| 23 | Ga0055530_10003020 | 3300003791 | Bacteria | 10068 |
| 24 | Ga0055530_10053716 | 3300003791 | Bacteria | 924 |
| 25 | Ga0055540_1000059 | 3300003792 | Bacteria | 132075 |
| 26 | Ga0055531_10001080 | 3300003794 | Bacteria | 21409 |
| 27 | Ga0055531_10001578 | 3300003794 | Bacteria | 16647 |
| 28 | Ga0055543_1000144 | 3300004625 | Bacteria | 59417 |
| 29 | Ga0065165_1014482 | 3300005262 | Bacteria | 3059 |
| 30 | Ga0065165_1014526 | 3300005262 | Bacteria | 3052 |
| 31 | Ga0065165_1018270 | 3300005262 | Bacteria | 2544 |
| 32 | Ga0065165_1036589 | 3300005262 | Bacteria | 1496 |
| 33 | Ga0065715_10527971 | 3300005293 | Bacteria | 758 |
| 34 | Ga0070658_10225337 | 3300005327 | Bacteria | 1586 |
| 35 | Ga0070658_10699872 | 3300005327 | Bacteria | 879 |
| 36 | Ga0070676_10013766 | 3300005328 | Bacteria | 4435 |
| 37 | Ga0070690_100024780 | 3300005330 | Bacteria | 3692 |
| 38 | Ga0070670_100006305 | 3300005331 | Bacteria | 10039 |
| 39 | Ga0070670_100116637 | 3300005331 | Bacteria | 2302 |
| 40 | Ga0070670_100123059 | 3300005331 | Bacteria | 2238 |
| 41 | Ga0070670_100368834 | 3300005331 | Bacteria | 1263 |
| 42 | Ga0070677_10150498 | 3300005333 | Bacteria | 1082 |
| 43 | Ga0068869_100064225 | 3300005334 | Bacteria | 2700 |
| 44 | Ga0068869_100108635 | 3300005334 | Bacteria | 2108 |
| 45 | Ga0070666_10085414 | 3300005335 | Bacteria | 2161 |
| 46 | Ga0070666_10253567 | 3300005335 | Bacteria | 1246 |
| 47 | Ga0070666_10295264 | 3300005335 | Bacteria | 1153 |
| 48 | Ga0070666_10397516 | 3300005335 | Bacteria | 990 |
| 49 | Ga0070680_100027256 | 3300005336 | Bacteria | 4575 |
| 50 | Ga0070680_100068768 | 3300005336 | Bacteria | 2907 |
| 51 | Ga0068868_100018409 | 3300005338 | Bacteria | 5223 |
| 52 | Ga0068868_100108205 | 3300005338 | Bacteria | 2256 |
| 53 | Ga0068868_100282759 | 3300005338 | Bacteria | 1404 |
| 54 | Ga0068868_100398368 | 3300005338 | Bacteria | 1187 |
| 55 | Ga0070660_100002557 | 3300005339 | Bacteria | 12469 |
| 56 | Ga0070660_100009788 | 3300005339 | Bacteria | 6755 |
| 57 | Ga0070689_100000624 | 3300005340 | Bacteria | 21405 |
| 58 | Ga0070689_100199393 | 3300005340 | Bacteria | 1633 |
| 59 | Ga0070687_100035247 | 3300005343 | Bacteria | 2483 |
| 60 | Ga0070661_100071272 | 3300005344 | Unclassified | 2557 |
| 61 | Ga0070668_100230863 | 3300005347 | Bacteria | 1530 |
| 62 | Ga0070668_100238038 | 3300005347 | Bacteria | 1507 |
| 63 | Ga0070668_100411477 | 3300005347 | Bacteria | 1156 |
| 64 | Ga0070669_100065706 | 3300005353 | Bacteria | 2672 |
| 65 | Ga0070669_100171152 | 3300005353 | Bacteria | 1693 |
| 66 | Ga0070669_100326072 | 3300005353 | Bacteria | 1241 |
| 67 | Ga0070669_100334658 | 3300005353 | Bacteria | 1225 |
| 68 | Ga0070675_100014471 | 3300005354 | Bacteria | 6222 |
| 69 | Ga0070675_100139096 | 3300005354 | Bacteria | 2074 |
| 70 | Ga0070675_100217508 | 3300005354 | Bacteria | 1663 |
| 71 | Ga0070675_100435111 | 3300005354 | Bacteria | 1175 |
| 72 | Ga0070671_100185860 | 3300005355 | Bacteria | 1760 |
| 73 | Ga0070671_100345424 | 3300005355 | Bacteria | 1270 |
| 74 | Ga0070674_100136852 | 3300005356 | Bacteria | 1833 |
| 75 | Ga0070674_100402961 | 3300005356 | Bacteria | 1118 |
| 76 | Ga0070674_100511777 | 3300005356 | Bacteria | 1001 |
| 77 | Ga0070673_100031836 | 3300005364 | Bacteria | 3963 |
| 78 | Ga0070673_100110895 | 3300005364 | Bacteria | 2275 |
| 79 | Ga0070673_100290085 | 3300005364 | Bacteria | 1437 |
| 80 | Ga0070673_100292640 | 3300005364 | Bacteria | 1431 |
| 81 | Ga0070659_100006694 | 3300005366 | Bacteria | 8331 |
| 82 | Ga0070659_100961633 | 3300005366 | Bacteria | 748 |
| 83 | Ga0070667_100007815 | 3300005367 | Bacteria | 8868 |
| 84 | Ga0070667_100009258 | 3300005367 | Bacteria | 8159 |
| 85 | Ga0070667_100219092 | 3300005367 | Bacteria | 1694 |
| 86 | Ga0070667_100317055 | 3300005367 | Bacteria | 1406 |
| 87 | Ga0070667_100380306 | 3300005367 | Bacteria | 1282 |
| 88 | Ga0070709_10025893 | 3300005434 | Bacteria | 3470 |
| 89 | Ga0070701_10306550 | 3300005438 | Bacteria | 978 |
| 90 | Ga0070663_100034987 | 3300005455 | Bacteria | 3482 |
| 91 | Ga0070663_100133030 | 3300005455 | Bacteria | 1891 |
| 92 | Ga0070678_100007969 | 3300005456 | Bacteria | 6315 |
| 93 | Ga0070678_100259245 | 3300005456 | Bacteria | 1461 |
| 94 | Ga0070662_100014951 | 3300005457 | Bacteria | 5190 |
| 95 | Ga0070662_100085270 | 3300005457 | Bacteria | 2360 |
| 96 | Ga0070662_100106904 | 3300005457 | Bacteria | 2126 |
| 97 | Ga0070662_100171761 | 3300005457 | Bacteria | 1703 |
| 98 | Ga0070662_100909080 | 3300005457 | Bacteria | 751 |
| 99 | Ga0070681_10108402 | 3300005458 | Bacteria | 2717 |
| 100 | Ga0068867_100080860 | 3300005459 | Bacteria | 2448 |
| 101 | Ga0068867_100181061 | 3300005459 | Bacteria | 1676 |
| 102 | Ga0068867_100223528 | 3300005459 | Bacteria | 1518 |
| 103 | Ga0068867_100700712 | 3300005459 | Bacteria | 894 |
| 104 | Ga0070706_100006620 | 3300005467 | Bacteria | 10929 |
| 105 | Ga0070707_100038174 | 3300005468 | Bacteria | 4587 |
| 106 | Ga0068853_100015198 | 3300005539 | Bacteria | 6327 |
| 107 | Ga0068853_100421537 | 3300005539 | Bacteria | 1251 |
| 108 | Ga0068853_100528825 | 3300005539 | Bacteria | 1115 |
| 109 | Ga0068853_100597820 | 3300005539 | Bacteria | 1047 |
| 110 | Ga0068853_100701297 | 3300005539 | Bacteria | 965 |
| 111 | Ga0070672_100031116 | 3300005543 | Bacteria | 4014 |
| 112 | Ga0070672_100063689 | 3300005543 | Bacteria | 2911 |
| 113 | Ga0070672_100104446 | 3300005543 | Bacteria | 2302 |
| 114 | Ga0070672_100105106 | 3300005543 | Bacteria | 2295 |
| 115 | Ga0070672_100303104 | 3300005543 | Bacteria | 1355 |
| 116 | Ga0070672_100312006 | 3300005543 | Bacteria | 1335 |
| 117 | Ga0070672_100596830 | 3300005543 | Bacteria | 961 |
| 118 | Ga0070672_100636700 | 3300005543 | Bacteria | 931 |
| 119 | Ga0070686_100133490 | 3300005544 | Bacteria | 1720 |
| 120 | Ga0070693_100007174 | 3300005547 | Bacteria | 5437 |
| 121 | Ga0070665_100065950 | 3300005548 | Bacteria | 3631 |
| 122 | Ga0068855_100013718 | 3300005563 | Bacteria | 9769 |
| 123 | Ga0068855_100042439 | 3300005563 | Bacteria | 5389 |
| 124 | Ga0068855_100095346 | 3300005563 | Bacteria | 3429 |
| 125 | Ga0068855_100420597 | 3300005563 | Bacteria | 1462 |
| 126 | Ga0070664_100080541 | 3300005564 | Unclassified | 2805 |
| 127 | Ga0070664_100120831 | 3300005564 | Bacteria | 2294 |
| 128 | Ga0070664_100255061 | 3300005564 | Bacteria | 1577 |
| 129 | Ga0070664_100482413 | 3300005564 | Bacteria | 1141 |
| 130 | Ga0070664_100604099 | 3300005564 | Bacteria | 1017 |
| 131 | Ga0068857_100248419 | 3300005577 | Bacteria | 1630 |
| 132 | Ga0068856_100037428 | 3300005614 | Bacteria | 4761 |
| 133 | Ga0068856_100042007 | 3300005614 | Bacteria | 4496 |
| 134 | Ga0068856_100204026 | 3300005614 | Bacteria | 1991 |
| 135 | Ga0068856_100236318 | 3300005614 | Bacteria | 1843 |
| 136 | Ga0068856_100393020 | 3300005614 | Bacteria | 1406 |
| 137 | Ga0068856_100530192 | 3300005614 | Bacteria | 1199 |
| 138 | Ga0068852_100011576 | 3300005616 | Bacteria | 6651 |
| 139 | Ga0068852_100042300 | 3300005616 | Bacteria | 3857 |
| 140 | Ga0068852_100045985 | 3300005616 | Bacteria | 3716 |
| 141 | Ga0068852_100162631 | 3300005616 | Bacteria | 2085 |
| 142 | Ga0068852_100192386 | 3300005616 | Bacteria | 1926 |
| 143 | Ga0068852_100558651 | 3300005616 | Bacteria | 1145 |
| 144 | Ga0068859_100039064 | 3300005617 | Bacteria | 4760 |
| 145 | Ga0068859_100065307 | 3300005617 | Bacteria | 3673 |
| 146 | Ga0068859_100234388 | 3300005617 | Bacteria | 1924 |
| 147 | Ga0068859_100394040 | 3300005617 | Bacteria | 1480 |
| 148 | Ga0068864_100013754 | 3300005618 | Bacteria | 6712 |
| 149 | Ga0068864_100019788 | 3300005618 | Bacteria | 5628 |
| 150 | Ga0068864_100707622 | 3300005618 | Bacteria | 984 |
| 151 | Ga0068866_10257098 | 3300005718 | Bacteria | 1071 |
| 152 | Ga0068861_100002738 | 3300005719 | Bacteria | 11545 |
| 153 | Ga0068861_100031672 | 3300005719 | Bacteria | 3887 |
| 154 | Ga0068861_100056852 | 3300005719 | Bacteria | 2987 |
| 155 | Ga0068851_10025723 | 3300005834 | Bacteria | 2888 |
| 156 | Ga0068851_10124697 | 3300005834 | Bacteria | 1387 |
| 157 | Ga0068851_10309789 | 3300005834 | Bacteria | 910 |
| 158 | Ga0068863_100020785 | 3300005841 | Bacteria | 6270 |
| 159 | Ga0068863_100137358 | 3300005841 | Bacteria | 2335 |
| 160 | Ga0068863_100242578 | 3300005841 | Bacteria | 1739 |
| 161 | Ga0068863_100436673 | 3300005841 | Bacteria | 1283 |
| 162 | Ga0068863_100763049 | 3300005841 | Bacteria | 963 |
| 163 | Ga0068858_100001185 | 3300005842 | Bacteria | 26988 |
| 164 | Ga0068858_100034648 | 3300005842 | Bacteria | 4683 |
| 165 | Ga0068858_100113584 | 3300005842 | Bacteria | 2529 |
| 166 | Ga0068860_100004815 | 3300005843 | Bacteria | 13742 |
| 167 | Ga0068860_100026517 | 3300005843 | Bacteria | 5585 |
| 168 | Ga0068860_100034324 | 3300005843 | Bacteria | 4864 |
| 169 | Ga0068860_100154427 | 3300005843 | Bacteria | 2211 |
| 170 | Ga0068860_100604203 | 3300005843 | Bacteria | 1102 |
| 171 | Ga0068862_100047648 | 3300005844 | Bacteria | 3658 |
| 172 | Ga0068862_100180853 | 3300005844 | Bacteria | 1892 |
| 173 | Ga0075368_10018128 | 3300006042 | Bacteria | 2642 |
| 174 | Ga0075368_10113227 | 3300006042 | Bacteria | 1119 |
| 175 | Ga0075368_10127234 | 3300006042 | Bacteria | 1057 |
| 176 | Ga0075363_100026519 | 3300006048 | Bacteria | 2965 |
| 177 | Ga0075363_100210630 | 3300006048 | Bacteria | 1112 |
| 178 | Ga0075363_100224502 | 3300006048 | Bacteria | 1077 |
| 179 | Ga0075363_100327878 | 3300006048 | Bacteria | 891 |
| 180 | Ga0075364_10041436 | 3300006051 | Bacteria | 2990 |
| 181 | Ga0075364_10041630 | 3300006051 | Bacteria | 2983 |
| 182 | Ga0075364_10245141 | 3300006051 | Bacteria | 1217 |
| 183 | Ga0075432_10012582 | 3300006058 | Bacteria | 2874 |
| 184 | Ga0070712_100109979 | 3300006175 | Bacteria | 2055 |
| 185 | Ga0075362_10058601 | 3300006177 | Bacteria | 1737 |
| 186 | Ga0075367_10026044 | 3300006178 | Bacteria | 3312 |
| 187 | Ga0075367_10026896 | 3300006178 | Bacteria | 3267 |
| 188 | Ga0075367_10185800 | 3300006178 | Bacteria | 1296 |
| 189 | Ga0075366_10001380 | 3300006195 | Bacteria | 12168 |
| 190 | Ga0075366_10019684 | 3300006195 | Bacteria | 3910 |
| 191 | Ga0075366_10027839 | 3300006195 | Bacteria | 3317 |
| 192 | Ga0075366_10043612 | 3300006195 | Bacteria | 2657 |
| 193 | Ga0075366_10077278 | 3300006195 | Bacteria | 1987 |
| 194 | Ga0075366_10083628 | 3300006195 | Bacteria | 1907 |
| 195 | Ga0075366_10276674 | 3300006195 | Bacteria | 1026 |
| 196 | Ga0075366_10348202 | 3300006195 | Bacteria | 909 |
| 197 | Ga0097621_100171187 | 3300006237 | Bacteria | 1872 |
| 198 | Ga0097621_100209765 | 3300006237 | Bacteria | 1694 |
| 199 | Ga0075370_10040034 | 3300006353 | Bacteria | 2642 |
| 200 | Ga0075370_10293335 | 3300006353 | Bacteria | 967 |
| 201 | Ga0068871_100094146 | 3300006358 | Bacteria | 2500 |
| 202 | Ga0068871_100123953 | 3300006358 | Bacteria | 2185 |
| 203 | Ga0075430_100117398 | 3300006846 | Bacteria | 2218 |
| 204 | Ga0068865_100031610 | 3300006881 | Bacteria | 3530 |
| 205 | Ga0068865_100107097 | 3300006881 | Bacteria | 2056 |
| 206 | Ga0068865_100609721 | 3300006881 | Bacteria | 923 |
| 207 | Ga0097620_100039061 | 3300006931 | Bacteria | 4760 |
| 208 | Ga0097620_100065308 | 3300006931 | Bacteria | 3673 |
| 209 | Ga0097620_100234381 | 3300006931 | Bacteria | 1924 |
| 210 | Ga0097620_100394034 | 3300006931 | Bacteria | 1480 |
| 211 | Ga0079104_1006920 | 3300006946 | Bacteria | 4192 |
| 212 | Ga0099826_10083699 | 3300006948 | Bacteria | 1977 |
| 213 | Ga0105240_10002070 | 3300009093 | Bacteria | 32876 |
| 214 | Ga0105240_10123742 | 3300009093 | Bacteria | 3111 |
| 215 | Ga0105240_10644699 | 3300009093 | Bacteria | 1162 |
| 216 | Ga0111539_10215275 | 3300009094 | Bacteria | 2238 |
| 217 | Ga0105245_10206809 | 3300009098 | Bacteria | 1887 |
| 218 | Ga0105245_10341275 | 3300009098 | Bacteria | 1481 |
| 219 | Ga0105243_10354089 | 3300009148 | Bacteria | 1349 |
| 220 | Ga0105243_10446156 | 3300009148 | Bacteria | 1213 |
| 221 | Ga0105241_10020687 | 3300009174 | Bacteria | 4862 |
| 222 | Ga0105241_10129050 | 3300009174 | Bacteria | 2045 |
| 223 | Ga0105241_10855172 | 3300009174 | Bacteria | 842 |
| 224 | Ga0105242_10118759 | 3300009176 | Bacteria | 2266 |
| 225 | Ga0105242_10690301 | 3300009176 | Bacteria | 997 |
| 226 | Ga0105248_10065552 | 3300009177 | Bacteria | 4078 |
| 227 | Ga0105248_10088911 | 3300009177 | Bacteria | 3477 |
| 228 | Ga0105248_10217938 | 3300009177 | Bacteria | 2149 |
| 229 | Ga0105248_10244015 | 3300009177 | Bacteria | 2022 |
| 230 | Ga0105248_10538103 | 3300009177 | Bacteria | 1318 |
| 231 | Ga0105237_10022027 | 3300009545 | Bacteria | 6540 |
| 232 | Ga0105237_10064875 | 3300009545 | Bacteria | 3648 |
| 233 | Ga0105238_10077712 | 3300009551 | Bacteria | 3310 |
| 234 | Ga0105238_10157136 | 3300009551 | Bacteria | 2249 |
| 235 | Ga0105238_10467490 | 3300009551 | Bacteria | 1259 |
| 236 | Ga0105249_10022314 | 3300009553 | Bacteria | 5670 |
| 237 | Ga0105249_10413675 | 3300009553 | Bacteria | 1381 |
| 238 | Ga0105249_10623764 | 3300009553 | Bacteria | 1134 |
| 239 | Ga0105239_10068683 | 3300010375 | Bacteria | 3894 |
| 240 | Ga0105239_10379575 | 3300010375 | Bacteria | 1598 |
| 241 | Ga0105239_10831227 | 3300010375 | Bacteria | 1059 |
| 242 | Ga0105239_11076803 | 3300010375 | Bacteria | 925 |
| 243 | Ga0157373_10018543 | 3300013100 | Bacteria | 5064 |
| 244 | Ga0157371_10086471 | 3300013102 | Bacteria | 2220 |
| 245 | Ga0157371_10228487 | 3300013102 | Bacteria | 1337 |
| 246 | Ga0157370_10273944 | 3300013104 | Bacteria | 1559 |
| 247 | Ga0157369_10192610 | 3300013105 | Bacteria | 2142 |
| 248 | Ga0157369_10617220 | 3300013105 | Bacteria | 1119 |
| 249 | Ga0157374_10127551 | 3300013296 | Bacteria | 2460 |
| 250 | Ga0157374_10275973 | 3300013296 | Bacteria | 1658 |
| 251 | Ga0157374_10779375 | 3300013296 | Bacteria | 971 |
| 252 | Ga0157378_10072895 | 3300013297 | Bacteria | 3086 |
| 253 | Ga0163162_10059623 | 3300013306 | Bacteria | 3849 |
| 254 | Ga0163162_10118583 | 3300013306 | Bacteria | 2748 |
| 255 | Ga0163162_10151222 | 3300013306 | Bacteria | 2439 |
| 256 | Ga0163162_10318675 | 3300013306 | Bacteria | 1687 |
| 257 | Ga0163162_10394781 | 3300013306 | Bacteria | 1516 |
| 258 | Ga0163162_11029133 | 3300013306 | Bacteria | 932 |
| 259 | Ga0157372_10178311 | 3300013307 | Bacteria | 2460 |
| 260 | Ga0157372_10275812 | 3300013307 | Bacteria | 1955 |
| 261 | Ga0157372_10311104 | 3300013307 | Bacteria | 1833 |
| 262 | Ga0157372_10324813 | 3300013307 | Bacteria | 1792 |
| 263 | Ga0157375_10049453 | 3300013308 | Bacteria | 4120 |
| 264 | Ga0157375_10052547 | 3300013308 | Bacteria | 4006 |
| 265 | Ga0157375_10187658 | 3300013308 | Bacteria | 2221 |
| 266 | Ga0157375_10222778 | 3300013308 | Bacteria | 2045 |
| 267 | Ga0157375_10389776 | 3300013308 | Bacteria | 1560 |
| 268 | Ga0157375_10419655 | 3300013308 | Bacteria | 1504 |
| 269 | Ga0157375_10422967 | 3300013308 | Bacteria | 1498 |
| 270 | Ga0163163_10024646 | 3300014325 | Bacteria | 5727 |
| 271 | Ga0163163_10049795 | 3300014325 | Bacteria | 4124 |
| 272 | Ga0157380_10001295 | 3300014326 | Bacteria | 16258 |
| 273 | Ga0157380_10064987 | 3300014326 | Bacteria | 2930 |
| 274 | Ga0157380_10072977 | 3300014326 | Bacteria | 2781 |
| 275 | Ga0157380_10078486 | 3300014326 | Bacteria | 2693 |
| 276 | Ga0157377_10042238 | 3300014745 | Bacteria | 2532 |
| 277 | Ga0157379_10031145 | 3300014968 | Bacteria | 4751 |
| 278 | Ga0157379_10077699 | 3300014968 | Bacteria | 2972 |
| 279 | Ga0157379_10090193 | 3300014968 | Bacteria | 2750 |
| 280 | Ga0157379_10101526 | 3300014968 | Bacteria | 2582 |
| 281 | Ga0157379_10105494 | 3300014968 | Bacteria | 2529 |
| 282 | Ga0157379_10266754 | 3300014968 | Bacteria | 1556 |
| 283 | Ga0157379_10303119 | 3300014968 | Bacteria | 1456 |
| 284 | Ga0157379_10923074 | 3300014968 | Bacteria | 829 |
| 285 | Ga0157376_10002116 | 3300014969 | Bacteria | 13365 |
| 286 | Ga0157376_10038774 | 3300014969 | Bacteria | 3879 |
| 287 | Ga0157376_10071904 | 3300014969 | Bacteria | 2941 |
| 288 | Ga0157376_10509087 | 3300014969 | Bacteria | 1184 |
| 289 | Ga0157376_10719139 | 3300014969 | Bacteria | 1005 |
| 290 | Ga0182006_1083651 | 3300015261 | Bacteria | 1160 |
| 291 | Ga0163161_10074141 | 3300017792 | Bacteria | 2495 |
| 292 | Ga0163161_10172145 | 3300017792 | Bacteria | 1656 |
| 293 | Ga0163161_10214799 | 3300017792 | Bacteria | 1487 |
| 294 | Ga0163161_10323631 | 3300017792 | Bacteria | 1219 |
| 295 | Ga0163161_10502091 | 3300017792 | Bacteria | 988 |
| 296 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 297 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 298 | Ga0207425_1002730 | 3300025245 | Bacteria | 6009 |
| 299 | Ga0207425_1003093 | 3300025245 | Bacteria | 5500 |
| 300 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 301 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 302 | Ga0209677_102311 | 3300025253 | Bacteria | 7323 |
| 303 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 304 | Ga0209129_1008061 | 3300025258 | Bacteria | 2997 |
| 305 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 306 | Ga0209565_1000923 | 3300025263 | Bacteria | 15607 |
| 307 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 308 | Ga0209130_1000104 | 3300025284 | Bacteria | 136694 |
| 309 | Ga0209130_1000161 | 3300025284 | Bacteria | 100375 |
| 310 | Ga0209130_1028024 | 3300025284 | Bacteria | 1189 |
| 311 | Ga0209675_1000099 | 3300025291 | Bacteria | 128911 |
| 312 | Ga0209675_1001851 | 3300025291 | Bacteria | 11492 |
| 313 | Ga0209675_1011520 | 3300025291 | Bacteria | 2927 |
| 314 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 315 | Ga0209676_1002377 | 3300025292 | Bacteria | 13514 |
| 316 | Ga0209025_1006841 | 3300025294 | Bacteria | 8704 |
| 317 | Ga0209025_1010184 | 3300025294 | Bacteria | 6414 |
| 318 | Ga0209025_1029251 | 3300025294 | Bacteria | 2673 |
| 319 | Ga0209564_1000555 | 3300025295 | Bacteria | 59942 |
| 320 | Ga0209564_1002809 | 3300025295 | Bacteria | 12946 |
| 321 | Ga0209758_1018095 | 3300025297 | Bacteria | 3472 |
| 322 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 323 | Ga0209050_1021294 | 3300025298 | Bacteria | 2369 |
| 324 | Ga0209050_1028106 | 3300025298 | Bacteria | 1833 |
| 325 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 326 | Ga0209256_1014236 | 3300025299 | Bacteria | 2880 |
| 327 | Ga0207426_1000156 | 3300025302 | Bacteria | 178646 |
| 328 | Ga0207426_1001121 | 3300025302 | Bacteria | 24462 |
| 329 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 330 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 331 | Ga0209257_1005881 | 3300025304 | Bacteria | 8277 |
| 332 | Ga0207656_10046409 | 3300025321 | Bacteria | 1864 |
| 333 | Ga0207656_10138562 | 3300025321 | Unclassified | 1145 |
| 334 | Ga0207655_1092064 | 3300025728 | Bacteria | 1064 |
| 335 | Ga0207682_10031528 | 3300025893 | Bacteria | 2127 |
| 336 | Ga0207682_10040018 | 3300025893 | Bacteria | 1908 |
| 337 | Ga0207682_10046967 | 3300025893 | Bacteria | 1776 |
| 338 | Ga0207642_10087850 | 3300025899 | Bacteria | 1528 |
| 339 | Ga0207688_10051169 | 3300025901 | Bacteria | 2314 |
| 340 | Ga0207680_10008314 | 3300025903 | Bacteria | 5085 |
| 341 | Ga0207680_10025898 | 3300025903 | Bacteria | 3242 |
| 342 | Ga0207680_10065415 | 3300025903 | Bacteria | 2232 |
| 343 | Ga0207680_10404619 | 3300025903 | Bacteria | 965 |
| 344 | Ga0207699_10097406 | 3300025906 | Bacteria | 1859 |
| 345 | Ga0207645_10003724 | 3300025907 | Bacteria | 11470 |
| 346 | Ga0207645_10019669 | 3300025907 | Bacteria | 4426 |
| 347 | Ga0207643_10304639 | 3300025908 | Bacteria | 992 |
| 348 | Ga0207705_10011758 | 3300025909 | Bacteria | 6324 |
| 349 | Ga0207705_10051365 | 3300025909 | Bacteria | 2967 |
| 350 | Ga0207705_10135912 | 3300025909 | Bacteria | 1833 |
| 351 | Ga0207705_10167930 | 3300025909 | Bacteria | 1651 |
| 352 | Ga0207705_10465415 | 3300025909 | Bacteria | 981 |
| 353 | Ga0207684_10000714 | 3300025910 | Bacteria | 39062 |
| 354 | Ga0207654_10007718 | 3300025911 | Bacteria | 5429 |
| 355 | Ga0207654_10055478 | 3300025911 | Bacteria | 2294 |
| 356 | Ga0207695_10026604 | 3300025913 | Bacteria | 6456 |
| 357 | Ga0207695_10153021 | 3300025913 | Bacteria | 2244 |
| 358 | Ga0207695_10354456 | 3300025913 | Bacteria | 1354 |
| 359 | Ga0207671_10051806 | 3300025914 | Bacteria | 3041 |
| 360 | Ga0207671_10137781 | 3300025914 | Bacteria | 1878 |
| 361 | Ga0207693_10022272 | 3300025915 | Bacteria | 5035 |
| 362 | Ga0207663_10227436 | 3300025916 | Bacteria | 1361 |
| 363 | Ga0207660_10053451 | 3300025917 | Bacteria | 2879 |
| 364 | Ga0207662_10044666 | 3300025918 | Bacteria | 2616 |
| 365 | Ga0207662_10056513 | 3300025918 | Bacteria | 2344 |
| 366 | Ga0207662_10077373 | 3300025918 | Bacteria | 2024 |
| 367 | Ga0207657_10006245 | 3300025919 | Bacteria | 12388 |
| 368 | Ga0207657_10006432 | 3300025919 | Bacteria | 12181 |
| 369 | Ga0207657_10017764 | 3300025919 | Bacteria | 6809 |
| 370 | Ga0207657_10169575 | 3300025919 | Bacteria | 1769 |
| 371 | Ga0207657_10185157 | 3300025919 | Bacteria | 1682 |
| 372 | Ga0207657_10469957 | 3300025919 | Bacteria | 986 |
| 373 | Ga0207649_10090317 | 3300025920 | Bacteria | 2004 |
| 374 | Ga0207649_10414651 | 3300025920 | Bacteria | 1010 |
| 375 | Ga0207649_10549636 | 3300025920 | Bacteria | 883 |
| 376 | Ga0207649_10599679 | 3300025920 | Bacteria | 847 |
| 377 | Ga0207652_10051193 | 3300025921 | Bacteria | 3540 |
| 378 | Ga0207652_10081838 | 3300025921 | Bacteria | 2824 |
| 379 | Ga0207652_10976883 | 3300025921 | Bacteria | 745 |
| 380 | Ga0207646_10576156 | 3300025922 | Bacteria | 1011 |
| 381 | Ga0207681_10006662 | 3300025923 | Bacteria | 7092 |
| 382 | Ga0207681_10196498 | 3300025923 | Bacteria | 1546 |
| 383 | Ga0207681_10213240 | 3300025923 | Bacteria | 1489 |
| 384 | Ga0207681_10635375 | 3300025923 | Bacteria | 884 |
| 385 | Ga0207694_10043930 | 3300025924 | Bacteria | 3449 |
| 386 | Ga0207694_10104234 | 3300025924 | Bacteria | 2250 |
| 387 | Ga0207650_10000680 | 3300025925 | Bacteria | 26724 |
| 388 | Ga0207650_10019281 | 3300025925 | Bacteria | 4790 |
| 389 | Ga0207650_10159413 | 3300025925 | Bacteria | 1787 |
| 390 | Ga0207650_10168742 | 3300025925 | Bacteria | 1738 |
| 391 | Ga0207659_10028246 | 3300025926 | Bacteria | 3810 |
| 392 | Ga0207659_10225077 | 3300025926 | Bacteria | 1510 |
| 393 | Ga0207687_10213141 | 3300025927 | Bacteria | 1516 |
| 394 | Ga0207687_10333001 | 3300025927 | Bacteria | 1232 |
| 395 | Ga0207644_10037119 | 3300025931 | Bacteria | 3425 |
| 396 | Ga0207644_10280584 | 3300025931 | Bacteria | 1337 |
| 397 | Ga0207690_10361500 | 3300025932 | Bacteria | 1150 |
| 398 | Ga0207690_10628490 | 3300025932 | Bacteria | 878 |
| 399 | Ga0207706_10005882 | 3300025933 | Bacteria | 11409 |
| 400 | Ga0207706_10102249 | 3300025933 | Bacteria | 2521 |
| 401 | Ga0207706_10195211 | 3300025933 | Bacteria | 1776 |
| 402 | Ga0207686_10025634 | 3300025934 | Bacteria | 3432 |
| 403 | Ga0207709_10370529 | 3300025935 | Bacteria | 1087 |
| 404 | Ga0207670_10050971 | 3300025936 | Bacteria | 2777 |
| 405 | Ga0207669_10004122 | 3300025937 | Bacteria | 6368 |
| 406 | Ga0207704_10215709 | 3300025938 | Bacteria | 1416 |
| 407 | Ga0207704_10380962 | 3300025938 | Bacteria | 1107 |
| 408 | Ga0207691_10010380 | 3300025940 | Bacteria | 8935 |
| 409 | Ga0207691_10024632 | 3300025940 | Bacteria | 5660 |
| 410 | Ga0207691_10033480 | 3300025940 | Bacteria | 4784 |
| 411 | Ga0207691_10057116 | 3300025940 | Bacteria | 3553 |
| 412 | Ga0207691_10074408 | 3300025940 | Bacteria | 3064 |
| 413 | Ga0207691_10118166 | 3300025940 | Bacteria | 2352 |
| 414 | Ga0207691_10300645 | 3300025940 | Bacteria | 1379 |
| 415 | Ga0207711_10014147 | 3300025941 | Bacteria | 6629 |
| 416 | Ga0207711_10026013 | 3300025941 | Bacteria | 4908 |
| 417 | Ga0207711_10256528 | 3300025941 | Bacteria | 1606 |
| 418 | Ga0207711_10778621 | 3300025941 | Bacteria | 891 |
| 419 | Ga0207689_10099857 | 3300025942 | Bacteria | 2385 |
| 420 | Ga0207689_10280123 | 3300025942 | Bacteria | 1381 |
| 421 | Ga0207689_10294495 | 3300025942 | Bacteria | 1344 |
| 422 | Ga0207661_10045183 | 3300025944 | Bacteria | 3485 |
| 423 | Ga0207679_10032033 | 3300025945 | Bacteria | 3686 |
| 424 | Ga0207679_10090050 | 3300025945 | Bacteria | 2370 |
| 425 | Ga0207679_10163686 | 3300025945 | Bacteria | 1824 |
| 426 | Ga0207679_10324085 | 3300025945 | Bacteria | 1335 |
| 427 | Ga0207679_10450481 | 3300025945 | Unclassified | 1141 |
| 428 | Ga0207667_10020314 | 3300025949 | Bacteria | 7392 |
| 429 | Ga0207667_10063367 | 3300025949 | Bacteria | 3862 |
| 430 | Ga0207667_10071410 | 3300025949 | Bacteria | 3609 |
| 431 | Ga0207667_10140766 | 3300025949 | Bacteria | 2484 |
| 432 | Ga0207667_10439969 | 3300025949 | Bacteria | 1326 |
| 433 | Ga0207667_10497225 | 3300025949 | Bacteria | 1237 |
| 434 | Ga0207651_10013033 | 3300025960 | Bacteria | 4737 |
| 435 | Ga0207651_10102907 | 3300025960 | Bacteria | 2124 |
| 436 | Ga0207668_10005465 | 3300025972 | Bacteria | 7484 |
| 437 | Ga0207668_10060655 | 3300025972 | Bacteria | 2656 |
| 438 | Ga0207668_10086208 | 3300025972 | Bacteria | 2293 |
| 439 | Ga0207668_10519152 | 3300025972 | Bacteria | 1027 |
| 440 | Ga0207640_10296328 | 3300025981 | Bacteria | 1277 |
| 441 | Ga0207640_10366628 | 3300025981 | Bacteria | 1162 |
| 442 | Ga0207658_10009315 | 3300025986 | Bacteria | 6658 |
| 443 | Ga0207658_10012592 | 3300025986 | Bacteria | 5774 |
| 444 | Ga0207658_10605997 | 3300025986 | Bacteria | 984 |
| 445 | Ga0207677_10008465 | 3300026023 | Bacteria | 5750 |
| 446 | Ga0207677_10100771 | 3300026023 | Bacteria | 2124 |
| 447 | Ga0207677_10169391 | 3300026023 | Bacteria | 1706 |
| 448 | Ga0207677_10429130 | 3300026023 | Bacteria | 1128 |
| 449 | Ga0207677_10497277 | 3300026023 | Bacteria | 1053 |
| 450 | Ga0207703_10122841 | 3300026035 | Bacteria | 2231 |
| 451 | Ga0207703_10191042 | 3300026035 | Bacteria | 1813 |
| 452 | Ga0207639_10038545 | 3300026041 | Bacteria | 3555 |
| 453 | Ga0207639_10110468 | 3300026041 | Bacteria | 2239 |
| 454 | Ga0207639_10129500 | 3300026041 | Bacteria | 2087 |
| 455 | Ga0207639_10354551 | 3300026041 | Bacteria | 1311 |
| 456 | Ga0207639_10475342 | 3300026041 | Bacteria | 1138 |
| 457 | Ga0207639_10610632 | 3300026041 | Bacteria | 1006 |
| 458 | Ga0207639_10669502 | 3300026041 | Bacteria | 961 |
| 459 | Ga0207639_10783503 | 3300026041 | Bacteria | 888 |
| 460 | Ga0207678_10022150 | 3300026067 | Bacteria | 5568 |
| 461 | Ga0207678_10072306 | 3300026067 | Bacteria | 2955 |
| 462 | Ga0207678_10125445 | 3300026067 | Bacteria | 2190 |
| 463 | Ga0207678_10162233 | 3300026067 | Bacteria | 1909 |
| 464 | Ga0207678_10237600 | 3300026067 | Bacteria | 1560 |
| 465 | Ga0207678_10484780 | 3300026067 | Bacteria | 1077 |
| 466 | Ga0207708_10001498 | 3300026075 | Bacteria | 17400 |
| 467 | Ga0207708_10023675 | 3300026075 | Bacteria | 4643 |
| 468 | Ga0207702_10073004 | 3300026078 | Bacteria | 2958 |
| 469 | Ga0207702_10141102 | 3300026078 | Bacteria | 2180 |
| 470 | Ga0207702_10573578 | 3300026078 | Bacteria | 1105 |
| 471 | Ga0207702_10906079 | 3300026078 | Bacteria | 874 |
| 472 | Ga0207641_10002127 | 3300026088 | Bacteria | 18727 |
| 473 | Ga0207641_10006110 | 3300026088 | Bacteria | 10193 |
| 474 | Ga0207641_10023137 | 3300026088 | Bacteria | 5119 |
| 475 | Ga0207641_10161619 | 3300026088 | Bacteria | 2037 |
| 476 | Ga0207648_10018058 | 3300026089 | Bacteria | 6391 |
| 477 | Ga0207648_10052892 | 3300026089 | Bacteria | 3550 |
| 478 | Ga0207648_10068675 | 3300026089 | Bacteria | 3088 |
| 479 | Ga0207648_10128996 | 3300026089 | Bacteria | 2225 |
| 480 | Ga0207648_10680334 | 3300026089 | Bacteria | 952 |
| 481 | Ga0207648_10796090 | 3300026089 | Bacteria | 880 |
| 482 | Ga0207676_10011792 | 3300026095 | Bacteria | 6252 |
| 483 | Ga0207676_10016687 | 3300026095 | Bacteria | 5318 |
| 484 | Ga0207676_10180031 | 3300026095 | Bacteria | 1850 |
| 485 | Ga0207674_10117751 | 3300026116 | Bacteria | 2627 |
| 486 | Ga0207674_10282263 | 3300026116 | Bacteria | 1609 |
| 487 | Ga0207675_100006084 | 3300026118 | Bacteria | 11481 |
| 488 | Ga0207675_100034556 | 3300026118 | Bacteria | 4714 |
| 489 | Ga0207675_100191173 | 3300026118 | Bacteria | 1963 |
| 490 | Ga0207675_100199544 | 3300026118 | Bacteria | 1921 |
| 491 | Ga0207683_10024352 | 3300026121 | Bacteria | 5212 |
| 492 | Ga0207683_10308206 | 3300026121 | Bacteria | 1449 |
| 493 | Ga0207683_10417148 | 3300026121 | Bacteria | 1236 |
| 494 | Ga0207698_10023051 | 3300026142 | Bacteria | 4343 |
| 495 | Ga0207698_10056283 | 3300026142 | Bacteria | 3036 |
| 496 | Ga0207698_10088371 | 3300026142 | Bacteria | 2527 |
| 497 | Ga0207698_10103288 | 3300026142 | Bacteria | 2368 |
| 498 | Ga0207698_10165058 | 3300026142 | Bacteria | 1942 |
| 499 | Ga0207698_10222983 | 3300026142 | Bacteria | 1705 |
| 500 | Ga0207698_10557547 | 3300026142 | Bacteria | 1124 |
| 501 | Ga0207698_10628705 | 3300026142 | Bacteria | 1061 |
| 502 | Ga0207698_10660150 | 3300026142 | Bacteria | 1037 |
| 503 | Ga0209281_1007740 | 3300027111 | Bacteria | 2668 |
| 504 | Ga0268266_10197381 | 3300028379 | Bacteria | 1840 |
| 505 | Ga0268265_10021553 | 3300028380 | Bacteria | 4517 |
| 506 | Ga0268265_10333911 | 3300028380 | Bacteria | 1378 |
| 507 | Ga0268265_10499498 | 3300028380 | Bacteria | 1146 |
| 508 | Ga0268264_10022298 | 3300028381 | Bacteria | 5171 |
| 509 | Ga0268264_10101692 | 3300028381 | Bacteria | 2499 |
| 510 | Ga0268264_10162451 | 3300028381 | Bacteria | 2013 |
| 511 | Ga0268264_10284382 | 3300028381 | Bacteria | 1551 |
| 512 | Ga0307515_10386323 | 3300028794 | Bacteria | 1030 |
| 513 | Ga0265332_10005179 | 3300031238 | Bacteria | 6034 |
| 514 | Ga0265331_10100709 | 3300031250 | Bacteria | 1329 |
| 515 | Ga0265327_10000147 | 3300031251 | Bacteria | 153254 |
| 516 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 517 | Ga0307408_100005019 | 3300031548 | Bacteria | 8877 |
| 518 | Ga0307408_100185949 | 3300031548 | Bacteria | 1670 |
| 519 | Ga0307508_10011561 | 3300031616 | Bacteria | 8067 |
| 520 | Ga0307514_10219979 | 3300031649 | Bacteria | 1166 |
| 521 | Ga0265314_10004558 | 3300031711 | Bacteria | 12795 |
| 522 | Ga0265342_10170590 | 3300031712 | Bacteria | 1197 |
| 523 | Ga0307516_10072178 | 3300031730 | Bacteria | 3312 |
| 524 | Ga0307405_10482915 | 3300031731 | Bacteria | 989 |
| 525 | Ga0307413_10504703 | 3300031824 | Bacteria | 972 |
| 526 | Ga0307406_10028586 | 3300031901 | Bacteria | 3370 |
| 527 | Ga0307412_10403397 | 3300031911 | Bacteria | 1114 |
| 528 | Ga0307412_10468455 | 3300031911 | Bacteria | 1042 |
| 529 | Ga0307409_100001596 | 3300031995 | Bacteria | 11334 |
| 530 | Ga0307416_100012247 | 3300032002 | Bacteria | 5766 |
| 531 | Ga0307416_100142552 | 3300032002 | Bacteria | 2181 |
| 532 | Ga0307415_100000346 | 3300032126 | Bacteria | 19904 |
| 533 | Ga0373942_0171038 | 3300035207 | Bacteria | 707 |
| 534 | Ga0373931_0000300 | 3300035691 | Bacteria | 20785 |
| 535 | Ga0373931_0097185 | 3300035691 | Bacteria | 1651 |
| 536 | Ga0373935_0235596 | 3300035692 | Bacteria | 1276 |
| 537 | Ga0373935_0307557 | 3300035692 | Bacteria | 1122 |
| 538 | Ga0373937_0205232 | 3300036401 | Bacteria | 1853 |
| 539 | Ga0373937_0233417 | 3300036401 | Bacteria | 1733 |
| 540 | Ga0373937_0707173 | 3300036401 | Unclassified | 954 |
| 541 | Ga0373925_0150218 | 3300037068 | Bacteria | 1829 |
| 542 | Ga0373925_0351948 | 3300037068 | Bacteria | 1196 |
| 543 | Ga0395899_0005223 | 3300037312 | Bacteria | 10100 |
| 544 | Ga0395899_0029143 | 3300037312 | Bacteria | 4151 |
| 545 | Ga0395899_0067036 | 3300037312 | Bacteria | 2634 |
| 546 | Ga0395899_0090559 | 3300037312 | Bacteria | 2217 |
| 547 | Ga0395900_0013506 | 3300037418 | Bacteria | 8344 |
| 548 | Ga0395900_0024828 | 3300037418 | Bacteria | 6134 |
| 549 | Ga0395900_0053083 | 3300037418 | Bacteria | 4171 |
| 550 | Ga0395900_0068694 | 3300037418 | Bacteria | 3641 |
| 551 | Ga0395900_0131330 | 3300037418 | Bacteria | 2566 |
| 552 | Ga0395900_0136448 | 3300037418 | Bacteria | 2513 |
| 553 | Ga0395900_0148594 | 3300037418 | Bacteria | 2395 |
| 554 | Ga0395900_0265889 | 3300037418 | Bacteria | 1711 |
| 555 | Ga0395900_0286769 | 3300037418 | Bacteria | 1636 |
| 556 | Ga0395900_1008186 | 3300037418 | Bacteria | 752 |
| 557 | Ga0395898_0014120 | 3300037466 | Bacteria | 8210 |
| 558 | Ga0395898_0048219 | 3300037466 | Bacteria | 4178 |
| 559 | Ga0395898_0084143 | 3300037466 | Bacteria | 3066 |
| 560 | Ga0395898_0271496 | 3300037466 | Bacteria | 1617 |
| 561 | Ga0395905_0001406 | 3300037471 | Bacteria | 29134 |
| 562 | Ga0395905_0063052 | 3300037471 | Bacteria | 3467 |
| 563 | Ga0395905_0088556 | 3300037471 | Bacteria | 2901 |
| 564 | Ga0395905_0105995 | 3300037471 | Bacteria | 2639 |
| 565 | Ga0395905_0140028 | 3300037471 | Bacteria | 2276 |
| 566 | Ga0395905_0180643 | 3300037471 | Bacteria | 1981 |
| 567 | Ga0395905_0196292 | 3300037471 | Bacteria | 1892 |
| 568 | Ga0395905_0557024 | 3300037471 | Bacteria | 1048 |
| 569 | Ga0395901_0041433 | 3300038443 | Bacteria | 4772 |
| 570 | Ga0395901_0097087 | 3300038443 | Bacteria | 3088 |
| 571 | Ga0395901_0177094 | 3300038443 | Bacteria | 2236 |
| 572 | Ga0395901_0179643 | 3300038443 | Bacteria | 2219 |
| 573 | Ga0395901_0191123 | 3300038443 | Bacteria | 2147 |
| 574 | Ga0395901_0300754 | 3300038443 | Bacteria | 1663 |
| 575 | Ga0395901_0326044 | 3300038443 | Bacteria | 1588 |
| 576 | Ga0395901_0380636 | 3300038443 | Bacteria | 1452 |
| 577 | Ga0395901_1104704 | 3300038443 | Bacteria | 763 |
| 578 | Ga0451807_2210824 | 3300041486 | Bacteria | 895 |
| 579 | Ga0451835_1109056 | 3300041492 | Bacteria | 939 |
| 580 | Ga0439433_0026758 | 3300041999 | Bacteria | 1306 |
| 581 | Ga0439448_0000585 | 3300042005 | Bacteria | 8553 |
| 582 | Ga0439449_0029676 | 3300042007 | Bacteria | 2038 |
| 583 | Ga0439450_021047 | 3300042008 | Bacteria | 1397 |
| 584 | Ga0439455_0031602 | 3300042012 | Bacteria | 1319 |
| 585 | Ga0450903_013516 | 3300042138 | Bacteria | 1298 |
| 586 | Ga0451577_0011213 | 3300042876 | Bacteria | 8498 |
| 587 | Ga0466969_0071528 | 3300044656 | Bacteria | 1667 |
| 588 | Ga0466972_0140292 | 3300044658 | Bacteria | 1137 |
| 589 | Ga0453683_0001915 | 3300044673 | Bacteria | 16995 |
| 590 | Ga0453683_0005625 | 3300044673 | Bacteria | 8709 |
| 591 | Ga0466965_0000612 | 3300044683 | Bacteria | 13033 |
| 592 | Ga0466965_0054489 | 3300044683 | Bacteria | 1988 |
| 593 | Ga0466966_0016157 | 3300044684 | Bacteria | 4934 |
| 594 | Ga0466966_0070888 | 3300044684 | Bacteria | 2184 |
| 595 | Ga0466966_0101534 | 3300044684 | Bacteria | 1778 |
| 596 | Ga0466966_0157064 | 3300044684 | Bacteria | 1385 |
| 597 | Ga0466963_0076777 | 3300044694 | Bacteria | 2256 |
| 598 | Ga0466964_0007906 | 3300044706 | Bacteria | 3983 |
| 599 | Ga0453684_0232843 | 3300044712 | Bacteria | 2125 |
| 600 | Ga0466970_0233824 | 3300044765 | Bacteria | 1027 |
| 601 | Ga0466957_0000323 | 3300044842 | Bacteria | 23196 |
| 602 | Ga0466957_0007570 | 3300044842 | Bacteria | 6138 |
| 603 | Ga0466957_0051695 | 3300044842 | Bacteria | 2501 |
| 604 | Ga0466959_0032599 | 3300045049 | Bacteria | 3856 |
| 605 | Ga0466959_0035301 | 3300045049 | Bacteria | 3699 |
| 606 | Ga0466959_0041813 | 3300045049 | Bacteria | 3383 |
| 607 | Ga0451576_0002636 | 3300045051 | Bacteria | 26218 |
| 608 | Ga0451576_0006746 | 3300045051 | Bacteria | 13978 |
| 609 | Ga0451576_0020764 | 3300045051 | Bacteria | 7148 |
| 610 | Ga0451576_0697400 | 3300045051 | Bacteria | 1067 |
| 611 | Ga0466958_0073580 | 3300045836 | Bacteria | 2093 |
| 612 | Ga0466958_0292432 | 3300045836 | Bacteria | 1045 |
| 613 | Ga0466967_0020822 | 3300045976 | Bacteria | 5311 |
| 614 | Ga0466967_0025547 | 3300045976 | Bacteria | 4873 |
| 615 | Ga0495617_000046 | 3300046452 | Bacteria | 115430 |
| 616 | Ga0495627_001455 | 3300046453 | Bacteria | 13878 |
| 617 | Ga0495627_020297 | 3300046453 | Bacteria | 2215 |
| 618 | Ga0495590_0000144 | 3300046457 | Bacteria | 43127 |
| 619 | Ga0495590_0034882 | 3300046457 | Bacteria | 1757 |
| 620 | Ga0495591_000444 | 3300046458 | Bacteria | 33698 |
| 621 | Ga0495591_036948 | 3300046458 | Bacteria | 1417 |
| 622 | Ga0495638_0064750 | 3300046460 | Bacteria | 2251 |
| 623 | Ga0495653_0122229 | 3300046463 | Bacteria | 1853 |
| 624 | Ga0495650_0000248 | 3300046471 | Bacteria | 106527 |
| 625 | Ga0495650_0000825 | 3300046471 | Bacteria | 37485 |
| 626 | Ga0495650_0006291 | 3300046471 | Bacteria | 7428 |
| 627 | Ga0495650_0017149 | 3300046471 | Bacteria | 3640 |
| 628 | Ga0495580_0039286 | 3300046472 | Bacteria | 3385 |
| 629 | Ga0495582_0009309 | 3300046473 | Bacteria | 5417 |
| 630 | Ga0495605_0003469 | 3300046474 | Bacteria | 9385 |
| 631 | Ga0495605_0007418 | 3300046474 | Bacteria | 6221 |
| 632 | Ga0495605_0009661 | 3300046474 | Bacteria | 5420 |
| 633 | Ga0495605_0058448 | 3300046474 | Bacteria | 1853 |
| 634 | Ga0495584_0002608 | 3300046491 | Bacteria | 10156 |
| 635 | Ga0495584_0008298 | 3300046491 | Bacteria | 5380 |
| 636 | Ga0495584_0026763 | 3300046491 | Bacteria | 2923 |
| 637 | Ga0495584_0027184 | 3300046491 | Bacteria | 2899 |
| 638 | Ga0495584_0068327 | 3300046491 | Bacteria | 1785 |
| 639 | Ga0495584_0089944 | 3300046491 | Bacteria | 1547 |
| 640 | Ga0495585_0000380 | 3300046492 | Bacteria | 42602 |
| 641 | Ga0495585_0021715 | 3300046492 | Bacteria | 3685 |
| 642 | Ga0495585_0069006 | 3300046492 | Bacteria | 1930 |
| 643 | Ga0495594_0007112 | 3300046499 | Bacteria | 5756 |
| 644 | Ga0495596_0000955 | 3300046500 | Bacteria | 17265 |
| 645 | Ga0495596_0004609 | 3300046500 | Bacteria | 6678 |
| 646 | Ga0495596_0015566 | 3300046500 | Bacteria | 3180 |
| 647 | Ga0495596_0021141 | 3300046500 | Bacteria | 2658 |
| 648 | Ga0495596_0021462 | 3300046500 | Bacteria | 2635 |
| 649 | Ga0495607_0002356 | 3300046501 | Bacteria | 15441 |
| 650 | Ga0495607_0011324 | 3300046501 | Bacteria | 5944 |
| 651 | Ga0495607_0012235 | 3300046501 | Bacteria | 5671 |
| 652 | Ga0495607_0025769 | 3300046501 | Bacteria | 3654 |
| 653 | Ga0495607_0029860 | 3300046501 | Bacteria | 3353 |
| 654 | Ga0495607_0029921 | 3300046501 | Bacteria | 3349 |
| 655 | Ga0495607_0046386 | 3300046501 | Bacteria | 2552 |
| 656 | Ga0495607_0109731 | 3300046501 | Bacteria | 1464 |
| 657 | Ga0495583_0009058 | 3300046506 | Bacteria | 5996 |
| 658 | Ga0495583_0010736 | 3300046506 | Bacteria | 5313 |
| 659 | Ga0495583_0085688 | 3300046506 | Bacteria | 1363 |
| 660 | Ga0495583_0087528 | 3300046506 | Bacteria | 1345 |
| 661 | Ga0495583_0143884 | 3300046506 | Bacteria | 991 |
| 662 | Ga0495606_0309779 | 3300046507 | Bacteria | 852 |
| 663 | Ga0495610_0000331 | 3300046512 | Bacteria | 50101 |
| 664 | Ga0495616_0002503 | 3300046513 | Bacteria | 12153 |
| 665 | Ga0495616_0010413 | 3300046513 | Bacteria | 5382 |
| 666 | Ga0495616_0019536 | 3300046513 | Bacteria | 3696 |
| 667 | Ga0495616_0042857 | 3300046513 | Bacteria | 2301 |
| 668 | Ga0495616_0060158 | 3300046513 | Bacteria | 1866 |
| 669 | Ga0495616_0129558 | 3300046513 | Bacteria | 1157 |
| 670 | Ga0495616_0140709 | 3300046513 | Bacteria | 1098 |
| 671 | Ga0495630_0571396 | 3300046517 | Bacteria | 867 |
| 672 | Ga0495631_0006224 | 3300046518 | Bacteria | 6181 |
| 673 | Ga0495631_0011979 | 3300046518 | Bacteria | 4250 |
| 674 | Ga0495631_0014477 | 3300046518 | Bacteria | 3808 |
| 675 | Ga0495631_0018273 | 3300046518 | Bacteria | 3303 |
| 676 | Ga0495631_0060139 | 3300046518 | Bacteria | 1649 |
| 677 | Ga0495631_0061239 | 3300046518 | Bacteria | 1632 |
| 678 | Ga0495632_0000280 | 3300046519 | Bacteria | 50071 |
| 679 | Ga0495632_0002237 | 3300046519 | Bacteria | 14928 |
| 680 | Ga0495632_0003131 | 3300046519 | Bacteria | 11970 |
| 681 | Ga0495632_0005246 | 3300046519 | Bacteria | 8617 |
| 682 | Ga0495632_0008312 | 3300046519 | Bacteria | 6390 |
| 683 | Ga0495632_0033797 | 3300046519 | Bacteria | 2622 |
| 684 | Ga0495632_0047013 | 3300046519 | Bacteria | 2142 |
| 685 | Ga0495637_0000029 | 3300046520 | Bacteria | 143929 |
| 686 | Ga0495637_0022477 | 3300046520 | Bacteria | 2875 |
| 687 | Ga0495637_0044319 | 3300046520 | Bacteria | 1894 |
| 688 | Ga0495643_0000514 | 3300046522 | Bacteria | 48210 |
| 689 | Ga0495643_0003982 | 3300046522 | Bacteria | 10560 |
| 690 | Ga0495643_0024993 | 3300046522 | Bacteria | 3384 |
| 691 | Ga0495643_0044633 | 3300046522 | Bacteria | 2407 |
| 692 | Ga0495643_0062232 | 3300046522 | Bacteria | 1976 |
| 693 | Ga0495643_0209672 | 3300046522 | Bacteria | 930 |
| 694 | Ga0495644_0003853 | 3300046523 | Bacteria | 5907 |
| 695 | Ga0495644_0028033 | 3300046523 | Bacteria | 2132 |
| 696 | Ga0495644_0031087 | 3300046523 | Bacteria | 2016 |
| 697 | Ga0495644_0066157 | 3300046523 | Bacteria | 1357 |
| 698 | Ga0495648_0001486 | 3300046524 | Bacteria | 22929 |
| 699 | Ga0495648_0007529 | 3300046524 | Bacteria | 8703 |
| 700 | Ga0495648_0010091 | 3300046524 | Bacteria | 7233 |
| 701 | Ga0495648_0013250 | 3300046524 | Bacteria | 6107 |
| 702 | Ga0495648_0052908 | 3300046524 | Bacteria | 2463 |
| 703 | Ga0495648_0110232 | 3300046524 | Bacteria | 1499 |
| 704 | Ga0495666_0003799 | 3300046526 | Bacteria | 7636 |
| 705 | Ga0495642_0000726 | 3300046528 | Bacteria | 16365 |
| 706 | Ga0495642_0000987 | 3300046528 | Bacteria | 13239 |
| 707 | Ga0495642_0001846 | 3300046528 | Bacteria | 9065 |
| 708 | Ga0495642_0008902 | 3300046528 | Bacteria | 3840 |
| 709 | Ga0495642_0016964 | 3300046528 | Bacteria | 2843 |
| 710 | Ga0495642_0097744 | 3300046528 | Bacteria | 1247 |
| 711 | Ga0495642_0168755 | 3300046528 | Bacteria | 950 |
| 712 | Ga0495642_0217338 | 3300046528 | Bacteria | 834 |
| 713 | Ga0495654_0004629 | 3300046530 | Bacteria | 8116 |
| 714 | Ga0495654_0006758 | 3300046530 | Bacteria | 6485 |
| 715 | Ga0495654_0021303 | 3300046530 | Bacteria | 3373 |
| 716 | Ga0495654_0057046 | 3300046530 | Bacteria | 1887 |
| 717 | Ga0495654_0174570 | 3300046530 | Bacteria | 934 |
| 718 | Ga0495665_0000417 | 3300046531 | Bacteria | 21644 |
| 719 | Ga0495665_0017434 | 3300046531 | Bacteria | 3862 |
| 720 | Ga0495586_0026023 | 3300046535 | Bacteria | 3130 |
| 721 | Ga0495586_0058220 | 3300046535 | Bacteria | 2098 |
| 722 | Ga0495587_0053648 | 3300046536 | Bacteria | 2376 |
| 723 | Ga0495587_0124784 | 3300046536 | Bacteria | 1473 |
| 724 | Ga0495609_0007416 | 3300046538 | Bacteria | 5481 |
| 725 | Ga0495609_0033190 | 3300046538 | Bacteria | 2343 |
| 726 | Ga0495609_0078542 | 3300046538 | Bacteria | 1444 |
| 727 | Ga0495609_0082892 | 3300046538 | Bacteria | 1400 |
| 728 | Ga0495609_0113009 | 3300046538 | Bacteria | 1171 |
| 729 | Ga0495609_0130084 | 3300046538 | Bacteria | 1078 |
| 730 | Ga0495609_0168571 | 3300046538 | Bacteria | 925 |
| 731 | Ga0495621_0061697 | 3300046539 | Bacteria | 1362 |
| 732 | Ga0495597_0000038 | 3300046542 | Bacteria | 113027 |
| 733 | Ga0495597_0002142 | 3300046542 | Bacteria | 13064 |
| 734 | Ga0495597_0002168 | 3300046542 | Bacteria | 12887 |
| 735 | Ga0495597_0010872 | 3300046542 | Bacteria | 4429 |
| 736 | Ga0495597_0011852 | 3300046542 | Bacteria | 4220 |
| 737 | Ga0495597_0031876 | 3300046542 | Bacteria | 2395 |
| 738 | Ga0495597_0056093 | 3300046542 | Bacteria | 1726 |
| 739 | Ga0495645_0097557 | 3300046543 | Bacteria | 2093 |
| 740 | Ga0495645_0280327 | 3300046543 | Bacteria | 1096 |
| 741 | Ga0495622_0012728 | 3300046557 | Bacteria | 3901 |
| 742 | Ga0495622_0052125 | 3300046557 | Bacteria | 1898 |
| 743 | Ga0495633_0011001 | 3300046558 | Bacteria | 4911 |
| 744 | Ga0495633_0033063 | 3300046558 | Bacteria | 2495 |
| 745 | Ga0495633_0219443 | 3300046558 | Bacteria | 870 |
| 746 | Ga0495656_0031428 | 3300046615 | Bacteria | 2153 |
| 747 | Ga0495656_0078973 | 3300046615 | Bacteria | 1480 |
| 748 | Ga0495668_0002824 | 3300046616 | Bacteria | 13809 |
| 749 | Ga0495668_0003288 | 3300046616 | Bacteria | 12264 |
| 750 | Ga0495668_0012840 | 3300046616 | Bacteria | 4960 |
| 751 | Ga0495668_0014100 | 3300046616 | Bacteria | 4696 |
| 752 | Ga0495668_0047510 | 3300046616 | Bacteria | 2383 |
| 753 | Ga0495668_0129337 | 3300046616 | Bacteria | 1382 |
| 754 | Ga0495668_0247750 | 3300046616 | Bacteria | 975 |
| 755 | Ga0495634_0006070 | 3300046642 | Bacteria | 9216 |
| 756 | Ga0495611_0002451 | 3300046648 | Bacteria | 8473 |
| 757 | Ga0495611_0004179 | 3300046648 | Bacteria | 6282 |
| 758 | Ga0495611_0061992 | 3300046648 | Bacteria | 1700 |
| 759 | Ga0495611_0097663 | 3300046648 | Bacteria | 1361 |
| 760 | Ga0495625_0068216 | 3300046660 | Bacteria | 2501 |
| 761 | Ga0495625_0068750 | 3300046660 | Bacteria | 2489 |
| 762 | Ga0495625_0098544 | 3300046660 | Bacteria | 2010 |
| 763 | Ga0495625_0356869 | 3300046660 | Bacteria | 922 |
| 764 | Ga0495661_0001352 | 3300046665 | Bacteria | 20780 |
| 765 | Ga0495661_0003089 | 3300046665 | Bacteria | 12500 |
| 766 | Ga0495661_0012791 | 3300046665 | Bacteria | 5662 |
| 767 | Ga0495661_0020551 | 3300046665 | Bacteria | 4308 |
| 768 | Ga0495661_0034939 | 3300046665 | Bacteria | 3158 |
| 769 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 770 | Ga0495588_0103418 | 3300046674 | Bacteria | 1497 |
| 771 | Ga0495588_0291559 | 3300046674 | Bacteria | 859 |
| 772 | Ga0495623_0018892 | 3300046679 | Bacteria | 4450 |
| 773 | Ga0495623_0237632 | 3300046679 | Bacteria | 1030 |
| 774 | Ga0495646_0362796 | 3300046680 | Bacteria | 757 |
| 775 | Ga0495658_0051716 | 3300046683 | Bacteria | 2328 |
| 776 | Ga0495658_0191361 | 3300046683 | Bacteria | 1272 |
| 777 | Ga0495669_0001076 | 3300046684 | Bacteria | 11355 |
| 778 | Ga0495669_0001136 | 3300046684 | Bacteria | 11017 |
| 779 | Ga0495669_0039918 | 3300046684 | Bacteria | 2079 |
| 780 | Ga0495613_0026964 | 3300046689 | Bacteria | 4277 |
| 781 | Ga0495670_0017930 | 3300046691 | Bacteria | 3486 |
| 782 | Ga0495670_0040674 | 3300046691 | Bacteria | 2318 |
| 783 | Ga0495671_0002191 | 3300046692 | Bacteria | 12437 |
| 784 | Ga0495671_0009512 | 3300046692 | Bacteria | 5428 |
| 785 | Ga0495649_0000401 | 3300046694 | Bacteria | 37516 |
| 786 | Ga0495649_0001525 | 3300046694 | Bacteria | 17403 |
| 787 | Ga0495649_0005324 | 3300046694 | Bacteria | 8208 |
| 788 | Ga0495649_0034148 | 3300046694 | Bacteria | 2799 |
| 789 | Ga0495649_0050486 | 3300046694 | Bacteria | 2257 |
| 790 | Ga0495649_0308614 | 3300046694 | Bacteria | 804 |
| 791 | Ga0495589_0001429 | 3300046794 | Bacteria | 13778 |
| 792 | Ga0495589_0021536 | 3300046794 | Bacteria | 3293 |
| 793 | Ga0495589_0041718 | 3300046794 | Bacteria | 2288 |
| 794 | Ga0495589_0065875 | 3300046794 | Bacteria | 1775 |
| 795 | Ga0495589_0094961 | 3300046794 | Bacteria | 1446 |
| 796 | Ga0495660_0000610 | 3300046810 | Bacteria | 28168 |
| 797 | Ga0495660_0008012 | 3300046810 | Bacteria | 6204 |
| 798 | Ga0495660_0062788 | 3300046810 | Bacteria | 1990 |
| 799 | Ga0495581_0002458 | 3300047315 | Bacteria | 10479 |
| 800 | Ga0495581_0021512 | 3300047315 | Bacteria | 3737 |
| 801 | Ga0495604_0008585 | 3300047317 | Bacteria | 8071 |
| 802 | Ga0495636_0053259 | 3300047318 | Bacteria | 1699 |
| 803 | Ga0495672_0004226 | 3300047320 | Bacteria | 11872 |
| 804 | Ga0495672_0005753 | 3300047320 | Bacteria | 9763 |
| 805 | Ga0495672_0006204 | 3300047320 | Bacteria | 9320 |
| 806 | Ga0495672_0016628 | 3300047320 | Bacteria | 4947 |
| 807 | Ga0495676_0039478 | 3300047321 | Bacteria | 3909 |
| 808 | Ga0495680_0013436 | 3300047322 | Bacteria | 7144 |
| 809 | Ga0495683_0001034 | 3300047323 | Bacteria | 19338 |
| 810 | Ga0495683_0015345 | 3300047323 | Bacteria | 3987 |
| 811 | Ga0495683_0062274 | 3300047323 | Bacteria | 1846 |
| 812 | Ga0495683_0123876 | 3300047323 | Bacteria | 1224 |
| 813 | Ga0495683_0164584 | 3300047323 | Bacteria | 1023 |
| 814 | Ga0495687_000146 | 3300047443 | Bacteria | 107228 |
| 815 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 816 | Ga0495687_001049 | 3300047443 | Bacteria | 27391 |
| 817 | Ga0495687_002447 | 3300047443 | Bacteria | 14903 |
| 818 | Ga0495687_002970 | 3300047443 | Bacteria | 12841 |
| 819 | Ga0495687_009091 | 3300047443 | Bacteria | 5596 |
| 820 | Ga0495675_0064564 | 3300047444 | Bacteria | 2315 |
| 821 | Ga0495675_0135963 | 3300047444 | Bacteria | 1526 |
| 822 | Ga0495677_0001082 | 3300047445 | Bacteria | 10920 |
| 823 | Ga0495677_0002141 | 3300047445 | Bacteria | 7817 |
| 824 | Ga0495677_0012628 | 3300047445 | Bacteria | 3078 |
| 825 | Ga0495677_0014680 | 3300047445 | Bacteria | 2849 |
| 826 | Ga0495677_0020707 | 3300047445 | Bacteria | 2383 |
| 827 | Ga0495677_0042366 | 3300047445 | Bacteria | 1667 |
| 828 | Ga0495677_0078618 | 3300047445 | Bacteria | 1234 |
| 829 | Ga0495679_004496 | 3300047446 | Bacteria | 6405 |
| 830 | Ga0495679_008174 | 3300047446 | Bacteria | 4280 |
| 831 | Ga0495685_018894 | 3300047447 | Bacteria | 2366 |
| 832 | Ga0495685_042494 | 3300047447 | Bacteria | 1551 |
| 833 | Ga0495685_043831 | 3300047447 | Bacteria | 1526 |
| 834 | Ga0495685_080966 | 3300047447 | Bacteria | 1081 |
| 835 | Ga0495673_0003618 | 3300047469 | Bacteria | 10113 |
| 836 | Ga0495681_0001847 | 3300047470 | Bacteria | 15559 |
| 837 | Ga0495681_0002580 | 3300047470 | Bacteria | 12869 |
| 838 | Ga0495681_0044613 | 3300047470 | Bacteria | 2128 |
| 839 | Ga0495686_0000240 | 3300047472 | Bacteria | 99258 |
| 840 | Ga0495686_0052459 | 3300047472 | Bacteria | 2557 |
| 841 | Ga0495686_0269812 | 3300047472 | Bacteria | 949 |
| 842 | Ga0495686_0381251 | 3300047472 | Bacteria | 760 |
| 843 | Ga0495602_0008566 | 3300048088 | Bacteria | 10680 |
| 844 | Ga0495614_0003072 | 3300048089 | Bacteria | 7434 |
| 845 | Ga0495626_0000058 | 3300048091 | Bacteria | 147007 |
| 846 | Ga0495626_0009749 | 3300048091 | Bacteria | 5175 |
| 847 | Ga0495626_0010350 | 3300048091 | Bacteria | 4981 |
| 848 | Ga0495626_0036691 | 3300048091 | Bacteria | 2333 |
| 849 | Ga0495626_0088488 | 3300048091 | Bacteria | 1365 |
| 850 | Ga0496102_0013788 | 3300048905 | Bacteria | 7011 |
| 851 | Ga0496102_0096713 | 3300048905 | Bacteria | 2738 |
| 852 | Ga0496102_0258365 | 3300048905 | Bacteria | 1642 |
| 853 | Ga0496103_0015377 | 3300048906 | Bacteria | 4552 |
| 854 | Ga0496103_0043644 | 3300048906 | Bacteria | 2761 |
| 855 | Ga0496103_0143482 | 3300048906 | Bacteria | 1528 |
| 856 | Ga0496103_0348406 | 3300048906 | Bacteria | 952 |
| 857 | Ga0496104_0202086 | 3300048907 | Bacteria | 1899 |
| 858 | Ga0496104_0593685 | 3300048907 | Bacteria | 1018 |
| 859 | Ga0496104_0643176 | 3300048907 | Bacteria | 970 |
| 860 | Ga0496105_0051253 | 3300048908 | Bacteria | 3410 |
| 861 | Ga0496106_0003307 | 3300048909 | Bacteria | 12022 |
| 862 | Ga0496106_0783229 | 3300048909 | Bacteria | 757 |
| 863 | Ga0496107_0111117 | 3300048910 | Bacteria | 2014 |
| 864 | Ga0496107_0187489 | 3300048910 | Bacteria | 1536 |
| 865 | Ga0496108_0008901 | 3300048911 | Bacteria | 8138 |
| 866 | Ga0496108_0032815 | 3300048911 | Bacteria | 4312 |
| 867 | Ga0496108_0584994 | 3300048911 | Bacteria | 973 |
| 868 | Ga0496109_0097368 | 3300048912 | Bacteria | 2727 |
| 869 | Ga0496109_0175508 | 3300048912 | Bacteria | 2011 |
| 870 | Ga0496110_0193882 | 3300048913 | Bacteria | 1845 |
| 871 | Ga0496110_0456902 | 3300048913 | Bacteria | 1164 |
| 872 | Ga0496110_1121206 | 3300048913 | Bacteria | 695 |
| 873 | Ga0496111_0359722 | 3300048914 | Bacteria | 1077 |
| 874 | Ga0496112_0522245 | 3300048915 | Bacteria | 1122 |
| 875 | Ga0496112_1149775 | 3300048915 | Bacteria | 694 |
| 876 | Ga0496113_0017014 | 3300048916 | Bacteria | 5037 |
| 877 | Ga0496114_0141727 | 3300048917 | Bacteria | 2082 |
| 878 | Ga0496114_0892102 | 3300048917 | Bacteria | 770 |
| 879 | Ga0496115_0067339 | 3300048918 | Bacteria | 2896 |
| 880 | Ga0496122_0021291 | 3300048925 | Bacteria | 5810 |
| 881 | Ga0496123_0012930 | 3300048926 | Bacteria | 7059 |
| 882 | Ga0496123_0143781 | 3300048926 | Bacteria | 1299 |
| 883 | Ga0496124_0023780 | 3300048927 | Bacteria | 5585 |
| 884 | Ga0501304_004113 | 3300049160 | Bacteria | 1095 |
| 885 | Ga0495678_000146 | 3300049459 | Bacteria | 85995 |
| 886 | Ga0495678_001792 | 3300049459 | Bacteria | 15868 |
| 887 | Ga0495678_003975 | 3300049459 | Bacteria | 8841 |
| 888 | Ga0495678_042532 | 3300049459 | Bacteria | 1810 |
| 889 | Ga0495682_0004888 | 3300049460 | Bacteria | 5648 |
| 890 | Ga0495682_0063271 | 3300049460 | Bacteria | 1334 |
| 891 | Ga0495682_0116596 | 3300049460 | Bacteria | 957 |
| 892 | Ga0501036_0181821 | 3300049572 | Bacteria | 1770 |
| 893 | Ga0501043_0118611 | 3300049579 | Bacteria | 2075 |
| 894 | Ga0501046_0011663 | 3300049580 | Bacteria | 7512 |
| 895 | Ga0501047_0042109 | 3300049581 | Bacteria | 4413 |
| 896 | Ga0501035_0012463 | 3300049822 | Bacteria | 7857 |
| 897 | Ga0501044_0052615 | 3300049823 | Bacteria | 4195 |
| 898 | nmdc:mga03683_165397_c1 | 3300050489 | Bacteria | 1004 |
| 899 | nmdc:mga03683_21791_c1 | 3300050489 | Bacteria | 1093 |
| 900 | nmdc:mga03683_6483_c1 | 3300050489 | Bacteria | 4010 |
| 901 | nmdc:mga03n38_145997_c1 | 3300050490 | Bacteria | 1186 |
| 902 | nmdc:mga03n38_163995_c1 | 3300050490 | Bacteria | 1127 |
| 903 | nmdc:mga00v17_37254_c1 | 3300050491 | Bacteria | 2903 |
| 904 | nmdc:mga0k408_1189_c1 | 3300050493 | Bacteria | 13937 |
| 905 | nmdc:mga0k408_252228_c1 | 3300050493 | Bacteria | 1054 |
| 906 | nmdc:mga0k408_343972_c1 | 3300050493 | Bacteria | 889 |
| 907 | nmdc:mga0k408_360_c1 | 3300050493 | Bacteria | 25004 |
| 908 | nmdc:mga0k408_3630_c1 | 3300050493 | Bacteria | 8166 |
| 909 | nmdc:mga0k408_6365_c1 | 3300050493 | Bacteria | 6302 |
| 910 | nmdc:mga06z11_255062_c1 | 3300050494 | Bacteria | 1034 |
| 911 | nmdc:mga06z11_272001_c1 | 3300050494 | Bacteria | 1002 |
| 912 | nmdc:mga04h51_121831_c1 | 3300050495 | Bacteria | 972 |
| 913 | nmdc:mga07m45_1323_c1 | 3300050496 | Bacteria | 11285 |
| 914 | nmdc:mga09592_161702_c1 | 3300050508 | Bacteria | 1934 |
| 915 | nmdc:mga0qj67_327172_c1 | 3300050509 | Bacteria | 1240 |
| 916 | nmdc:mga08y16_132737_c1 | 3300050511 | Bacteria | 2588 |
| 917 | nmdc:mga0sz30_123724_c1 | 3300050516 | Bacteria | 1137 |
| 918 | Ga0500578_0133823 | 3300053086 | Bacteria | 1553 |
| 919 | Ga0500641_0058269 | 3300053096 | Bacteria | 1604 |
| 920 | Ga0500650_0055189 | 3300053098 | Bacteria | 1850 |
| 921 | Ga0500650_0101992 | 3300053098 | Bacteria | 1342 |
| 922 | Ga0500658_0002943 | 3300053134 | Bacteria | 6536 |
| 923 | Ga0500616_0197740 | 3300053153 | Bacteria | 893 |
| 924 | Ga0500645_002171 | 3300053730 | Bacteria | 8985 |
| 925 | Ga0500645_012633 | 3300053730 | Bacteria | 2727 |
| 926 | Ga0500645_016743 | 3300053730 | Bacteria | 2305 |
| 927 | Ga0500645_026767 | 3300053730 | Bacteria | 1753 |
| 928 | Ga0587083_0012162 | 3300059505 | Bacteria | 1438 |
| 929 | Ga0466962_0131293 | 3300061719 | Bacteria | 1210 |
| 930 | 2511246909 | 2511231002 | Bacteria | 5042903 |
| 931 | 2643797098 | 2643221556 | Bacteria | 7251154 |
| 932 | 2644469798 | 2643221684 | Bacteria | 7145183 |
| 933 | 2809147402 | 2808606418 | Bacteria | 6724496 |
| 934 | 2857552301 | 2857547612 | Bacteria | 6179999 |
| 935 | 8047676616 | 8047673197 | Bacteria | 7395230 |
| 936 | Ga0070660_100272594 | |||
| 937 | JGI25156J39149_1000005 | |||
| 938 | JGI25154J39366_1000017 | |||
| 939 | JGI25157J39369_1000003 | |||
| 940 | JGI25157J39369_1000054 | |||
| 941 | JGI25150J39212_1004275 | |||
| 942 | JGI25159J45721_1001021 | |||
| 943 | JGI25159J45721_1004551 | |||
| 944 | JGI25151J46595_10010433 | |||
| 945 | JGI25160J50197_1000904 | |||
| 946 | JGI25161J50226_1000098 | |||
| 947 | Ga0032354_1048063 | |||
| 948 | Ga0055525_1000006 | |||
| 949 | Ga0055526_1000687 | |||
| 950 | Ga0055526_1018534 | |||
| 951 | Ga0055537_1001789 | |||
| 952 | Ga0055537_1019896 | |||
| 953 | Ga0055524_1000111 | |||
| 954 | Ga0055536_1009963 | |||
| 955 | Ga0055536_1022523 | |||
| 956 | Ga0055534_1004295 | |||
| 957 | Ga0055528_1002416 | |||
| 958 | Ga0055530_10003020 | |||
| 959 | Ga0055530_10053716 | |||
| 960 | Ga0055540_1000059 | |||
| 961 | Ga0055531_10001080 | |||
| 962 | Ga0055531_10001578 | |||
| 963 | Ga0055543_1000144 | |||
| 964 | Ga0065165_1014482 | |||
| 965 | Ga0065165_1014526 | |||
| 966 | Ga0065165_1018270 | |||
| 967 | Ga0065165_1036589 | |||
| 968 | Ga0065715_10527971 | |||
| 969 | Ga0070658_10225337 | |||
| 970 | Ga0070658_10699872 | |||
| 971 | Ga0070676_10013766 | |||
| 972 | Ga0070690_100024780 | |||
| 973 | Ga0070670_100006305 | |||
| 974 | Ga0070670_100116637 | |||
| 975 | Ga0070670_100123059 | |||
| 976 | Ga0070670_100368834 | |||
| 977 | Ga0070677_10150498 | |||
| 978 | Ga0068869_100064225 | |||
| 979 | Ga0068869_100108635 | |||
| 980 | Ga0070666_10085414 | |||
| 981 | Ga0070666_10253567 | |||
| 982 | Ga0070666_10295264 | |||
| 983 | Ga0070666_10397516 | |||
| 984 | Ga0070680_100027256 | |||
| 985 | Ga0070680_100068768 | |||
| 986 | Ga0068868_100018409 | |||
| 987 | Ga0068868_100108205 | |||
| 988 | Ga0068868_100282759 | |||
| 989 | Ga0068868_100398368 | |||
| 990 | Ga0070660_100002557 | |||
| 991 | Ga0070660_100009788 | |||
| 992 | Ga0070689_100000624 | |||
| 993 | Ga0070689_100199393 | |||
| 994 | Ga0070687_100035247 | |||
| 995 | Ga0070661_100071272 | |||
| 996 | Ga0070668_100230863 | |||
| 997 | Ga0070668_100238038 | |||
| 998 | Ga0070668_100411477 | |||
| 999 | Ga0070669_100065706 | |||
| 1000 | Ga0070669_100171152 | |||
| 1001 | Ga0070669_100326072 | |||
| 1002 | Ga0070669_100334658 | |||
| 1003 | Ga0070675_100014471 | |||
| 1004 | Ga0070675_100139096 | |||
| 1005 | Ga0070675_100217508 | |||
| 1006 | Ga0070675_100435111 | |||
| 1007 | Ga0070671_100185860 | |||
| 1008 | Ga0070671_100345424 | |||
| 1009 | Ga0070674_100136852 | |||
| 1010 | Ga0070674_100402961 | |||
| 1011 | Ga0070674_100511777 | |||
| 1012 | Ga0070673_100031836 | |||
| 1013 | Ga0070673_100110895 | |||
| 1014 | Ga0070673_100290085 | |||
| 1015 | Ga0070673_100292640 | |||
| 1016 | Ga0070659_100006694 | |||
| 1017 | Ga0070659_100961633 | |||
| 1018 | Ga0070667_100007815 | |||
| 1019 | Ga0070667_100009258 | |||
| 1020 | Ga0070667_100219092 | |||
| 1021 | Ga0070667_100317055 | |||
| 1022 | Ga0070667_100380306 | |||
| 1023 | Ga0070709_10025893 | |||
| 1024 | Ga0070701_10306550 | |||
| 1025 | Ga0070663_100034987 | |||
| 1026 | Ga0070663_100133030 | |||
| 1027 | Ga0070678_100007969 | |||
| 1028 | Ga0070678_100259245 | |||
| 1029 | Ga0070662_100014951 | |||
| 1030 | Ga0070662_100085270 | |||
| 1031 | Ga0070662_100106904 | |||
| 1032 | Ga0070662_100171761 | |||
| 1033 | Ga0070662_100909080 | |||
| 1034 | Ga0070681_10108402 | |||
| 1035 | Ga0068867_100080860 | |||
| 1036 | Ga0068867_100181061 | |||
| 1037 | Ga0068867_100223528 | |||
| 1038 | Ga0068867_100700712 | |||
| 1039 | Ga0070706_100006620 | |||
| 1040 | Ga0070707_100038174 | |||
| 1041 | Ga0068853_100015198 | |||
| 1042 | Ga0068853_100421537 | |||
| 1043 | Ga0068853_100528825 | |||
| 1044 | Ga0068853_100597820 | |||
| 1045 | Ga0068853_100701297 | |||
| 1046 | Ga0070672_100031116 | |||
| 1047 | Ga0070672_100063689 | |||
| 1048 | Ga0070672_100104446 | |||
| 1049 | Ga0070672_100105106 | |||
| 1050 | Ga0070672_100303104 | |||
| 1051 | Ga0070672_100312006 | |||
| 1052 | Ga0070672_100596830 | |||
| 1053 | Ga0070672_100636700 | |||
| 1054 | Ga0070686_100133490 | |||
| 1055 | Ga0070693_100007174 | |||
| 1056 | Ga0070665_100065950 | |||
| 1057 | Ga0068855_100013718 | |||
| 1058 | Ga0068855_100042439 | |||
| 1059 | Ga0068855_100095346 | |||
| 1060 | Ga0068855_100420597 | |||
| 1061 | Ga0070664_100080541 | |||
| 1062 | Ga0070664_100120831 | |||
| 1063 | Ga0070664_100255061 | |||
| 1064 | Ga0070664_100482413 | |||
| 1065 | Ga0070664_100604099 | |||
| 1066 | Ga0068857_100248419 | |||
| 1067 | Ga0068856_100037428 | |||
| 1068 | Ga0068856_100042007 | |||
| 1069 | Ga0068856_100204026 | |||
| 1070 | Ga0068856_100236318 | |||
| 1071 | Ga0068856_100393020 | |||
| 1072 | Ga0068856_100530192 | |||
| 1073 | Ga0068852_100011576 | |||
| 1074 | Ga0068852_100042300 | |||
| 1075 | Ga0068852_100045985 | |||
| 1076 | Ga0068852_100162631 | |||
| 1077 | Ga0068852_100192386 | |||
| 1078 | Ga0068852_100558651 | |||
| 1079 | Ga0068859_100039064 | |||
| 1080 | Ga0068859_100065307 | |||
| 1081 | Ga0068859_100234388 | |||
| 1082 | Ga0068859_100394040 | |||
| 1083 | Ga0068864_100013754 | |||
| 1084 | Ga0068864_100019788 | |||
| 1085 | Ga0068864_100707622 | |||
| 1086 | Ga0068866_10257098 | |||
| 1087 | Ga0068861_100002738 | |||
| 1088 | Ga0068861_100031672 | |||
| 1089 | Ga0068861_100056852 | |||
| 1090 | Ga0068851_10025723 | |||
| 1091 | Ga0068851_10124697 | |||
| 1092 | Ga0068851_10309789 | |||
| 1093 | Ga0068863_100020785 | |||
| 1094 | Ga0068863_100137358 | |||
| 1095 | Ga0068863_100242578 | |||
| 1096 | Ga0068863_100436673 | |||
| 1097 | Ga0068863_100763049 | |||
| 1098 | Ga0068858_100001185 | |||
| 1099 | Ga0068858_100034648 | |||
| 1100 | Ga0068858_100113584 | |||
| 1101 | Ga0068860_100004815 | |||
| 1102 | Ga0068860_100026517 | |||
| 1103 | Ga0068860_100034324 | |||
| 1104 | Ga0068860_100154427 | |||
| 1105 | Ga0068860_100604203 | |||
| 1106 | Ga0068862_100047648 | |||
| 1107 | Ga0068862_100180853 | |||
| 1108 | Ga0075368_10018128 | |||
| 1109 | Ga0075368_10113227 | |||
| 1110 | Ga0075368_10127234 | |||
| 1111 | Ga0075363_100026519 | |||
| 1112 | Ga0075363_100210630 | |||
| 1113 | Ga0075363_100224502 | |||
| 1114 | Ga0075363_100327878 | |||
| 1115 | Ga0075364_10041436 | |||
| 1116 | Ga0075364_10041630 | |||
| 1117 | Ga0075364_10245141 | |||
| 1118 | Ga0075432_10012582 | |||
| 1119 | Ga0070712_100109979 | |||
| 1120 | Ga0075362_10058601 | |||
| 1121 | Ga0075367_10026044 | |||
| 1122 | Ga0075367_10026896 | |||
| 1123 | Ga0075367_10185800 | |||
| 1124 | Ga0075366_10001380 | |||
| 1125 | Ga0075366_10019684 | |||
| 1126 | Ga0075366_10027839 | |||
| 1127 | Ga0075366_10043612 | |||
| 1128 | Ga0075366_10077278 | |||
| 1129 | Ga0075366_10083628 | |||
| 1130 | Ga0075366_10276674 | |||
| 1131 | Ga0075366_10348202 | |||
| 1132 | Ga0097621_100171187 | |||
| 1133 | Ga0097621_100209765 | |||
| 1134 | Ga0075370_10040034 | |||
| 1135 | Ga0075370_10293335 | |||
| 1136 | Ga0068871_100094146 | |||
| 1137 | Ga0068871_100123953 | |||
| 1138 | Ga0075430_100117398 | |||
| 1139 | Ga0068865_100031610 | |||
| 1140 | Ga0068865_100107097 | |||
| 1141 | Ga0068865_100609721 | |||
| 1142 | Ga0097620_100039061 | |||
| 1143 | Ga0097620_100065308 | |||
| 1144 | Ga0097620_100234381 | |||
| 1145 | Ga0097620_100394034 | |||
| 1146 | Ga0079104_1006920 | |||
| 1147 | Ga0099826_10083699 | |||
| 1148 | Ga0105240_10002070 | |||
| 1149 | Ga0105240_10123742 | |||
| 1150 | Ga0105240_10644699 | |||
| 1151 | Ga0111539_10215275 | |||
| 1152 | Ga0105245_10206809 | |||
| 1153 | Ga0105245_10341275 | |||
| 1154 | Ga0105243_10354089 | |||
| 1155 | Ga0105243_10446156 | |||
| 1156 | Ga0105241_10020687 | |||
| 1157 | Ga0105241_10129050 | |||
| 1158 | Ga0105241_10855172 | |||
| 1159 | Ga0105242_10118759 | |||
| 1160 | Ga0105242_10690301 | |||
| 1161 | Ga0105248_10065552 | |||
| 1162 | Ga0105248_10088911 | |||
| 1163 | Ga0105248_10217938 | |||
| 1164 | Ga0105248_10244015 | |||
| 1165 | Ga0105248_10538103 | |||
| 1166 | Ga0105237_10022027 | |||
| 1167 | Ga0105237_10064875 | |||
| 1168 | Ga0105238_10077712 | |||
| 1169 | Ga0105238_10157136 | |||
| 1170 | Ga0105238_10467490 | |||
| 1171 | Ga0105249_10022314 | |||
| 1172 | Ga0105249_10413675 | |||
| 1173 | Ga0105249_10623764 | |||
| 1174 | Ga0105239_10068683 | |||
| 1175 | Ga0105239_10379575 | |||
| 1176 | Ga0105239_10831227 | |||
| 1177 | Ga0105239_11076803 | |||
| 1178 | Ga0157373_10018543 | |||
| 1179 | Ga0157371_10086471 | |||
| 1180 | Ga0157371_10228487 | |||
| 1181 | Ga0157370_10273944 | |||
| 1182 | Ga0157369_10192610 | |||
| 1183 | Ga0157369_10617220 | |||
| 1184 | Ga0157374_10127551 | |||
| 1185 | Ga0157374_10275973 | |||
| 1186 | Ga0157374_10779375 | |||
| 1187 | Ga0157378_10072895 | |||
| 1188 | Ga0163162_10059623 | |||
| 1189 | Ga0163162_10118583 | |||
| 1190 | Ga0163162_10151222 | |||
| 1191 | Ga0163162_10318675 | |||
| 1192 | Ga0163162_10394781 | |||
| 1193 | Ga0163162_11029133 | |||
| 1194 | Ga0157372_10178311 | |||
| 1195 | Ga0157372_10275812 | |||
| 1196 | Ga0157372_10311104 | |||
| 1197 | Ga0157372_10324813 | |||
| 1198 | Ga0157375_10049453 | |||
| 1199 | Ga0157375_10052547 | |||
| 1200 | Ga0157375_10187658 | |||
| 1201 | Ga0157375_10222778 | |||
| 1202 | Ga0157375_10389776 | |||
| 1203 | Ga0157375_10419655 | |||
| 1204 | Ga0157375_10422967 | |||
| 1205 | Ga0163163_10024646 | |||
| 1206 | Ga0163163_10049795 | |||
| 1207 | Ga0157380_10001295 | |||
| 1208 | Ga0157380_10064987 | |||
| 1209 | Ga0157380_10072977 | |||
| 1210 | Ga0157380_10078486 | |||
| 1211 | Ga0157377_10042238 | |||
| 1212 | Ga0157379_10031145 | |||
| 1213 | Ga0157379_10077699 | |||
| 1214 | Ga0157379_10090193 | |||
| 1215 | Ga0157379_10101526 | |||
| 1216 | Ga0157379_10105494 | |||
| 1217 | Ga0157379_10266754 | |||
| 1218 | Ga0157379_10303119 | |||
| 1219 | Ga0157379_10923074 | |||
| 1220 | Ga0157376_10002116 | |||
| 1221 | Ga0157376_10038774 | |||
| 1222 | Ga0157376_10071904 | |||
| 1223 | Ga0157376_10509087 | |||
| 1224 | Ga0157376_10719139 | |||
| 1225 | Ga0182006_1083651 | |||
| 1226 | Ga0163161_10074141 | |||
| 1227 | Ga0163161_10172145 | |||
| 1228 | Ga0163161_10214799 | |||
| 1229 | Ga0163161_10323631 | |||
| 1230 | Ga0163161_10502091 | |||
| 1231 | Ga0209435_100002 | |||
| 1232 | Ga0209563_100022 | |||
| 1233 | Ga0207425_1002730 | |||
| 1234 | Ga0207425_1003093 | |||
| 1235 | Ga0209646_1000001 | |||
| 1236 | Ga0209026_1000001 | |||
| 1237 | Ga0209677_102311 | |||
| 1238 | Ga0209759_1000001 | |||
| 1239 | Ga0209129_1008061 | |||
| 1240 | Ga0209565_1000016 | |||
| 1241 | Ga0209565_1000923 | |||
| 1242 | Ga0209673_1000008 | |||
| 1243 | Ga0209130_1000104 | |||
| 1244 | Ga0209130_1000161 | |||
| 1245 | Ga0209130_1028024 | |||
| 1246 | Ga0209675_1000099 | |||
| 1247 | Ga0209675_1001851 | |||
| 1248 | Ga0209675_1011520 | |||
| 1249 | Ga0209676_1000023 | |||
| 1250 | Ga0209676_1002377 | |||
| 1251 | Ga0209025_1006841 | |||
| 1252 | Ga0209025_1010184 | |||
| 1253 | Ga0209025_1029251 | |||
| 1254 | Ga0209564_1000555 | |||
| 1255 | Ga0209564_1002809 | |||
| 1256 | Ga0209758_1018095 | |||
| 1257 | Ga0209050_1000022 | |||
| 1258 | Ga0209050_1021294 | |||
| 1259 | Ga0209050_1028106 | |||
| 1260 | Ga0209256_1000001 | |||
| 1261 | Ga0209256_1014236 | |||
| 1262 | Ga0207426_1000156 | |||
| 1263 | Ga0207426_1001121 | |||
| 1264 | Ga0209051_1000013 | |||
| 1265 | Ga0209257_1000042 | |||
| 1266 | Ga0209257_1005881 | |||
| 1267 | Ga0207656_10046409 | |||
| 1268 | Ga0207656_10138562 | |||
| 1269 | Ga0207655_1092064 | |||
| 1270 | Ga0207682_10031528 | |||
| 1271 | Ga0207682_10040018 | |||
| 1272 | Ga0207682_10046967 | |||
| 1273 | Ga0207642_10087850 | |||
| 1274 | Ga0207688_10051169 | |||
| 1275 | Ga0207680_10008314 | |||
| 1276 | Ga0207680_10025898 | |||
| 1277 | Ga0207680_10065415 | |||
| 1278 | Ga0207680_10404619 | |||
| 1279 | Ga0207699_10097406 | |||
| 1280 | Ga0207645_10003724 | |||
| 1281 | Ga0207645_10019669 | |||
| 1282 | Ga0207643_10304639 | |||
| 1283 | Ga0207705_10011758 | |||
| 1284 | Ga0207705_10051365 | |||
| 1285 | Ga0207705_10135912 | |||
| 1286 | Ga0207705_10167930 | |||
| 1287 | Ga0207705_10465415 | |||
| 1288 | Ga0207684_10000714 | |||
| 1289 | Ga0207654_10007718 | |||
| 1290 | Ga0207654_10055478 | |||
| 1291 | Ga0207695_10026604 | |||
| 1292 | Ga0207695_10153021 | |||
| 1293 | Ga0207695_10354456 | |||
| 1294 | Ga0207671_10051806 | |||
| 1295 | Ga0207671_10137781 | |||
| 1296 | Ga0207693_10022272 | |||
| 1297 | Ga0207663_10227436 | |||
| 1298 | Ga0207660_10053451 | |||
| 1299 | Ga0207662_10044666 | |||
| 1300 | Ga0207662_10056513 | |||
| 1301 | Ga0207662_10077373 | |||
| 1302 | Ga0207657_10006245 | |||
| 1303 | Ga0207657_10006432 | |||
| 1304 | Ga0207657_10017764 | |||
| 1305 | Ga0207657_10169575 | |||
| 1306 | Ga0207657_10185157 | |||
| 1307 | Ga0207657_10469957 | |||
| 1308 | Ga0207649_10090317 | |||
| 1309 | Ga0207649_10414651 | |||
| 1310 | Ga0207649_10549636 | |||
| 1311 | Ga0207649_10599679 | |||
| 1312 | Ga0207652_10051193 | |||
| 1313 | Ga0207652_10081838 | |||
| 1314 | Ga0207652_10976883 | |||
| 1315 | Ga0207646_10576156 | |||
| 1316 | Ga0207681_10006662 | |||
| 1317 | Ga0207681_10196498 | |||
| 1318 | Ga0207681_10213240 | |||
| 1319 | Ga0207681_10635375 | |||
| 1320 | Ga0207694_10043930 | |||
| 1321 | Ga0207694_10104234 | |||
| 1322 | Ga0207650_10000680 | |||
| 1323 | Ga0207650_10019281 | |||
| 1324 | Ga0207650_10159413 | |||
| 1325 | Ga0207650_10168742 | |||
| 1326 | Ga0207659_10028246 | |||
| 1327 | Ga0207659_10225077 | |||
| 1328 | Ga0207687_10213141 | |||
| 1329 | Ga0207687_10333001 | |||
| 1330 | Ga0207644_10037119 | |||
| 1331 | Ga0207644_10280584 | |||
| 1332 | Ga0207690_10361500 | |||
| 1333 | Ga0207690_10628490 | |||
| 1334 | Ga0207706_10005882 | |||
| 1335 | Ga0207706_10102249 | |||
| 1336 | Ga0207706_10195211 | |||
| 1337 | Ga0207686_10025634 | |||
| 1338 | Ga0207709_10370529 | |||
| 1339 | Ga0207670_10050971 | |||
| 1340 | Ga0207669_10004122 | |||
| 1341 | Ga0207704_10215709 | |||
| 1342 | Ga0207704_10380962 | |||
| 1343 | Ga0207691_10010380 | |||
| 1344 | Ga0207691_10024632 | |||
| 1345 | Ga0207691_10033480 | |||
| 1346 | Ga0207691_10057116 | |||
| 1347 | Ga0207691_10074408 | |||
| 1348 | Ga0207691_10118166 | |||
| 1349 | Ga0207691_10300645 | |||
| 1350 | Ga0207711_10014147 | |||
| 1351 | Ga0207711_10026013 | |||
| 1352 | Ga0207711_10256528 | |||
| 1353 | Ga0207711_10778621 | |||
| 1354 | Ga0207689_10099857 | |||
| 1355 | Ga0207689_10280123 | |||
| 1356 | Ga0207689_10294495 | |||
| 1357 | Ga0207661_10045183 | |||
| 1358 | Ga0207679_10032033 | |||
| 1359 | Ga0207679_10090050 | |||
| 1360 | Ga0207679_10163686 | |||
| 1361 | Ga0207679_10324085 | |||
| 1362 | Ga0207679_10450481 | |||
| 1363 | Ga0207667_10020314 | |||
| 1364 | Ga0207667_10063367 | |||
| 1365 | Ga0207667_10071410 | |||
| 1366 | Ga0207667_10140766 | |||
| 1367 | Ga0207667_10439969 | |||
| 1368 | Ga0207667_10497225 | |||
| 1369 | Ga0207651_10013033 | |||
| 1370 | Ga0207651_10102907 | |||
| 1371 | Ga0207668_10005465 | |||
| 1372 | Ga0207668_10060655 | |||
| 1373 | Ga0207668_10086208 | |||
| 1374 | Ga0207668_10519152 | |||
| 1375 | Ga0207640_10296328 | |||
| 1376 | Ga0207640_10366628 | |||
| 1377 | Ga0207658_10009315 | |||
| 1378 | Ga0207658_10012592 | |||
| 1379 | Ga0207658_10605997 | |||
| 1380 | Ga0207677_10008465 | |||
| 1381 | Ga0207677_10100771 | |||
| 1382 | Ga0207677_10169391 | |||
| 1383 | Ga0207677_10429130 | |||
| 1384 | Ga0207677_10497277 | |||
| 1385 | Ga0207703_10122841 | |||
| 1386 | Ga0207703_10191042 | |||
| 1387 | Ga0207639_10038545 | |||
| 1388 | Ga0207639_10110468 | |||
| 1389 | Ga0207639_10129500 | |||
| 1390 | Ga0207639_10354551 | |||
| 1391 | Ga0207639_10475342 | |||
| 1392 | Ga0207639_10610632 | |||
| 1393 | Ga0207639_10669502 | |||
| 1394 | Ga0207639_10783503 | |||
| 1395 | Ga0207678_10022150 | |||
| 1396 | Ga0207678_10072306 | |||
| 1397 | Ga0207678_10125445 | |||
| 1398 | Ga0207678_10162233 | |||
| 1399 | Ga0207678_10237600 | |||
| 1400 | Ga0207678_10484780 | |||
| 1401 | Ga0207708_10001498 | |||
| 1402 | Ga0207708_10023675 | |||
| 1403 | Ga0207702_10073004 | |||
| 1404 | Ga0207702_10141102 | |||
| 1405 | Ga0207702_10573578 | |||
| 1406 | Ga0207702_10906079 | |||
| 1407 | Ga0207641_10002127 | |||
| 1408 | Ga0207641_10006110 | |||
| 1409 | Ga0207641_10023137 | |||
| 1410 | Ga0207641_10161619 | |||
| 1411 | Ga0207648_10018058 | |||
| 1412 | Ga0207648_10052892 | |||
| 1413 | Ga0207648_10068675 | |||
| 1414 | Ga0207648_10128996 | |||
| 1415 | Ga0207648_10680334 | |||
| 1416 | Ga0207648_10796090 | |||
| 1417 | Ga0207676_10011792 | |||
| 1418 | Ga0207676_10016687 | |||
| 1419 | Ga0207676_10180031 | |||
| 1420 | Ga0207674_10117751 | |||
| 1421 | Ga0207674_10282263 | |||
| 1422 | Ga0207675_100006084 | |||
| 1423 | Ga0207675_100034556 | |||
| 1424 | Ga0207675_100191173 | |||
| 1425 | Ga0207675_100199544 | |||
| 1426 | Ga0207683_10024352 | |||
| 1427 | Ga0207683_10308206 | |||
| 1428 | Ga0207683_10417148 | |||
| 1429 | Ga0207698_10023051 | |||
| 1430 | Ga0207698_10056283 | |||
| 1431 | Ga0207698_10088371 | |||
| 1432 | Ga0207698_10103288 | |||
| 1433 | Ga0207698_10165058 | |||
| 1434 | Ga0207698_10222983 | |||
| 1435 | Ga0207698_10557547 | |||
| 1436 | Ga0207698_10628705 | |||
| 1437 | Ga0207698_10660150 | |||
| 1438 | Ga0209281_1007740 | |||
| 1439 | Ga0268266_10197381 | |||
| 1440 | Ga0268265_10021553 | |||
| 1441 | Ga0268265_10333911 | |||
| 1442 | Ga0268265_10499498 | |||
| 1443 | Ga0268264_10022298 | |||
| 1444 | Ga0268264_10101692 | |||
| 1445 | Ga0268264_10162451 | |||
| 1446 | Ga0268264_10284382 | |||
| 1447 | Ga0307515_10386323 | |||
| 1448 | Ga0265332_10005179 | |||
| 1449 | Ga0265331_10100709 | |||
| 1450 | Ga0265327_10000147 | |||
| 1451 | Ga0307513_10000038 | |||
| 1452 | Ga0307408_100005019 | |||
| 1453 | Ga0307408_100185949 | |||
| 1454 | Ga0307508_10011561 | |||
| 1455 | Ga0307514_10219979 | |||
| 1456 | Ga0265314_10004558 | |||
| 1457 | Ga0265342_10170590 | |||
| 1458 | Ga0307516_10072178 | |||
| 1459 | Ga0307405_10482915 | |||
| 1460 | Ga0307413_10504703 | |||
| 1461 | Ga0307406_10028586 | |||
| 1462 | Ga0307412_10403397 | |||
| 1463 | Ga0307412_10468455 | |||
| 1464 | Ga0307409_100001596 | |||
| 1465 | Ga0307416_100012247 | |||
| 1466 | Ga0307416_100142552 | |||
| 1467 | Ga0307415_100000346 | |||
| 1468 | Ga0373942_0171038 | |||
| 1469 | Ga0373931_0000300 | |||
| 1470 | Ga0373931_0097185 | |||
| 1471 | Ga0373935_0235596 | |||
| 1472 | Ga0373935_0307557 | |||
| 1473 | Ga0373937_0205232 | |||
| 1474 | Ga0373937_0233417 | |||
| 1475 | Ga0373937_0707173 | |||
| 1476 | Ga0373925_0150218 | |||
| 1477 | Ga0373925_0351948 | |||
| 1478 | Ga0395899_0005223 | |||
| 1479 | Ga0395899_0029143 | |||
| 1480 | Ga0395899_0067036 | |||
| 1481 | Ga0395899_0090559 | |||
| 1482 | Ga0395900_0013506 | |||
| 1483 | Ga0395900_0024828 | |||
| 1484 | Ga0395900_0053083 | |||
| 1485 | Ga0395900_0068694 | |||
| 1486 | Ga0395900_0131330 | |||
| 1487 | Ga0395900_0136448 | |||
| 1488 | Ga0395900_0148594 | |||
| 1489 | Ga0395900_0265889 | |||
| 1490 | Ga0395900_0286769 | |||
| 1491 | Ga0395900_1008186 | |||
| 1492 | Ga0395898_0014120 | |||
| 1493 | Ga0395898_0048219 | |||
| 1494 | Ga0395898_0084143 | |||
| 1495 | Ga0395898_0271496 | |||
| 1496 | Ga0395905_0001406 | |||
| 1497 | Ga0395905_0063052 | |||
| 1498 | Ga0395905_0088556 | |||
| 1499 | Ga0395905_0105995 | |||
| 1500 | Ga0395905_0140028 | |||
| 1501 | Ga0395905_0180643 | |||
| 1502 | Ga0395905_0196292 | |||
| 1503 | Ga0395905_0557024 | |||
| 1504 | Ga0395901_0041433 | |||
| 1505 | Ga0395901_0097087 | |||
| 1506 | Ga0395901_0177094 | |||
| 1507 | Ga0395901_0179643 | |||
| 1508 | Ga0395901_0191123 | |||
| 1509 | Ga0395901_0300754 | |||
| 1510 | Ga0395901_0326044 | |||
| 1511 | Ga0395901_0380636 | |||
| 1512 | Ga0395901_1104704 | |||
| 1513 | Ga0451807_2210824 | |||
| 1514 | Ga0451835_1109056 | |||
| 1515 | Ga0439433_0026758 | |||
| 1516 | Ga0439448_0000585 | |||
| 1517 | Ga0439449_0029676 | |||
| 1518 | Ga0439450_021047 | |||
| 1519 | Ga0439455_0031602 | |||
| 1520 | Ga0450903_013516 | |||
| 1521 | Ga0451577_0011213 | |||
| 1522 | Ga0466969_0071528 | |||
| 1523 | Ga0466972_0140292 | |||
| 1524 | Ga0453683_0001915 | |||
| 1525 | Ga0453683_0005625 | |||
| 1526 | Ga0466965_0000612 | |||
| 1527 | Ga0466965_0054489 | |||
| 1528 | Ga0466966_0016157 | |||
| 1529 | Ga0466966_0070888 | |||
| 1530 | Ga0466966_0101534 | |||
| 1531 | Ga0466966_0157064 | |||
| 1532 | Ga0466963_0076777 | |||
| 1533 | Ga0466964_0007906 | |||
| 1534 | Ga0453684_0232843 | |||
| 1535 | Ga0466970_0233824 | |||
| 1536 | Ga0466957_0000323 | |||
| 1537 | Ga0466957_0007570 | |||
| 1538 | Ga0466957_0051695 | |||
| 1539 | Ga0466959_0032599 | |||
| 1540 | Ga0466959_0035301 | |||
| 1541 | Ga0466959_0041813 | |||
| 1542 | Ga0451576_0002636 | |||
| 1543 | Ga0451576_0006746 | |||
| 1544 | Ga0451576_0020764 | |||
| 1545 | Ga0451576_0697400 | |||
| 1546 | Ga0466958_0073580 | |||
| 1547 | Ga0466958_0292432 | |||
| 1548 | Ga0466967_0020822 | |||
| 1549 | Ga0466967_0025547 | |||
| 1550 | Ga0495617_000046 | |||
| 1551 | Ga0495627_001455 | |||
| 1552 | Ga0495627_020297 | |||
| 1553 | Ga0495590_0000144 | |||
| 1554 | Ga0495590_0034882 | |||
| 1555 | Ga0495591_000444 | |||
| 1556 | Ga0495591_036948 | |||
| 1557 | Ga0495638_0064750 | |||
| 1558 | Ga0495653_0122229 | |||
| 1559 | Ga0495650_0000248 | |||
| 1560 | Ga0495650_0000825 | |||
| 1561 | Ga0495650_0006291 | |||
| 1562 | Ga0495650_0017149 | |||
| 1563 | Ga0495580_0039286 | |||
| 1564 | Ga0495582_0009309 | |||
| 1565 | Ga0495605_0003469 | |||
| 1566 | Ga0495605_0007418 | |||
| 1567 | Ga0495605_0009661 | |||
| 1568 | Ga0495605_0058448 | |||
| 1569 | Ga0495584_0002608 | |||
| 1570 | Ga0495584_0008298 | |||
| 1571 | Ga0495584_0026763 | |||
| 1572 | Ga0495584_0027184 | |||
| 1573 | Ga0495584_0068327 | |||
| 1574 | Ga0495584_0089944 | |||
| 1575 | Ga0495585_0000380 | |||
| 1576 | Ga0495585_0021715 | |||
| 1577 | Ga0495585_0069006 | |||
| 1578 | Ga0495594_0007112 | |||
| 1579 | Ga0495596_0000955 | |||
| 1580 | Ga0495596_0004609 | |||
| 1581 | Ga0495596_0015566 | |||
| 1582 | Ga0495596_0021141 | |||
| 1583 | Ga0495596_0021462 | |||
| 1584 | Ga0495607_0002356 | |||
| 1585 | Ga0495607_0011324 | |||
| 1586 | Ga0495607_0012235 | |||
| 1587 | Ga0495607_0025769 | |||
| 1588 | Ga0495607_0029860 | |||
| 1589 | Ga0495607_0029921 | |||
| 1590 | Ga0495607_0046386 | |||
| 1591 | Ga0495607_0109731 | |||
| 1592 | Ga0495583_0009058 | |||
| 1593 | Ga0495583_0010736 | |||
| 1594 | Ga0495583_0085688 | |||
| 1595 | Ga0495583_0087528 | |||
| 1596 | Ga0495583_0143884 | |||
| 1597 | Ga0495606_0309779 | |||
| 1598 | Ga0495610_0000331 | |||
| 1599 | Ga0495616_0002503 | |||
| 1600 | Ga0495616_0010413 | |||
| 1601 | Ga0495616_0019536 | |||
| 1602 | Ga0495616_0042857 | |||
| 1603 | Ga0495616_0060158 | |||
| 1604 | Ga0495616_0129558 | |||
| 1605 | Ga0495616_0140709 | |||
| 1606 | Ga0495630_0571396 | |||
| 1607 | Ga0495631_0006224 | |||
| 1608 | Ga0495631_0011979 | |||
| 1609 | Ga0495631_0014477 | |||
| 1610 | Ga0495631_0018273 | |||
| 1611 | Ga0495631_0060139 | |||
| 1612 | Ga0495631_0061239 | |||
| 1613 | Ga0495632_0000280 | |||
| 1614 | Ga0495632_0002237 | |||
| 1615 | Ga0495632_0003131 | |||
| 1616 | Ga0495632_0005246 | |||
| 1617 | Ga0495632_0008312 | |||
| 1618 | Ga0495632_0033797 | |||
| 1619 | Ga0495632_0047013 | |||
| 1620 | Ga0495637_0000029 | |||
| 1621 | Ga0495637_0022477 | |||
| 1622 | Ga0495637_0044319 | |||
| 1623 | Ga0495643_0000514 | |||
| 1624 | Ga0495643_0003982 | |||
| 1625 | Ga0495643_0024993 | |||
| 1626 | Ga0495643_0044633 | |||
| 1627 | Ga0495643_0062232 | |||
| 1628 | Ga0495643_0209672 | |||
| 1629 | Ga0495644_0003853 | |||
| 1630 | Ga0495644_0028033 | |||
| 1631 | Ga0495644_0031087 | |||
| 1632 | Ga0495644_0066157 | |||
| 1633 | Ga0495648_0001486 | |||
| 1634 | Ga0495648_0007529 | |||
| 1635 | Ga0495648_0010091 | |||
| 1636 | Ga0495648_0013250 | |||
| 1637 | Ga0495648_0052908 | |||
| 1638 | Ga0495648_0110232 | |||
| 1639 | Ga0495666_0003799 | |||
| 1640 | Ga0495642_0000726 | |||
| 1641 | Ga0495642_0000987 | |||
| 1642 | Ga0495642_0001846 | |||
| 1643 | Ga0495642_0008902 | |||
| 1644 | Ga0495642_0016964 | |||
| 1645 | Ga0495642_0097744 | |||
| 1646 | Ga0495642_0168755 | |||
| 1647 | Ga0495642_0217338 | |||
| 1648 | Ga0495654_0004629 | |||
| 1649 | Ga0495654_0006758 | |||
| 1650 | Ga0495654_0021303 | |||
| 1651 | Ga0495654_0057046 | |||
| 1652 | Ga0495654_0174570 | |||
| 1653 | Ga0495665_0000417 | |||
| 1654 | Ga0495665_0017434 | |||
| 1655 | Ga0495586_0026023 | |||
| 1656 | Ga0495586_0058220 | |||
| 1657 | Ga0495587_0053648 | |||
| 1658 | Ga0495587_0124784 | |||
| 1659 | Ga0495609_0007416 | |||
| 1660 | Ga0495609_0033190 | |||
| 1661 | Ga0495609_0078542 | |||
| 1662 | Ga0495609_0082892 | |||
| 1663 | Ga0495609_0113009 | |||
| 1664 | Ga0495609_0130084 | |||
| 1665 | Ga0495609_0168571 | |||
| 1666 | Ga0495621_0061697 | |||
| 1667 | Ga0495597_0000038 | |||
| 1668 | Ga0495597_0002142 | |||
| 1669 | Ga0495597_0002168 | |||
| 1670 | Ga0495597_0010872 | |||
| 1671 | Ga0495597_0011852 | |||
| 1672 | Ga0495597_0031876 | |||
| 1673 | Ga0495597_0056093 | |||
| 1674 | Ga0495645_0097557 | |||
| 1675 | Ga0495645_0280327 | |||
| 1676 | Ga0495622_0012728 | |||
| 1677 | Ga0495622_0052125 | |||
| 1678 | Ga0495633_0011001 | |||
| 1679 | Ga0495633_0033063 | |||
| 1680 | Ga0495633_0219443 | |||
| 1681 | Ga0495656_0031428 | |||
| 1682 | Ga0495656_0078973 | |||
| 1683 | Ga0495668_0002824 | |||
| 1684 | Ga0495668_0003288 | |||
| 1685 | Ga0495668_0012840 | |||
| 1686 | Ga0495668_0014100 | |||
| 1687 | Ga0495668_0047510 | |||
| 1688 | Ga0495668_0129337 | |||
| 1689 | Ga0495668_0247750 | |||
| 1690 | Ga0495634_0006070 | |||
| 1691 | Ga0495611_0002451 | |||
| 1692 | Ga0495611_0004179 | |||
| 1693 | Ga0495611_0061992 | |||
| 1694 | Ga0495611_0097663 | |||
| 1695 | Ga0495625_0068216 | |||
| 1696 | Ga0495625_0068750 | |||
| 1697 | Ga0495625_0098544 | |||
| 1698 | Ga0495625_0356869 | |||
| 1699 | Ga0495661_0001352 | |||
| 1700 | Ga0495661_0003089 | |||
| 1701 | Ga0495661_0012791 | |||
| 1702 | Ga0495661_0020551 | |||
| 1703 | Ga0495661_0034939 | |||
| 1704 | Ga0495588_0000059 | |||
| 1705 | Ga0495588_0103418 | |||
| 1706 | Ga0495588_0291559 | |||
| 1707 | Ga0495623_0018892 | |||
| 1708 | Ga0495623_0237632 | |||
| 1709 | Ga0495646_0362796 | |||
| 1710 | Ga0495658_0051716 | |||
| 1711 | Ga0495658_0191361 | |||
| 1712 | Ga0495669_0001076 | |||
| 1713 | Ga0495669_0001136 | |||
| 1714 | Ga0495669_0039918 | |||
| 1715 | Ga0495613_0026964 | |||
| 1716 | Ga0495670_0017930 | |||
| 1717 | Ga0495670_0040674 | |||
| 1718 | Ga0495671_0002191 | |||
| 1719 | Ga0495671_0009512 | |||
| 1720 | Ga0495649_0000401 | |||
| 1721 | Ga0495649_0001525 | |||
| 1722 | Ga0495649_0005324 | |||
| 1723 | Ga0495649_0034148 | |||
| 1724 | Ga0495649_0050486 | |||
| 1725 | Ga0495649_0308614 | |||
| 1726 | Ga0495589_0001429 | |||
| 1727 | Ga0495589_0021536 | |||
| 1728 | Ga0495589_0041718 | |||
| 1729 | Ga0495589_0065875 | |||
| 1730 | Ga0495589_0094961 | |||
| 1731 | Ga0495660_0000610 | |||
| 1732 | Ga0495660_0008012 | |||
| 1733 | Ga0495660_0062788 | |||
| 1734 | Ga0495581_0002458 | |||
| 1735 | Ga0495581_0021512 | |||
| 1736 | Ga0495604_0008585 | |||
| 1737 | Ga0495636_0053259 | |||
| 1738 | Ga0495672_0004226 | |||
| 1739 | Ga0495672_0005753 | |||
| 1740 | Ga0495672_0006204 | |||
| 1741 | Ga0495672_0016628 | |||
| 1742 | Ga0495676_0039478 | |||
| 1743 | Ga0495680_0013436 | |||
| 1744 | Ga0495683_0001034 | |||
| 1745 | Ga0495683_0015345 | |||
| 1746 | Ga0495683_0062274 | |||
| 1747 | Ga0495683_0123876 | |||
| 1748 | Ga0495683_0164584 | |||
| 1749 | Ga0495687_000146 | |||
| 1750 | Ga0495687_000174 | |||
| 1751 | Ga0495687_001049 | |||
| 1752 | Ga0495687_002447 | |||
| 1753 | Ga0495687_002970 | |||
| 1754 | Ga0495687_009091 | |||
| 1755 | Ga0495675_0064564 | |||
| 1756 | Ga0495675_0135963 | |||
| 1757 | Ga0495677_0001082 | |||
| 1758 | Ga0495677_0002141 | |||
| 1759 | Ga0495677_0012628 | |||
| 1760 | Ga0495677_0014680 | |||
| 1761 | Ga0495677_0020707 | |||
| 1762 | Ga0495677_0042366 | |||
| 1763 | Ga0495677_0078618 | |||
| 1764 | Ga0495679_004496 | |||
| 1765 | Ga0495679_008174 | |||
| 1766 | Ga0495685_018894 | |||
| 1767 | Ga0495685_042494 | |||
| 1768 | Ga0495685_043831 | |||
| 1769 | Ga0495685_080966 | |||
| 1770 | Ga0495673_0003618 | |||
| 1771 | Ga0495681_0001847 | |||
| 1772 | Ga0495681_0002580 | |||
| 1773 | Ga0495681_0044613 | |||
| 1774 | Ga0495686_0000240 | |||
| 1775 | Ga0495686_0052459 | |||
| 1776 | Ga0495686_0269812 | |||
| 1777 | Ga0495686_0381251 | |||
| 1778 | Ga0495602_0008566 | |||
| 1779 | Ga0495614_0003072 | |||
| 1780 | Ga0495626_0000058 | |||
| 1781 | Ga0495626_0009749 | |||
| 1782 | Ga0495626_0010350 | |||
| 1783 | Ga0495626_0036691 | |||
| 1784 | Ga0495626_0088488 | |||
| 1785 | Ga0496102_0013788 | |||
| 1786 | Ga0496102_0096713 | |||
| 1787 | Ga0496102_0258365 | |||
| 1788 | Ga0496103_0015377 | |||
| 1789 | Ga0496103_0043644 | |||
| 1790 | Ga0496103_0143482 | |||
| 1791 | Ga0496103_0348406 | |||
| 1792 | Ga0496104_0202086 | |||
| 1793 | Ga0496104_0593685 | |||
| 1794 | Ga0496104_0643176 | |||
| 1795 | Ga0496105_0051253 | |||
| 1796 | Ga0496106_0003307 | |||
| 1797 | Ga0496106_0783229 | |||
| 1798 | Ga0496107_0111117 | |||
| 1799 | Ga0496107_0187489 | |||
| 1800 | Ga0496108_0008901 | |||
| 1801 | Ga0496108_0032815 | |||
| 1802 | Ga0496108_0584994 | |||
| 1803 | Ga0496109_0097368 | |||
| 1804 | Ga0496109_0175508 | |||
| 1805 | Ga0496110_0193882 | |||
| 1806 | Ga0496110_0456902 | |||
| 1807 | Ga0496110_1121206 | |||
| 1808 | Ga0496111_0359722 | |||
| 1809 | Ga0496112_0522245 | |||
| 1810 | Ga0496112_1149775 | |||
| 1811 | Ga0496113_0017014 | |||
| 1812 | Ga0496114_0141727 | |||
| 1813 | Ga0496114_0892102 | |||
| 1814 | Ga0496115_0067339 | |||
| 1815 | Ga0496122_0021291 | |||
| 1816 | Ga0496123_0012930 | |||
| 1817 | Ga0496123_0143781 | |||
| 1818 | Ga0496124_0023780 | |||
| 1819 | Ga0501304_004113 | |||
| 1820 | Ga0495678_000146 | |||
| 1821 | Ga0495678_001792 | |||
| 1822 | Ga0495678_003975 | |||
| 1823 | Ga0495678_042532 | |||
| 1824 | Ga0495682_0004888 | |||
| 1825 | Ga0495682_0063271 | |||
| 1826 | Ga0495682_0116596 | |||
| 1827 | Ga0501036_0181821 | |||
| 1828 | Ga0501043_0118611 | |||
| 1829 | Ga0501046_0011663 | |||
| 1830 | Ga0501047_0042109 | |||
| 1831 | Ga0501035_0012463 | |||
| 1832 | Ga0501044_0052615 | |||
| 1833 | nmdc:mga03683_165397_c1 | |||
| 1834 | nmdc:mga03683_21791_c1 | |||
| 1835 | nmdc:mga03683_6483_c1 | |||
| 1836 | nmdc:mga03n38_145997_c1 | |||
| 1837 | nmdc:mga03n38_163995_c1 | |||
| 1838 | nmdc:mga00v17_37254_c1 | |||
| 1839 | nmdc:mga0k408_1189_c1 | |||
| 1840 | nmdc:mga0k408_252228_c1 | |||
| 1841 | nmdc:mga0k408_343972_c1 | |||
| 1842 | nmdc:mga0k408_360_c1 | |||
| 1843 | nmdc:mga0k408_3630_c1 | |||
| 1844 | nmdc:mga0k408_6365_c1 | |||
| 1845 | nmdc:mga06z11_255062_c1 | |||
| 1846 | nmdc:mga06z11_272001_c1 | |||
| 1847 | nmdc:mga04h51_121831_c1 | |||
| 1848 | nmdc:mga07m45_1323_c1 | |||
| 1849 | nmdc:mga09592_161702_c1 | |||
| 1850 | nmdc:mga0qj67_327172_c1 | |||
| 1851 | nmdc:mga08y16_132737_c1 | |||
| 1852 | nmdc:mga0sz30_123724_c1 | |||
| 1853 | Ga0500578_0133823 | |||
| 1854 | Ga0500641_0058269 | |||
| 1855 | Ga0500650_0055189 | |||
| 1856 | Ga0500650_0101992 | |||
| 1857 | Ga0500658_0002943 | |||
| 1858 | Ga0500616_0197740 | |||
| 1859 | Ga0500645_002171 | |||
| 1860 | Ga0500645_012633 | |||
| 1861 | Ga0500645_016743 | |||
| 1862 | Ga0500645_026767 | |||
| 1863 | Ga0587083_0012162 | |||
| 1864 | Ga0466962_0131293 | |||
| 1865 | 2511246909 | |||
| 1866 | 2643797098 | |||
| 1867 | 2644469798 | |||
| 1868 | 2809147402 | |||
| 1869 | 2857552301 | |||
| 1870 | 8047676616 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sss-assembly1.cif.gz_H | structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy | 0.8827 | 44 | 209 |
| 7ssp-assembly1.cif.gz_H | structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state | 0.8685 | 45 | 209 |
| 1jig-assembly1.cif.gz_A | dlp-2 from bacillus anthracis | 0.8569 | 44 | 181 |
| 7ssp-assembly1.cif.gz_H | structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state | 0.8538 | 45 | 209 |
| 7sss-assembly1.cif.gz_H | structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy | 0.8448 | 44 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54VB3_38_194_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9401 | 42 | 184 | 1.20.1260.10 |
| af_Q9W3W4_54_201_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9052 | 51 | 189 | 1.20.1260.10 |
| af_P41735_52_233_3.15.10.10 | Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 | 0.8784 | 48 | 209 | 3.15.10.10 |
| af_Q4E674_25_205_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8773 | 47 | 209 | 1.20.1260.10 |
| af_Q54VB3_38_194_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8542 | 42 | 184 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5P641-F1-model_v4 | 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) | 0.9954 | 60 | 209 |
GO:0004497
GO:0005886 GO:0006744 GO:0046872 |
| AF-A0A7I8BNG7-F1-model_v4 | 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) | 0.9929 | 39 | 209 |
GO:0005886
GO:0006744 GO:0008682 GO:0046872 |
| AF-A0A4S3KL16-F1-model_v4 | Demethoxyubiquinone hydroxylase family protein | 0.9927 | 50 | 209 |
GO:0004497
GO:0005886 GO:0006744 GO:0046872 |
| AF-A0A3B9XXC9-F1-model_v4 | Demethoxyubiquinone hydroxylase family protein | 0.9915 | 43 | 209 |
GO:0004497
GO:0005886 GO:0006744 GO:0046872 |
| AF-A0A1H7SPT3-F1-model_v4 | 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) | 0.9894 | 26 | 209 |
GO:0005886
GO:0006744 GO:0008682 GO:0046872 |