F486148

General Info

Members Datasets Scaffolds Average Seq Length
935 512 1870 246

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10210226|Ga0070709_102102262
Length 251
Sequence LINDTASKSSVISAKDIVQRVEALDWNHISQDLDSYGNAIIENLISSNDCDALINLYSEGSIFRSRVVMEQHGFGRGEYKYFSYPLPDIIASLRTTLYPHLAAIANQWNDMMNIIDISYPERHADFIARCHDAGQLKPTPLLLRYGEDDYNCLHQDLYGQHIFPLQLTILLSAPQRDFVGGEFVLAEQRPRMQSRPEVVPLRQGDAVVFAVHNRPVKGARGNVYRVNLRHGVSRIRSGHRYTLGIIFHDAK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
239 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
240 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
241 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
251 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
257 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
258 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
259 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
264 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
387 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
388 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
389 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
390 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
397 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
398 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
399 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
400 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
401 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
429 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
430 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
433 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
434 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
435 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
438 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
439 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
440 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
443 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
444 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
445 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
446 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
447 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
448 2519103095 Burkholderia sp. KJ006 Isolate Nodule
449 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
450 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
451 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
452 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
453 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
454 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
455 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
456 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
457 2643221723 Ensifer sp. Root278 Isolate Unclassified
458 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
459 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
460 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
461 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
462 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
463 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
464 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
465 2818991452 Burkholderia cepacia 561 Isolate Unclassified
466 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
467 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
468 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
469 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
470 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
471 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
472 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
473 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
474 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
475 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
476 2904564687 Burkholderia sp. 571 Isolate Unclassified
477 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
478 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
479 2904699407
480 2906610324
481 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
482 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
483 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
484 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
485 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
486 2922425934
487 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
488 2928163908 Burkholderia sp. 567 Isolate Unclassified
489 2928170801 Burkholderia sp. 572 Isolate Unclassified
490 2928536128 Burkholderia sola 565 Isolate Unclassified
491 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
492 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
493 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
494 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
495 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
496 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
497 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
498 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
499 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
500 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
501 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
502 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
503 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
504 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
505 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
506 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
507 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
508 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
509 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
510 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
511 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
512 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 3.42
Rhizoplane 5.45
Rhizosphere 74.33
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10210226 3300005434 Bacteria 1383
2 JGI24740J21852_10024707 3300001979 Bacteria 2035
3 JGI24739J22299_10011315 3300001989 Bacteria 3295
4 JGI24739J22299_10022764 3300001989 Bacteria 2221
5 JGI24737J22298_10074716 3300001990 Bacteria 1011
6 JGI25155J39150_1000034 3300002704 Bacteria 105264
7 JGI25156J39149_1000008 3300002705 Bacteria 229035
8 JGI25156J39149_1001728 3300002705 Bacteria 8762
9 JGI25162J39368_1000571 3300002737 Bacteria 27025
10 JGI25162J39368_1001418 3300002737 Bacteria 13024
11 JGI25162J39368_1001489 3300002737 Bacteria 12227
12 JGI25154J39366_1000063 3300002738 Bacteria 104538
13 JGI25154J39366_1003899 3300002738 Bacteria 2891
14 JGI25158J39367_1015551 3300002739 Bacteria 971
15 JGI25157J39369_1000028 3300002741 Bacteria 147384
16 JGI25157J39369_1000062 3300002741 Bacteria 104644
17 JGI25157J39369_1003754 3300002741 Bacteria 2982
18 JGI25164J39214_1000217 3300002772 Bacteria 46995
19 JGI25164J39214_1000501 3300002772 Bacteria 19123
20 JGI25159J45721_1000013 3300002987 Bacteria 148953
21 JGI25406J46586_10050458 3300003203 Bacteria 1397
22 JGI25165J46597_1000453 3300003214 Bacteria 41271
23 JGI25165J46597_1000578 3300003214 Bacteria 32401
24 JGI25165J46597_1000814 3300003214 Bacteria 23467
25 JGI25153J46596_10008855 3300003215 Bacteria 4753
26 rootL2_10003826 3300003322 Bacteria 13645
27 JGI25160J50197_1000013 3300003354 Bacteria 263367
28 JGI25161J50226_1000579 3300003374 Bacteria 15493
29 Ga0055532_1001218 3300003758 Bacteria 7604
30 Ga0055532_1001241 3300003758 Bacteria 7503
31 Ga0055532_1001698 3300003758 Bacteria 5668
32 Ga0055527_1001232 3300003760 Bacteria 5670
33 Ga0055527_1002377 3300003760 Bacteria 3221
34 Ga0055527_1002494 3300003760 Bacteria 3099
35 Ga0055535_1000615 3300003761 Bacteria 29107
36 Ga0055535_1002165 3300003761 Bacteria 7604
37 Ga0055535_1002740 3300003761 Bacteria 5670
38 Ga0055542_1000496 3300003762 Bacteria 36150
39 Ga0055542_1002048 3300003762 Bacteria 7604
40 Ga0055542_1006036 3300003762 Bacteria 2640
41 Ga0055529_1000116 3300003763 Bacteria 117929
42 Ga0055529_1001408 3300003763 Bacteria 7628
43 Ga0055536_1000412 3300003781 Bacteria 30810
44 Ga0055528_1000843 3300003790 Bacteria 20858
45 Ga0055531_10009427 3300003794 Bacteria 4987
46 Ga0055541_1013402 3300003841 Bacteria 1150
47 Ga0055543_1000606 3300004625 Bacteria 19421
48 Ga0065165_1000021 3300005262 Bacteria 262983
49 Ga0065704_10181965 3300005289 Bacteria 1232
50 Ga0065707_10001372 3300005295 Bacteria 11014
51 Ga0070658_10262350 3300005327 Bacteria 1467
52 Ga0070676_10010334 3300005328 Bacteria 5062
53 Ga0070676_10167613 3300005328 Bacteria 1418
54 Ga0070683_100501745 3300005329 Bacteria 1159
55 Ga0070690_100037204 3300005330 Bacteria 3066
56 Ga0070677_10262576 3300005333 Bacteria 862
57 Ga0070666_10003190 3300005335 Bacteria 9964
58 Ga0070666_10199306 3300005335 Bacteria 1408
59 Ga0070680_100031361 3300005336 Bacteria 4272
60 Ga0070682_100008953 3300005337 Bacteria 5655
61 Ga0070682_100780835 3300005337 Bacteria 774
62 Ga0070660_100000351 3300005339 Bacteria 30754
63 Ga0070660_100061318 3300005339 Bacteria 2920
64 Ga0070660_100600487 3300005339 Bacteria 920
65 Ga0070691_10002329 3300005341 Bacteria 8422
66 Ga0070687_100055826 3300005343 Bacteria 2064
67 Ga0070687_100119700 3300005343 Bacteria 1504
68 Ga0070692_10001267 3300005345 Bacteria 9015
69 Ga0070668_100140112 3300005347 Bacteria 1948
70 Ga0070669_100070332 3300005353 Bacteria 2586
71 Ga0070675_100002724 3300005354 Bacteria 13279
72 Ga0070675_100170859 3300005354 Bacteria 1874
73 Ga0070671_100008249 3300005355 Bacteria 8335
74 Ga0070674_100012062 3300005356 Bacteria 5294
75 Ga0070674_100024749 3300005356 Bacteria 3900
76 Ga0070659_100004655 3300005366 Bacteria 9798
77 Ga0070659_100006462 3300005366 Bacteria 8465
78 Ga0070659_100044907 3300005366 Bacteria 3461
79 Ga0070667_100012141 3300005367 Bacteria 7130
80 Ga0070667_100035078 3300005367 Bacteria 4201
81 Ga0070703_10000608 3300005406 Bacteria 12728
82 Ga0070703_10084321 3300005406 Bacteria 1089
83 Ga0070714_100000068 3300005435 Bacteria 94765
84 Ga0070714_100044744 3300005435 Bacteria 3748
85 Ga0070714_100432438 3300005435 Bacteria 1248
86 Ga0070713_100073385 3300005436 Bacteria 2896
87 Ga0070713_100250032 3300005436 Bacteria 1617
88 Ga0070710_10021561 3300005437 Bacteria 3360
89 Ga0070710_10105756 3300005437 Bacteria 1683
90 Ga0070701_10133388 3300005438 Bacteria 1413
91 Ga0070701_10248649 3300005438 Bacteria 1073
92 Ga0070711_100009700 3300005439 Archaea 5931
93 Ga0070711_100019538 3300005439 Bacteria 4348
94 Ga0070705_100009745 3300005440 Bacteria 4786
95 Ga0070705_100012975 3300005440 Bacteria 4251
96 Ga0070705_100125001 3300005440 Bacteria 1668
97 Ga0070700_100003570 3300005441 Bacteria 8038
98 Ga0070700_100102933 3300005441 Bacteria 1885
99 Ga0070700_100192697 3300005441 Bacteria 1426
100 Ga0070708_100013388 3300005445 Bacteria 6714
101 Ga0070708_100331070 3300005445 Bacteria 1435
102 Ga0070708_100452975 3300005445 Bacteria 1211
103 Ga0070663_100032808 3300005455 Bacteria 3583
104 Ga0070663_100049973 3300005455 Bacteria 2972
105 Ga0070663_100208011 3300005455 Bacteria 1531
106 Ga0070663_100318552 3300005455 Bacteria 1250
107 Ga0070678_100193823 3300005456 Bacteria 1672
108 Ga0070662_100078651 3300005457 Bacteria 2450
109 Ga0070662_100122783 3300005457 Bacteria 1992
110 Ga0070662_100201103 3300005457 Bacteria 1581
111 Ga0070662_100328953 3300005457 Bacteria 1248
112 Ga0070681_10013078 3300005458 Bacteria 8241
113 Ga0068867_100075667 3300005459 Bacteria 2526
114 Ga0068867_100150834 3300005459 Bacteria 1826
115 Ga0068867_100158862 3300005459 Bacteria 1781
116 Ga0068867_100451811 3300005459 Bacteria 1095
117 Ga0070706_100113453 3300005467 Bacteria 2523
118 Ga0070706_100202022 3300005467 Bacteria 1856
119 Ga0070707_100032869 3300005468 Bacteria 4943
120 Ga0070707_100088722 3300005468 Bacteria 2992
121 Ga0070707_100090652 3300005468 Bacteria 2959
122 Ga0070707_100335764 3300005468 Bacteria 1468
123 Ga0070707_100408809 3300005468 Bacteria 1317
124 Ga0070707_100503978 3300005468 Bacteria 1172
125 Ga0070698_100381706 3300005471 Bacteria 1342
126 Ga0070698_100524162 3300005471 Bacteria 1123
127 Ga0070699_100045657 3300005518 Bacteria 3791
128 Ga0070699_100180404 3300005518 Bacteria 1873
129 Ga0070699_100220091 3300005518 Bacteria 1692
130 Ga0070699_100670634 3300005518 Bacteria 947
131 Ga0070679_100014122 3300005530 Bacteria 7659
132 Ga0070679_100248404 3300005530 Bacteria 1735
133 Ga0070679_100598929 3300005530 Bacteria 1045
134 Ga0070684_100161538 3300005535 Bacteria 2032
135 Ga0070697_100096888 3300005536 Bacteria 2447
136 Ga0070697_100099716 3300005536 Bacteria 2411
137 Ga0070697_100432625 3300005536 Bacteria 1144
138 Ga0068853_100026218 3300005539 Bacteria 4893
139 Ga0068853_100070929 3300005539 Bacteria 3033
140 Ga0070672_100074296 3300005543 Bacteria 2711
141 Ga0070672_100106450 3300005543 Bacteria 2281
142 Ga0070686_100000969 3300005544 Bacteria 16553
143 Ga0070686_100023244 3300005544 Bacteria 3703
144 Ga0070686_100047287 3300005544 Bacteria 2720
145 Ga0070686_100166639 3300005544 Bacteria 1555
146 Ga0070696_100062401 3300005546 Bacteria 2608
147 Ga0070693_100001301 3300005547 Bacteria 11239
148 Ga0070665_100005165 3300005548 Bacteria 13510
149 Ga0070665_100102777 3300005548 Bacteria 2861
150 Ga0070665_100127837 3300005548 Bacteria 2544
151 Ga0070665_100141029 3300005548 Bacteria 2413
152 Ga0070665_100161327 3300005548 Bacteria 2244
153 Ga0070704_100018217 3300005549 Bacteria 4484
154 Ga0070704_100226031 3300005549 Bacteria 1524
155 Ga0068855_100020164 3300005563 Bacteria 8006
156 Ga0068855_100031608 3300005563 Bacteria 6321
157 Ga0068855_100055489 3300005563 Bacteria 4653
158 Ga0068855_100550330 3300005563 Bacteria 1249
159 Ga0070664_100027907 3300005564 Bacteria 4694
160 Ga0070664_100067766 3300005564 Bacteria 3050
161 Ga0068857_100082006 3300005577 Bacteria 2881
162 Ga0068854_100010194 3300005578 Bacteria 6090
163 Ga0068854_100088228 3300005578 Bacteria 2303
164 Ga0068854_100402553 3300005578 Bacteria 1133
165 Ga0068856_100094136 3300005614 Bacteria 2982
166 Ga0068856_100106510 3300005614 Bacteria 2798
167 Ga0070702_100002583 3300005615 Bacteria 7873
168 Ga0068852_100052029 3300005616 Bacteria 3518
169 Ga0068859_100007576 3300005617 Bacteria 11028
170 Ga0068859_100092345 3300005617 Bacteria 3078
171 Ga0068859_100118531 3300005617 Bacteria 2713
172 Ga0068864_100010239 3300005618 Bacteria 7744
173 Ga0068864_100054265 3300005618 Bacteria 3459
174 Ga0068861_100007517 3300005719 Bacteria 7472
175 Ga0068861_100010512 3300005719 Bacteria 6424
176 Ga0068861_100026180 3300005719 Bacteria 4239
177 Ga0068861_100050178 3300005719 Bacteria 3163
178 Ga0068861_100063863 3300005719 Bacteria 2831
179 Ga0068861_100076320 3300005719 Bacteria 2611
180 Ga0068861_100224388 3300005719 Bacteria 1590
181 Ga0068861_100284977 3300005719 Bacteria 1424
182 Ga0068851_10001679 3300005834 Bacteria 9690
183 Ga0068851_10005246 3300005834 Bacteria 5880
184 Ga0068870_10168713 3300005840 Bacteria 1304
185 Ga0068858_100022945 3300005842 Bacteria 5820
186 Ga0068860_100951534 3300005843 Bacteria 876
187 Ga0068862_100074855 3300005844 Bacteria 2927
188 Ga0068862_100190149 3300005844 Bacteria 1847
189 Ga0068862_100333471 3300005844 Bacteria 1403
190 Ga0081538_10021735 3300005981 Bacteria 4670
191 Ga0081538_10124123 3300005981 Bacteria 1233
192 Ga0081540_1099399 3300005983 Bacteria 1257
193 Ga0081539_10000630 3300005985 Bacteria 71317
194 Ga0081539_10015247 3300005985 Bacteria 5599
195 Ga0070717_10029350 3300006028 Bacteria 4411
196 Ga0075365_10049319 3300006038 Bacteria 2774
197 Ga0075368_10040175 3300006042 Bacteria 1836
198 Ga0075368_10040364 3300006042 Bacteria 1832
199 Ga0075363_100208221 3300006048 Bacteria 1119
200 Ga0075364_10196049 3300006051 Bacteria 1368
201 Ga0070712_100013161 3300006175 Bacteria 5278
202 Ga0070712_100133172 3300006175 Bacteria 1887
203 Ga0075367_10012607 3300006178 Bacteria 4516
204 Ga0075366_10267384 3300006195 Bacteria 1044
205 Ga0097621_100165838 3300006237 Bacteria 1902
206 Ga0097621_100319131 3300006237 Bacteria 1376
207 Ga0075370_10038007 3300006353 Bacteria 2708
208 Ga0075428_101147550 3300006844 Bacteria 820
209 Ga0075430_100009905 3300006846 Bacteria 8059
210 Ga0075430_100124499 3300006846 Bacteria 2149
211 Ga0075431_100044225 3300006847 Bacteria 4593
212 Ga0075431_100123947 3300006847 Bacteria 2666
213 Ga0075431_100713411 3300006847 Bacteria 980
214 Ga0075433_10091906 3300006852 Bacteria 2683
215 Ga0075433_10108020 3300006852 Bacteria 2468
216 Ga0075433_10179345 3300006852 Bacteria 1884
217 Ga0075433_10447440 3300006852 Bacteria 1139
218 Ga0075434_100059788 3300006871 Bacteria 3789
219 Ga0075434_100576201 3300006871 Bacteria 1145
220 Ga0075429_100194276 3300006880 Bacteria 1778
221 Ga0075429_100414285 3300006880 Bacteria 1180
222 Ga0068865_100033651 3300006881 Bacteria 3432
223 Ga0075436_100073103 3300006914 Bacteria 2373
224 Ga0097620_100007576 3300006931 Bacteria 11028
225 Ga0097620_100092342 3300006931 Bacteria 3078
226 Ga0097620_100118524 3300006931 Bacteria 2713
227 Ga0099822_1018218 3300006943 Bacteria 7346
228 Ga0075435_100000748 3300007076 Bacteria 20130
229 Ga0075435_100764568 3300007076 Bacteria 841
230 Ga0099794_10011757 3300007265 Bacteria 3758
231 Ga0099795_10017844 3300007788 Bacteria 2270
232 Ga0105250_10003347 3300009092 Bacteria 7615
233 Ga0105240_10001826 3300009093 Bacteria 35711
234 Ga0105240_10017056 3300009093 Bacteria 9806
235 Ga0105240_10024259 3300009093 Bacteria 8003
236 Ga0105240_10120529 3300009093 Bacteria 3159
237 Ga0105240_10178234 3300009093 Bacteria 2511
238 Ga0105240_10180093 3300009093 Bacteria 2495
239 Ga0105240_10438205 3300009093 Bacteria 1465
240 Ga0111539_10040038 3300009094 Bacteria 5644
241 Ga0111539_10148878 3300009094 Bacteria 2740
242 Ga0111539_10261612 3300009094 Bacteria 2014
243 Ga0105245_10153275 3300009098 Bacteria 2181
244 Ga0105247_10006851 3300009101 Bacteria 7022
245 Ga0105247_10013904 3300009101 Bacteria 4827
246 Ga0105247_10194142 3300009101 Bacteria 1361
247 Ga0114129_10034752 3300009147 Bacteria 7121
248 Ga0114129_10154721 3300009147 Bacteria 3136
249 Ga0114129_10224048 3300009147 Bacteria 2535
250 Ga0114129_10786479 3300009147 Bacteria 1215
251 Ga0114129_10825084 3300009147 Bacteria 1181
252 Ga0105243_10018993 3300009148 Bacteria 5211
253 Ga0105243_10023265 3300009148 Bacteria 4715
254 Ga0105241_10026612 3300009174 Bacteria 4305
255 Ga0105241_10239527 3300009174 Bacteria 1533
256 Ga0105242_10699585 3300009176 Bacteria 991
257 Ga0105248_10003133 3300009177 Bacteria 18304
258 Ga0105248_10097999 3300009177 Bacteria 3303
259 Ga0105248_10417122 3300009177 Bacteria 1512
260 Ga0105248_10528864 3300009177 Bacteria 1330
261 Ga0105248_10757863 3300009177 Bacteria 1095
262 Ga0105237_10014432 3300009545 Bacteria 8262
263 Ga0105237_10026052 3300009545 Bacteria 5977
264 Ga0105237_10077928 3300009545 Bacteria 3304
265 Ga0105237_10101019 3300009545 Bacteria 2876
266 Ga0105237_10205762 3300009545 Bacteria 1968
267 Ga0105237_10535237 3300009545 Bacteria 1178
268 Ga0105238_10002530 3300009551 Bacteria 18269
269 Ga0105238_10005146 3300009551 Bacteria 12930
270 Ga0105238_10017925 3300009551 Bacteria 7198
271 Ga0105238_10900145 3300009551 Bacteria 903
272 Ga0105249_10219662 3300009553 Bacteria 1869
273 Ga0099796_10052193 3300010159 Bacteria 1423
274 Ga0105239_10000113 3300010375 Bacteria 114562
275 Ga0105239_10019468 3300010375 Bacteria 7493
276 Ga0105239_10066367 3300010375 Bacteria 3964
277 Ga0105239_10075749 3300010375 Bacteria 3700
278 Ga0105239_10480984 3300010375 Bacteria 1411
279 Ga0105239_10541965 3300010375 Bacteria 1325
280 Ga0105246_10051796 3300011119 Bacteria 2820
281 Ga0105246_10197976 3300011119 Bacteria 1560
282 Ga0157373_10366462 3300013100 Bacteria 1029
283 Ga0157371_10011722 3300013102 Bacteria 6736
284 Ga0157371_10012947 3300013102 Bacteria 6352
285 Ga0157371_10145373 3300013102 Bacteria 1689
286 Ga0157370_10018266 3300013104 Bacteria 7053
287 Ga0157370_10043871 3300013104 Bacteria 4301
288 Ga0157370_10058936 3300013104 Bacteria 3649
289 Ga0157370_10105073 3300013104 Bacteria 2643
290 Ga0157370_10106002 3300013104 Bacteria 2630
291 Ga0157370_10642799 3300013104 Bacteria 970
292 Ga0157369_10063928 3300013105 Bacteria 3964
293 Ga0157369_10531302 3300013105 Bacteria 1216
294 Ga0157374_10208558 3300013296 Bacteria 1915
295 Ga0157378_10082070 3300013297 Bacteria 2915
296 Ga0157378_10278021 3300013297 Bacteria 1613
297 Ga0163162_10270255 3300013306 Bacteria 1832
298 Ga0157372_10086714 3300013307 Bacteria 3552
299 Ga0157372_10385677 3300013307 Bacteria 1632
300 Ga0157375_10177401 3300013308 Bacteria 2281
301 Ga0157375_10281728 3300013308 Bacteria 1825
302 Ga0163163_10010202 3300014325 Bacteria 8432
303 Ga0157380_10004569 3300014326 Bacteria 9609
304 Ga0157380_10223094 3300014326 Bacteria 1687
305 Ga0182008_10063793 3300014497 Bacteria 1814
306 Ga0182008_10153861 3300014497 Bacteria 1154
307 Ga0157377_10060639 3300014745 Bacteria 2160
308 Ga0157379_10003720 3300014968 Bacteria 12978
309 Ga0157379_10397176 3300014968 Bacteria 1267
310 Ga0157376_10062605 3300014969 Bacteria 3131
311 Ga0182006_1042338 3300015261 Bacteria 1785
312 Ga0182006_1099721 3300015261 Bacteria 1032
313 Ga0182007_10010394 3300015262 Bacteria 3680
314 Ga0182007_10014124 3300015262 Bacteria 3021
315 Ga0163161_10051522 3300017792 Bacteria 2982
316 Ga0213872_10001206 3300021361 Bacteria 17519
317 Ga0209435_100020 3300025206 Bacteria 229105
318 Ga0209436_100699 3300025208 Bacteria 14094
319 Ga0209566_100507 3300025225 Bacteria 27001
320 Ga0209672_100020 3300025228 Bacteria 429003
321 Ga0209672_100045 3300025228 Bacteria 264926
322 Ga0209672_100337 3300025228 Bacteria 30210
323 Ga0209147_100024 3300025229 Bacteria 429003
324 Ga0209147_101591 3300025229 Bacteria 7657
325 Ga0209147_101614 3300025229 Bacteria 7555
326 Ga0207427_100228 3300025231 Bacteria 47076
327 Ga0207427_100229 3300025231 Bacteria 47034
328 Ga0209437_100039 3300025233 Bacteria 448321
329 Ga0209437_100370 3300025233 Bacteria 47076
330 Ga0209258_100084 3300025242 Bacteria 244783
331 Ga0209258_100200 3300025242 Bacteria 123379
332 Ga0209258_100587 3300025242 Bacteria 30186
333 Ga0209646_1000070 3300025246 Bacteria 229105
334 Ga0209646_1003227 3300025246 Bacteria 3271
335 Ga0209026_1000057 3300025250 Bacteria 229105
336 Ga0209026_1001184 3300025250 Bacteria 12103
337 Ga0209148_1000045 3300025254 Bacteria 448076
338 Ga0209148_1000737 3300025254 Bacteria 25451
339 Ga0209148_1001237 3300025254 Bacteria 14282
340 Ga0209759_1000047 3300025256 Bacteria 229105
341 Ga0209759_1000247 3300025256 Bacteria 80850
342 Ga0209759_1006664 3300025256 Bacteria 3840
343 Ga0209233_1000090 3300025261 Bacteria 315680
344 Ga0209233_1000336 3300025261 Bacteria 47076
345 Ga0209233_1003552 3300025261 Bacteria 5483
346 Ga0209455_1000035 3300025272 Bacteria 479071
347 Ga0209455_1000551 3300025272 Bacteria 25451
348 Ga0209455_1000585 3300025272 Bacteria 23683
349 Ga0209673_1000057 3300025273 Bacteria 270150
350 Ga0209130_1000039 3300025284 Bacteria 263493
351 Ga0209676_1001587 3300025292 Bacteria 20254
352 Ga0209025_1000301 3300025294 Bacteria 110450
353 Ga0209564_1000081 3300025295 Bacteria 261592
354 Ga0209564_1025857 3300025295 Bacteria 1960
355 Ga0209758_1015407 3300025297 Bacteria 3961
356 Ga0209050_1004758 3300025298 Bacteria 8967
357 Ga0209256_1004366 3300025299 Bacteria 8952
358 Ga0207426_1000099 3300025302 Bacteria 263493
359 Ga0209051_1002050 3300025303 Bacteria 15303
360 Ga0209257_1004214 3300025304 Bacteria 11394
361 Ga0207697_10023834 3300025315 Bacteria 2506
362 Ga0207656_10000902 3300025321 Bacteria 9651
363 Ga0207656_10011143 3300025321 Bacteria 3389
364 Ga0207653_10000611 3300025885 Bacteria 12467
365 Ga0207653_10022033 3300025885 Bacteria 2023
366 Ga0207688_10027182 3300025901 Bacteria 3147
367 Ga0207680_10012423 3300025903 Bacteria 4335
368 Ga0207647_10018202 3300025904 Bacteria 4760
369 Ga0207647_10021487 3300025904 Bacteria 4308
370 Ga0207647_10187769 3300025904 Bacteria 1198
371 Ga0207699_10078486 3300025906 Bacteria 2039
372 Ga0207699_10234709 3300025906 Bacteria 1258
373 Ga0207645_10001251 3300025907 Bacteria 20918
374 Ga0207645_10064837 3300025907 Bacteria 2334
375 Ga0207645_10237160 3300025907 Bacteria 1205
376 Ga0207643_10155789 3300025908 Bacteria 1372
377 Ga0207705_10020240 3300025909 Bacteria 4758
378 Ga0207684_10003614 3300025910 Bacteria 15049
379 Ga0207684_10082993 3300025910 Bacteria 2729
380 Ga0207684_10123171 3300025910 Bacteria 2224
381 Ga0207654_10000757 3300025911 Bacteria 17843
382 Ga0207707_10039025 3300025912 Bacteria 4151
383 Ga0207695_10000424 3300025913 Bacteria 93657
384 Ga0207695_10010815 3300025913 Bacteria 11122
385 Ga0207695_10190939 3300025913 Bacteria 1966
386 Ga0207695_10214386 3300025913 Bacteria 1835
387 Ga0207671_10001235 3300025914 Bacteria 30209
388 Ga0207671_10011113 3300025914 Bacteria 7361
389 Ga0207693_10006679 3300025915 Bacteria 9530
390 Ga0207663_10007556 3300025916 Archaea 5641
391 Ga0207663_10019288 3300025916 Bacteria 3838
392 Ga0207660_10227086 3300025917 Bacteria 1467
393 Ga0207662_10035802 3300025918 Bacteria 2900
394 Ga0207657_10000003 3300025919 Bacteria 263148
395 Ga0207657_10096721 3300025919 Bacteria 2456
396 Ga0207657_10464446 3300025919 Bacteria 993
397 Ga0207657_10670452 3300025919 Bacteria 807
398 Ga0207649_10363980 3300025920 Bacteria 1074
399 Ga0207652_10117474 3300025921 Bacteria 2363
400 Ga0207646_10003526 3300025922 Bacteria 17622
401 Ga0207646_10022870 3300025922 Bacteria 5747
402 Ga0207646_10053986 3300025922 Bacteria 3595
403 Ga0207646_10446914 3300025922 Bacteria 1166
404 Ga0207681_10024743 3300025923 Bacteria 3855
405 Ga0207694_10000119 3300025924 Bacteria 83771
406 Ga0207694_10177937 3300025924 Bacteria 1724
407 Ga0207694_10341400 3300025924 Bacteria 1238
408 Ga0207650_10178754 3300025925 Bacteria 1690
409 Ga0207659_10336684 3300025926 Bacteria 1249
410 Ga0207659_10497149 3300025926 Bacteria 1032
411 Ga0207687_10032388 3300025927 Bacteria 3540
412 Ga0207687_10091412 3300025927 Bacteria 2220
413 Ga0207687_10434323 3300025927 Bacteria 1086
414 Ga0207687_10458836 3300025927 Bacteria 1058
415 Ga0207700_10042572 3300025928 Bacteria 3330
416 Ga0207700_10262141 3300025928 Bacteria 1480
417 Ga0207700_10406019 3300025928 Bacteria 1194
418 Ga0207664_10000056 3300025929 Bacteria 125763
419 Ga0207664_10000450 3300025929 Bacteria 29138
420 Ga0207664_10524318 3300025929 Bacteria 1062
421 Ga0207664_10733636 3300025929 Bacteria 888
422 Ga0207644_10007235 3300025931 Bacteria 7223
423 Ga0207644_10143337 3300025931 Bacteria 1842
424 Ga0207690_10000007 3300025932 Bacteria 388533
425 Ga0207690_10001320 3300025932 Bacteria 15606
426 Ga0207690_10001889 3300025932 Bacteria 12854
427 Ga0207706_10021389 3300025933 Bacteria 5810
428 Ga0207706_10034381 3300025933 Bacteria 4510
429 Ga0207706_10043987 3300025933 Bacteria 3958
430 Ga0207706_10207904 3300025933 Bacteria 1716
431 Ga0207706_10391852 3300025933 Bacteria 1205
432 Ga0207669_10048456 3300025937 Bacteria 2524
433 Ga0207669_10142489 3300025937 Bacteria 1666
434 Ga0207704_10015826 3300025938 Bacteria 3857
435 Ga0207665_10042770 3300025939 Bacteria 3028
436 Ga0207691_10103452 3300025940 Bacteria 2539
437 Ga0207691_10177994 3300025940 Bacteria 1859
438 Ga0207691_10208364 3300025940 Bacteria 1699
439 Ga0207711_10002028 3300025941 Bacteria 18315
440 Ga0207711_10007642 3300025941 Bacteria 9041
441 Ga0207711_10084405 3300025941 Bacteria 2780
442 Ga0207711_10102941 3300025941 Bacteria 2528
443 Ga0207689_10443695 3300025942 Bacteria 1084
444 Ga0207689_10449896 3300025942 Bacteria 1076
445 Ga0207679_10054338 3300025945 Bacteria 2947
446 Ga0207679_10282687 3300025945 Bacteria 1423
447 Ga0207667_10011792 3300025949 Bacteria 10126
448 Ga0207667_10069173 3300025949 Bacteria 3675
449 Ga0207712_10092440 3300025961 Bacteria 2230
450 Ga0207712_10184990 3300025961 Bacteria 1640
451 Ga0207668_10076649 3300025972 Bacteria 2408
452 Ga0207668_10188752 3300025972 Bacteria 1631
453 Ga0207668_10260231 3300025972 Bacteria 1413
454 Ga0207668_10371323 3300025972 Bacteria 1201
455 Ga0207640_10129871 3300025981 Bacteria 1820
456 Ga0207640_10355157 3300025981 Bacteria 1179
457 Ga0207640_10825419 3300025981 Bacteria 805
458 Ga0207658_10279908 3300025986 Bacteria 1429
459 Ga0207658_10341194 3300025986 Bacteria 1302
460 Ga0207677_10014286 3300026023 Bacteria 4632
461 Ga0207703_10055143 3300026035 Bacteria 3233
462 Ga0207639_10043078 3300026041 Bacteria 3386
463 Ga0207639_10093870 3300026041 Bacteria 2407
464 Ga0207639_10295513 3300026041 Bacteria 1430
465 Ga0207678_10013434 3300026067 Bacteria 7187
466 Ga0207678_10090834 3300026067 Bacteria 2610
467 Ga0207678_10099553 3300026067 Bacteria 2483
468 Ga0207708_10005041 3300026075 Bacteria 9742
469 Ga0207708_10029087 3300026075 Bacteria 4185
470 Ga0207708_10165564 3300026075 Bacteria 1748
471 Ga0207708_10270394 3300026075 Bacteria 1375
472 Ga0207702_10000002 3300026078 Bacteria 491507
473 Ga0207648_10006160 3300026089 Bacteria 11953
474 Ga0207648_10521339 3300026089 Bacteria 1089
475 Ga0207676_10014754 3300026095 Bacteria 5628
476 Ga0207676_10081564 3300026095 Bacteria 2628
477 Ga0207674_10001403 3300026116 Bacteria 31095
478 Ga0207674_10015407 3300026116 Bacteria 8399
479 Ga0207674_10068310 3300026116 Bacteria 3576
480 Ga0207674_10177159 3300026116 Bacteria 2085
481 Ga0207675_100002884 3300026118 Bacteria 16909
482 Ga0207675_100013923 3300026118 Bacteria 7499
483 Ga0207675_100018711 3300026118 Bacteria 6465
484 Ga0207675_100030538 3300026118 Bacteria 5020
485 Ga0207675_100049980 3300026118 Bacteria 3902
486 Ga0207675_100069329 3300026118 Bacteria 3296
487 Ga0207675_100083403 3300026118 Bacteria 2998
488 Ga0207675_100107381 3300026118 Bacteria 2632
489 Ga0207675_100206193 3300026118 Bacteria 1889
490 Ga0207683_10028300 3300026121 Bacteria 4846
491 Ga0207683_10125286 3300026121 Bacteria 2308
492 Ga0207683_10199734 3300026121 Bacteria 1817
493 Ga0207698_10053661 3300026142 Bacteria 3096
494 Ga0207698_10054333 3300026142 Bacteria 3081
495 Ga0207698_10121806 3300026142 Bacteria 2209
496 Ga0209371_1000702 3300027312 Bacteria 28356
497 Ga0209589_1000014 3300027357 Bacteria 227996
498 Ga0209489_100014 3300027361 Bacteria 227996
499 Ga0209700_100024 3300027363 Bacteria 227996
500 Ga0209981_1012178 3300027378 Bacteria 1189
501 Ga0207428_10444557 3300027907 Bacteria 946
502 Ga0268266_10010004 3300028379 Bacteria 8324
503 Ga0268266_10026299 3300028379 Bacteria 4951
504 Ga0268266_10157936 3300028379 Bacteria 2050
505 Ga0268266_10170493 3300028379 Bacteria 1975
506 Ga0268265_10256350 3300028380 Bacteria 1552
507 Ga0307515_10190819 3300028794 Bacteria 1960
508 Ga0268256_1000556 3300030500 Bacteria 30238
509 Ga0265327_10008242 3300031251 Bacteria 7809
510 Ga0307513_10137611 3300031456 Bacteria 2375
511 Ga0307408_100024450 3300031548 Bacteria 4126
512 Ga0307408_100309395 3300031548 Bacteria 1327
513 Ga0307413_10226858 3300031824 Bacteria 1369
514 Ga0307410_10044340 3300031852 Bacteria 2954
515 Ga0307406_10088911 3300031901 Bacteria 2074
516 Ga0307409_100154977 3300031995 Bacteria 1995
517 Ga0307409_100193548 3300031995 Bacteria 1812
518 Ga0307409_100206223 3300031995 Bacteria 1763
519 Ga0307409_100568438 3300031995 Bacteria 1116
520 Ga0307416_100076081 3300032002 Bacteria 2812
521 Ga0307415_100233043 3300032126 Bacteria 1484
522 Ga0315911_1000002 3300033442 Bacteria 926833
523 Ga0373930_0011250 3300034816 Bacteria 1613
524 Ga0373948_0006739 3300034817 Bacteria 1911
525 Ga0373950_0003489 3300034818 Bacteria 2247
526 Ga0373959_0002098 3300034820 Bacteria 3183
527 Ga0373929_0004062 3300035085 Bacteria 2621
528 Ga0373940_0100503 3300035088 Bacteria 877
529 Ga0373952_0002581 3300035092 Bacteria 3262
530 Ga0373923_0120695 3300035111 Bacteria 1171
531 Ga0373936_0246338 3300035113 Bacteria 797
532 Ga0373945_0075004 3300035116 Bacteria 1287
533 Ga0373953_0006443 3300035117 Bacteria 3868
534 Ga0373954_0054030 3300035118 Bacteria 1889
535 Ga0373957_0005268 3300035120 Bacteria 4002
536 Ga0373960_0003165 3300035121 Bacteria 3720
537 Ga0373943_0089740 3300035170 Bacteria 1590
538 Ga0373943_0139370 3300035170 Bacteria 1305
539 Ga0373946_0067368 3300035171 Bacteria 1537
540 Ga0373955_0002074 3300035172 Bacteria 8641
541 Ga0373961_0003205 3300035241 Bacteria 4083
542 Ga0373924_0046362 3300035410 Bacteria 1790
543 Ga0373924_0132897 3300035410 Bacteria 1083
544 Ga0373935_0053895 3300035692 Bacteria 2559
545 Ga0373927_0008495 3300035695 Bacteria 6908
546 Ga0373927_0334073 3300035695 Bacteria 998
547 Ga0373933_0010030 3300035724 Bacteria 5185
548 Ga0373933_0016787 3300035724 Bacteria 4101
549 Ga0373933_0160114 3300035724 Bacteria 1429
550 Ga0373947_0044182 3300035725 Bacteria 2662
551 Ga0373947_0070557 3300035725 Bacteria 2141
552 Ga0373947_0123929 3300035725 Bacteria 1644
553 Ga0373937_0044597 3300036401 Bacteria 4051
554 Ga0373937_0443514 3300036401 Bacteria 1232
555 Ga0373925_0028650 3300037068 Bacteria 4080
556 Ga0395899_0044666 3300037312 Bacteria 3301
557 Ga0395898_0310753 3300037466 Bacteria 1504
558 Ga0395898_0556901 3300037466 Bacteria 1089
559 Ga0395905_0324024 3300037471 Bacteria 1431
560 Ga0395901_0006786 3300038443 Bacteria 11563
561 Ga0436365_0236368 3300039437 Bacteria 4199
562 Ga0436365_1466936 3300039437 Bacteria 1563
563 Ga0436361_0698579 3300039447 Bacteria 2639
564 Ga0436362_1225507 3300039453 Bacteria 1604
565 Ga0439459_0017955 3300042438 Bacteria 1324
566 Ga0466969_0003121 3300044656 Bacteria 8828
567 Ga0466969_0103227 3300044656 Bacteria 1340
568 Ga0466972_0013917 3300044658 Bacteria 4035
569 Ga0466977_0009355 3300044666 Bacteria 5517
570 Ga0466965_0001628 3300044683 Bacteria 9180
571 Ga0466966_0046859 3300044684 Bacteria 2758
572 Ga0466961_0003701 3300044693 Bacteria 9550
573 Ga0466961_0063884 3300044693 Bacteria 2339
574 Ga0466963_0006820 3300044694 Bacteria 6794
575 Ga0466971_0011871 3300044719 Bacteria 3816
576 Ga0466970_0037273 3300044765 Bacteria 2577
577 Ga0466970_0071317 3300044765 Bacteria 1869
578 Ga0466970_0114130 3300044765 Bacteria 1476
579 Ga0466957_0007716 3300044842 Bacteria 6087
580 Ga0466957_0100042 3300044842 Bacteria 1827
581 Ga0466959_0015180 3300045049 Bacteria 5610
582 Ga0466959_0069106 3300045049 Bacteria 2559
583 Ga0451576_0093229 3300045051 Bacteria 3131
584 Ga0451576_0325862 3300045051 Bacteria 1608
585 Ga0451576_0472454 3300045051 Bacteria 1317
586 Ga0466958_0045691 3300045836 Bacteria 2642
587 Ga0495617_010330 3300046452 Bacteria 3197
588 Ga0495592_0045902 3300046454 Bacteria 3258
589 Ga0495592_0048096 3300046454 Bacteria 3173
590 Ga0495592_0217136 3300046454 Unclassified 1281
591 Ga0495603_0049213 3300046455 Bacteria 2509
592 Ga0495603_0156717 3300046455 Bacteria 1321
593 Ga0495629_0003054 3300046459 Bacteria 12727
594 Ga0495629_0196029 3300046459 Bacteria 1397
595 Ga0495638_0001126 3300046460 Bacteria 25936
596 Ga0495638_0021100 3300046460 Bacteria 4296
597 Ga0495638_0070134 3300046460 Bacteria 2146
598 Ga0495638_0107341 3300046460 Bacteria 1662
599 Ga0495651_0017660 3300046462 Bacteria 5522
600 Ga0495651_0107020 3300046462 Bacteria 2072
601 Ga0495653_0017249 3300046463 Bacteria 5872
602 Ga0495653_0407542 3300046463 Bacteria 863
603 Ga0495580_0019874 3300046472 Bacteria 4981
604 Ga0495580_0041543 3300046472 Bacteria 3280
605 Ga0495664_0012705 3300046477 Bacteria 4769
606 Ga0495585_0184633 3300046492 Bacteria 1070
607 Ga0495594_0134907 3300046499 Bacteria 1399
608 Ga0495594_0231876 3300046499 Bacteria 1052
609 Ga0495596_0104505 3300046500 Bacteria 1100
610 Ga0495608_0022212 3300046511 Bacteria 4348
611 Ga0495608_0045817 3300046511 Bacteria 2912
612 Ga0495610_0000086 3300046512 Bacteria 109119
613 Ga0495616_0001081 3300046513 Bacteria 19363
614 Ga0495618_0122661 3300046514 Bacteria 1664
615 Ga0495628_0136792 3300046516 Bacteria 1872
616 Ga0495628_0678123 3300046516 Bacteria 730
617 Ga0495632_0049486 3300046519 Bacteria 2077
618 Ga0495632_0053856 3300046519 Bacteria 1974
619 Ga0495644_0044594 3300046523 Bacteria 1668
620 Ga0495648_0000936 3300046524 Bacteria 30292
621 Ga0495652_0120457 3300046529 Bacteria 2094
622 Ga0495640_0066024 3300046533 Bacteria 2441
623 Ga0495587_0004567 3300046536 Bacteria 9091
624 Ga0495587_0136985 3300046536 Bacteria 1398
625 Ga0495587_0303972 3300046536 Bacteria 892
626 Ga0495587_0384465 3300046536 Unclassified 780
627 Ga0495609_0062910 3300046538 Bacteria 1638
628 Ga0495645_0003461 3300046543 Bacteria 10707
629 Ga0495667_0020587 3300046559 Bacteria 4450
630 Ga0495667_0087092 3300046559 Bacteria 2025
631 Ga0495656_0009149 3300046615 Bacteria 3558
632 Ga0495668_0018052 3300046616 Bacteria 4083
633 Ga0495634_0017271 3300046642 Bacteria 5152
634 Ga0495635_0016639 3300046663 Bacteria 5137
635 Ga0495588_0081253 3300046674 Bacteria 1692
636 Ga0495657_0023414 3300046675 Bacteria 4413
637 Ga0495657_0062041 3300046675 Bacteria 2471
638 Ga0495599_0007931 3300046678 Bacteria 6441
639 Ga0495599_0010784 3300046678 Bacteria 5599
640 Ga0495623_0145069 3300046679 Bacteria 1408
641 Ga0495646_0001905 3300046680 Bacteria 12540
642 Ga0495646_0068538 3300046680 Bacteria 2094
643 Ga0495646_0102140 3300046680 Bacteria 1643
644 Ga0495671_0090991 3300046692 Bacteria 1493
645 Ga0495600_0010880 3300046809 Bacteria 5659
646 Ga0495600_0057288 3300046809 Bacteria 2546
647 Ga0495600_0172757 3300046809 Bacteria 1395
648 Ga0495604_0072545 3300047317 Bacteria 2601
649 Ga0495604_0099751 3300047317 Bacteria 2136
650 Ga0495674_0045817 3300047319 Bacteria 3883
651 Ga0495674_0231420 3300047319 Bacteria 1525
652 Ga0495676_0370093 3300047321 Bacteria 955
653 Ga0495680_0025590 3300047322 Bacteria 4881
654 Ga0495680_0178611 3300047322 Bacteria 1533
655 Ga0495680_0214914 3300047322 Bacteria 1375
656 Ga0495687_114774 3300047443 Bacteria 983
657 Ga0495675_0018890 3300047444 Bacteria 4379
658 Ga0495675_0034469 3300047444 Bacteria 3232
659 Ga0495673_0142716 3300047469 Bacteria 932
660 Ga0495684_0004673 3300047471 Bacteria 10687
661 Ga0495684_0111827 3300047471 Bacteria 2060
662 Ga0495686_0269948 3300047472 Bacteria 949
663 Ga0495593_0008595 3300047673 Bacteria 5938
664 Ga0495602_0014901 3300048088 Bacteria 7869
665 Ga0495602_0289274 3300048088 Unclassified 1204
666 Ga0495615_0052924 3300048090 Bacteria 1050
667 Ga0496100_0244548 3300048903 Bacteria 1325
668 Ga0496101_0007381 3300048904 Bacteria 7120
669 Ga0496101_0379966 3300048904 Bacteria 1111
670 Ga0496102_0001771 3300048905 Bacteria 18745
671 Ga0496104_0037931 3300048907 Bacteria 4506
672 Ga0496104_0077578 3300048907 Bacteria 3165
673 Ga0496104_0318801 3300048907 Bacteria 1467
674 Ga0496104_0726908 3300048907 Bacteria 900
675 Ga0496105_0060698 3300048908 Bacteria 3120
676 Ga0496105_0136182 3300048908 Bacteria 2023
677 Ga0496106_0001552 3300048909 Bacteria 17305
678 Ga0496106_0068759 3300048909 Bacteria 2702
679 Ga0496106_0242069 3300048909 Bacteria 1441
680 Ga0496106_0276704 3300048909 Bacteria 1344
681 Ga0496106_0298829 3300048909 Bacteria 1291
682 Ga0496106_0477665 3300048909 Bacteria 1001
683 Ga0496107_0001619 3300048910 Bacteria 14019
684 Ga0496107_0005793 3300048910 Bacteria 8456
685 Ga0496107_0046874 3300048910 Bacteria 3111
686 Ga0496107_0360284 3300048910 Bacteria 1082
687 Ga0496108_0000259 3300048911 Bacteria 45599
688 Ga0496108_0249097 3300048911 Bacteria 1545
689 Ga0496109_0000250 3300048912 Bacteria 51687
690 Ga0496109_0043844 3300048912 Bacteria 4055
691 Ga0496109_0076016 3300048912 Bacteria 3088
692 Ga0496109_0167877 3300048912 Bacteria 2058
693 Ga0496109_0400524 3300048912 Bacteria 1297
694 Ga0496110_0002671 3300048913 Bacteria 13465
695 Ga0496110_0070696 3300048913 Bacteria 3093
696 Ga0496111_0008568 3300048914 Bacteria 6774
697 Ga0496111_0014483 3300048914 Bacteria 5388
698 Ga0496112_0024688 3300048915 Bacteria 5762
699 Ga0496112_0181083 3300048915 Bacteria 2071
700 Ga0496112_0320189 3300048915 Bacteria 1495
701 Ga0496113_0006361 3300048916 Bacteria 7474
702 Ga0496113_0054860 3300048916 Bacteria 2985
703 Ga0496113_0067440 3300048916 Bacteria 2713
704 Ga0496114_0031799 3300048917 Bacteria 4342
705 Ga0496114_0531084 3300048917 Bacteria 1040
706 Ga0496115_0001917 3300048918 Bacteria 14846
707 Ga0496115_0002446 3300048918 Bacteria 13344
708 Ga0496115_0009899 3300048918 Bacteria 7100
709 Ga0496115_0056504 3300048918 Bacteria 3155
710 Ga0496115_0099672 3300048918 Bacteria 2381
711 Ga0496115_0221107 3300048918 Bacteria 1563
712 Ga0496117_0040595 3300048920 Bacteria 3419
713 Ga0496118_0058241 3300048921 Bacteria 2889
714 Ga0496121_0000079 3300048924 Bacteria 232653
715 Ga0496121_0000341 3300048924 Bacteria 97289
716 Ga0496121_0050547 3300048924 Bacteria 3510
717 Ga0496121_0149099 3300048924 Bacteria 1724
718 Ga0496126_0002328 3300048929 Bacteria 26027
719 Ga0496126_0029864 3300048929 Bacteria 5174
720 Ga0496126_0096800 3300048929 Bacteria 2587
721 Ga0496126_0189423 3300048929 Bacteria 1743
722 Ga0496126_0535909 3300048929 Bacteria 931
723 Ga0466983_0148994 3300048986 Bacteria 1914
724 Ga0501031_0013588 3300049568 Bacteria 5305
725 Ga0501031_0069781 3300049568 Bacteria 2289
726 Ga0501032_0000224 3300049569 Bacteria 46893
727 Ga0501033_0000095 3300049570 Bacteria 84522
728 Ga0501033_0008094 3300049570 Bacteria 8146
729 Ga0501033_0019549 3300049570 Bacteria 5121
730 Ga0501033_0063547 3300049570 Bacteria 2717
731 Ga0501033_0070461 3300049570 Bacteria 2569
732 Ga0501034_0001937 3300049571 Bacteria 26207
733 Ga0501034_0110645 3300049571 Bacteria 2738
734 Ga0501034_0124580 3300049571 Bacteria 2562
735 Ga0501036_0000007 3300049572 Bacteria 240500
736 Ga0501036_0037423 3300049572 Bacteria 4105
737 Ga0501036_0037901 3300049572 Bacteria 4078
738 Ga0501037_0000159 3300049573 Bacteria 63178
739 Ga0501037_0098107 3300049573 Bacteria 2117
740 Ga0501038_0000028 3300049574 Bacteria 144481
741 Ga0501038_0028614 3300049574 Bacteria 4951
742 Ga0501038_0060072 3300049574 Bacteria 3254
743 Ga0501038_0090141 3300049574 Bacteria 2571
744 Ga0501038_0097703 3300049574 Bacteria 2450
745 Ga0501039_0000005 3300049575 Bacteria 295471
746 Ga0501039_0050244 3300049575 Bacteria 3225
747 Ga0501041_0032755 3300049577 Bacteria 3141
748 Ga0501042_0313535 3300049578 Bacteria 1133
749 Ga0501042_0715480 3300049578 Bacteria 728
750 Ga0501043_0000127 3300049579 Bacteria 70587
751 Ga0501043_0062526 3300049579 Bacteria 2923
752 Ga0501043_0074873 3300049579 Bacteria 2659
753 Ga0501043_0138330 3300049579 Bacteria 1907
754 Ga0501046_0000032 3300049580 Bacteria 180265
755 Ga0501046_0030989 3300049580 Bacteria 4339
756 Ga0501046_0098687 3300049580 Bacteria 2242
757 Ga0501046_0128821 3300049580 Bacteria 1920
758 Ga0501047_0000077 3300049581 Bacteria 123480
759 Ga0501047_0035748 3300049581 Bacteria 4799
760 Ga0501048_0002484 3300049582 Bacteria 14086
761 Ga0501048_0061521 3300049582 Bacteria 2658
762 Ga0501048_0102916 3300049582 Bacteria 2015
763 Ga0501067_0053609 3300049583 Bacteria 2235
764 Ga0501068_0000392 3300049584 Bacteria 22164
765 Ga0501068_0050380 3300049584 Bacteria 2517
766 Ga0501069_0013965 3300049585 Bacteria 4289
767 Ga0501069_0018465 3300049585 Bacteria 3763
768 Ga0501070_0000070 3300049586 Bacteria 86706
769 Ga0501071_0089544 3300049587 Bacteria 2258
770 Ga0501073_0002575 3300049589 Bacteria 13564
771 Ga0501074_0014705 3300049590 Bacteria 5692
772 Ga0501075_0075228 3300049591 Bacteria 2553
773 Ga0501076_0078925 3300049592 Bacteria 2642
774 Ga0501076_0562270 3300049592 Bacteria 941
775 Ga0501077_0112896 3300049593 Bacteria 1723
776 Ga0501077_0151350 3300049593 Bacteria 1472
777 Ga0501202_010534 3300049652 Bacteria 1718
778 Ga0501217_015738 3300049661 Bacteria 1726
779 Ga0501243_012481 3300049675 Bacteria 1341
780 Ga0501249_038482 3300049679 Bacteria 1080
781 Ga0501225_0009988 3300049705 Bacteria 2695
782 Ga0501234_009724 3300049707 Bacteria 1501
783 Ga0501079_0026702 3300049741 Bacteria 4428
784 Ga0501080_0000035 3300049742 Bacteria 83220
785 Ga0501080_0046925 3300049742 Bacteria 4021
786 Ga0501080_0155841 3300049742 Bacteria 2110
787 Ga0501081_0391942 3300049743 Bacteria 1027
788 Ga0501081_0467581 3300049743 Bacteria 938
789 Ga0501083_0000460 3300049744 Bacteria 26118
790 Ga0501035_0000016 3300049822 Bacteria 243412
791 Ga0501035_0022425 3300049822 Bacteria 5798
792 Ga0501035_0030789 3300049822 Bacteria 4891
793 Ga0501035_0050686 3300049822 Bacteria 3719
794 Ga0501035_0114557 3300049822 Bacteria 2360
795 Ga0501035_0230244 3300049822 Bacteria 1579
796 Ga0501044_0000184 3300049823 Bacteria 77805
797 Ga0501044_0077905 3300049823 Bacteria 3360
798 Ga0501044_0137313 3300049823 Bacteria 2435
799 Ga0501044_0456807 3300049823 Bacteria 1183
800 Ga0501045_0211840 3300049824 Bacteria 1443
801 nmdc:mga0yw44_1411_c1 3300050492 Bacteria 9526
802 nmdc:mga0yw44_3789_c1 3300050492 Bacteria 6785
803 nmdc:mga07m45_29739_c1 3300050496 Bacteria 3023
804 nmdc:mga05p37_121400_c1 3300050507 Bacteria 3210
805 nmdc:mga05p37_1391_c1 3300050507 Bacteria 28154
806 nmdc:mga05p37_258881_c1 3300050507 Bacteria 2083
807 nmdc:mga05p37_306443_c1 3300050507 Bacteria 1884
808 nmdc:mga05p37_631178_c1 3300050507 Bacteria 1204
809 nmdc:mga05p37_986060_c1 3300050507 Bacteria 897
810 nmdc:mga09592_394980_c1 3300050508 Bacteria 1195
811 nmdc:mga0qj67_153842_c1 3300050509 Bacteria 1866
812 nmdc:mga0qj67_178900_c1 3300050509 Bacteria 1722
813 nmdc:mga06r32_637880_c1 3300050510 Bacteria 1034
814 nmdc:mga08y16_166574_c1 3300050511 Bacteria 2289
815 nmdc:mga08y16_225475_c1 3300050511 Bacteria 1939
816 nmdc:mga08y16_32007_c1 3300050511 Bacteria 5531
817 nmdc:mga08y16_493251_c1 3300050511 Bacteria 1245
818 nmdc:mga08y16_624339_c1 3300050511 Bacteria 1084
819 nmdc:mga0n895_27191_c1 3300050512 Bacteria 2810
820 nmdc:mga0n895_3566_c1 3300050512 Bacteria 12588
821 nmdc:mga0n895_369373_c1 3300050512 Bacteria 1452
822 nmdc:mga0rr50_613_c1 3300050513 Bacteria 19109
823 nmdc:mga0rr50_776309_c1 3300050513 Bacteria 818
824 nmdc:mga08x19_110311_c1 3300050514 Bacteria 1834
825 nmdc:mga0a205_125710_c1 3300050515 Bacteria 2464
826 nmdc:mga0a205_249058_c1 3300050515 Bacteria 1656
827 nmdc:mga0a205_30785_c1 3300050515 Bacteria 5140
828 nmdc:mga0a205_322267_c1 3300050515 Bacteria 1416
829 nmdc:mga0a205_500548_c1 3300050515 Bacteria 1072
830 nmdc:mga0a205_71037_c1 3300050515 Bacteria 3362
831 nmdc:mga0sz30_47647_c1 3300050516 Bacteria 1811
832 Ga0495601_0002804 3300053077 Bacteria 9891
833 Ga0495601_0296756 3300053077 Bacteria 1053
834 Ga0495601_0353664 3300053077 Bacteria 955
835 Ga0495612_0013808 3300053078 Bacteria 3254
836 Ga0495595_0002193 3300053084 Bacteria 7588
837 Ga0495595_0011788 3300053084 Bacteria 3663
838 Ga0495619_0009059 3300053085 Bacteria 6279
839 Ga0495619_0089462 3300053085 Bacteria 2083
840 Ga0495619_0144342 3300053085 Bacteria 1640
841 Ga0500566_0000043 3300053094 Bacteria 62755
842 Ga0500566_0004911 3300053094 Bacteria 7966
843 Ga0500641_0009742 3300053096 Bacteria 3458
844 Ga0500572_000024 3300053111 Bacteria 47391
845 Ga0500591_065678 3300053115 Bacteria 1659
846 Ga0500614_001091 3300053123 Bacteria 6714
847 Ga0500642_0019497 3300053130 Bacteria 2647
848 Ga0500642_0040489 3300053130 Bacteria 2010
849 Ga0500658_0066813 3300053134 Bacteria 1509
850 Ga0500585_027304 3300053144 Bacteria 1936
851 Ga0500589_184579 3300053147 Bacteria 816
852 Ga0500603_000121 3300053150 Bacteria 18383
853 Ga0500603_001758 3300053150 Bacteria 4870
854 Ga0500604_0000045 3300053151 Bacteria 47198
855 Ga0500616_0004754 3300053153 Bacteria 9546
856 Ga0500616_0079029 3300053153 Bacteria 1657
857 Ga0500630_000112 3300053159 Bacteria 26672
858 Ga0500638_022422 3300053162 Bacteria 2993
859 Ga0500639_000040 3300053163 Bacteria 63516
860 Ga0501084_0008371 3300054114 Bacteria 8540
861 Ga0501084_0040639 3300054114 Bacteria 3891
862 Ga0501082_0039048 3300060353 Bacteria 4095
863 Ga0501082_0295050 3300060353 Bacteria 1412
864 Ga0501082_0590850 3300060353 Bacteria 971
865 Ga0466962_0007393 3300061719 Bacteria 5269
866 Ga0530510_0011295 3300061734 Bacteria 6268
867 2513654077 2513237096 Bacteria 8722461
868 2513856829 2513237137 Bacteria 9558895
869 2513918417 2513237145 Bacteria 8979722
870 2517891349 2517572143 Bacteria 9484767
871 2519460451 2519103095 Bacteria 6629912
872 2524540887 2524023228 Bacteria 10118060
873 2585265258 2582581306 Bacteria 6450535
874 2585295706 2582581311 Bacteria 6763856
875 2585385608 2582581865 Bacteria 6644329
876 2599740669 2599185239 Bacteria 8686614
877 2599748324 2599185240 Bacteria 7968121
878 2600192813 2599185352 Bacteria 7228948
879 2600210236 2599185355 Bacteria 7968906
880 2644672979 2643221723 Bacteria 7095460
881 2671118871 2667528175 Bacteria 7532676
882 2676745726 2675903129 Bacteria 7964495
883 2728750062 2728368998 Bacteria 8720350
884 2793066717 2791355197 Bacteria 8420563
885 2817257758 2816332253 Bacteria 6764532
886 2817281844 2816332256 Bacteria 6891714
887 2817451415 2816332286 Bacteria 6853759
888 2819637568 2818991452 Bacteria 8442785
889 2838034875 2838029111 Bacteria 6603031
890 2842481631 2842475841 Bacteria 6603183
891 2842507990 2842502639 Bacteria 6604161
892 2863427079 2863421361 Bacteria 7300805
893 2870073732 2870068957 Bacteria 8925310
894 2876817721 2876808645 Bacteria 8824342
895 2879111853 2879110137 Bacteria 8907982
896 2885374997 2885374607 Bacteria 8927485
897 2895395720 2895395659 Bacteria 3983269
898 2903755310 2903748898 Bacteria 9972761
899 2904571061 2904564687 Bacteria 7609577
900 2904578227 2904571731 Bacteria 7608790
901 2904691218 2904690495 Bacteria 9412302
902 2904701303
903 2906616535
904 2906635308 2906635258 Bacteria 8601019
905 2906666853 2906660503 Bacteria 8595048
906 2908741703 2908739725 Bacteria 8628932
907 2908759141 2908756301 Bacteria 8864324
908 2922387363 2922386360 Bacteria 7017218
909 2922431445
910 2928158199 2928157003 Bacteria 7522202
911 2928167580 2928163908 Bacteria 7561269
912 2928177899 2928170801 Bacteria 8785406
913 2928542843 2928536128 Bacteria 7657547
914 2935634041 2935630451 Bacteria 8169952
915 2941510656 2941507105 Bacteria 8166816
916 2941518040 2941515067 Bacteria 8166720
917 2941527089 2941523033 Bacteria 8169134
918 2981997256 2981990288 Bacteria 7590678
919 3005481238 3005474847 Bacteria 9259049
920 8005488077 8005484373 Bacteria 6297373
921 8006939471 8006933436 Bacteria 10410654
922 8006979221 8006973647 Bacteria 10679141
923 8006984415 8006984368 Bacteria 9651211
924 8018852274 8018845410 Bacteria 8933938
925 8019565349 8019555841 Bacteria 9642137
926 8019575449 8019565922 Bacteria 9639779
927 8020808278 8020807995 Bacteria 6801506
928 8020943817 8020938398 Bacteria 7472757
929 8020952834 8020945358 Bacteria 8467355
930 8020954657 8020953355 Bacteria 7439080
931 8021123679 8021120328 Bacteria 8782274
932 8039104403 8039098773 Bacteria 6602928
933 8040172327 8040167225 Bacteria 6542727
934 8040178996 8040173305 Bacteria 6827067
935 8056693075 8056689827 Bacteria 6712655
936 Ga0070709_10210226
937 JGI24740J21852_10024707
938 JGI24739J22299_10011315
939 JGI24739J22299_10022764
940 JGI24737J22298_10074716
941 JGI25155J39150_1000034
942 JGI25156J39149_1000008
943 JGI25156J39149_1001728
944 JGI25162J39368_1000571
945 JGI25162J39368_1001418
946 JGI25162J39368_1001489
947 JGI25154J39366_1000063
948 JGI25154J39366_1003899
949 JGI25158J39367_1015551
950 JGI25157J39369_1000028
951 JGI25157J39369_1000062
952 JGI25157J39369_1003754
953 JGI25164J39214_1000217
954 JGI25164J39214_1000501
955 JGI25159J45721_1000013
956 JGI25406J46586_10050458
957 JGI25165J46597_1000453
958 JGI25165J46597_1000578
959 JGI25165J46597_1000814
960 JGI25153J46596_10008855
961 rootL2_10003826
962 JGI25160J50197_1000013
963 JGI25161J50226_1000579
964 Ga0055532_1001218
965 Ga0055532_1001241
966 Ga0055532_1001698
967 Ga0055527_1001232
968 Ga0055527_1002377
969 Ga0055527_1002494
970 Ga0055535_1000615
971 Ga0055535_1002165
972 Ga0055535_1002740
973 Ga0055542_1000496
974 Ga0055542_1002048
975 Ga0055542_1006036
976 Ga0055529_1000116
977 Ga0055529_1001408
978 Ga0055536_1000412
979 Ga0055528_1000843
980 Ga0055531_10009427
981 Ga0055541_1013402
982 Ga0055543_1000606
983 Ga0065165_1000021
984 Ga0065704_10181965
985 Ga0065707_10001372
986 Ga0070658_10262350
987 Ga0070676_10010334
988 Ga0070676_10167613
989 Ga0070683_100501745
990 Ga0070690_100037204
991 Ga0070677_10262576
992 Ga0070666_10003190
993 Ga0070666_10199306
994 Ga0070680_100031361
995 Ga0070682_100008953
996 Ga0070682_100780835
997 Ga0070660_100000351
998 Ga0070660_100061318
999 Ga0070660_100600487
1000 Ga0070691_10002329
1001 Ga0070687_100055826
1002 Ga0070687_100119700
1003 Ga0070692_10001267
1004 Ga0070668_100140112
1005 Ga0070669_100070332
1006 Ga0070675_100002724
1007 Ga0070675_100170859
1008 Ga0070671_100008249
1009 Ga0070674_100012062
1010 Ga0070674_100024749
1011 Ga0070659_100004655
1012 Ga0070659_100006462
1013 Ga0070659_100044907
1014 Ga0070667_100012141
1015 Ga0070667_100035078
1016 Ga0070703_10000608
1017 Ga0070703_10084321
1018 Ga0070714_100000068
1019 Ga0070714_100044744
1020 Ga0070714_100432438
1021 Ga0070713_100073385
1022 Ga0070713_100250032
1023 Ga0070710_10021561
1024 Ga0070710_10105756
1025 Ga0070701_10133388
1026 Ga0070701_10248649
1027 Ga0070711_100009700
1028 Ga0070711_100019538
1029 Ga0070705_100009745
1030 Ga0070705_100012975
1031 Ga0070705_100125001
1032 Ga0070700_100003570
1033 Ga0070700_100102933
1034 Ga0070700_100192697
1035 Ga0070708_100013388
1036 Ga0070708_100331070
1037 Ga0070708_100452975
1038 Ga0070663_100032808
1039 Ga0070663_100049973
1040 Ga0070663_100208011
1041 Ga0070663_100318552
1042 Ga0070678_100193823
1043 Ga0070662_100078651
1044 Ga0070662_100122783
1045 Ga0070662_100201103
1046 Ga0070662_100328953
1047 Ga0070681_10013078
1048 Ga0068867_100075667
1049 Ga0068867_100150834
1050 Ga0068867_100158862
1051 Ga0068867_100451811
1052 Ga0070706_100113453
1053 Ga0070706_100202022
1054 Ga0070707_100032869
1055 Ga0070707_100088722
1056 Ga0070707_100090652
1057 Ga0070707_100335764
1058 Ga0070707_100408809
1059 Ga0070707_100503978
1060 Ga0070698_100381706
1061 Ga0070698_100524162
1062 Ga0070699_100045657
1063 Ga0070699_100180404
1064 Ga0070699_100220091
1065 Ga0070699_100670634
1066 Ga0070679_100014122
1067 Ga0070679_100248404
1068 Ga0070679_100598929
1069 Ga0070684_100161538
1070 Ga0070697_100096888
1071 Ga0070697_100099716
1072 Ga0070697_100432625
1073 Ga0068853_100026218
1074 Ga0068853_100070929
1075 Ga0070672_100074296
1076 Ga0070672_100106450
1077 Ga0070686_100000969
1078 Ga0070686_100023244
1079 Ga0070686_100047287
1080 Ga0070686_100166639
1081 Ga0070696_100062401
1082 Ga0070693_100001301
1083 Ga0070665_100005165
1084 Ga0070665_100102777
1085 Ga0070665_100127837
1086 Ga0070665_100141029
1087 Ga0070665_100161327
1088 Ga0070704_100018217
1089 Ga0070704_100226031
1090 Ga0068855_100020164
1091 Ga0068855_100031608
1092 Ga0068855_100055489
1093 Ga0068855_100550330
1094 Ga0070664_100027907
1095 Ga0070664_100067766
1096 Ga0068857_100082006
1097 Ga0068854_100010194
1098 Ga0068854_100088228
1099 Ga0068854_100402553
1100 Ga0068856_100094136
1101 Ga0068856_100106510
1102 Ga0070702_100002583
1103 Ga0068852_100052029
1104 Ga0068859_100007576
1105 Ga0068859_100092345
1106 Ga0068859_100118531
1107 Ga0068864_100010239
1108 Ga0068864_100054265
1109 Ga0068861_100007517
1110 Ga0068861_100010512
1111 Ga0068861_100026180
1112 Ga0068861_100050178
1113 Ga0068861_100063863
1114 Ga0068861_100076320
1115 Ga0068861_100224388
1116 Ga0068861_100284977
1117 Ga0068851_10001679
1118 Ga0068851_10005246
1119 Ga0068870_10168713
1120 Ga0068858_100022945
1121 Ga0068860_100951534
1122 Ga0068862_100074855
1123 Ga0068862_100190149
1124 Ga0068862_100333471
1125 Ga0081538_10021735
1126 Ga0081538_10124123
1127 Ga0081540_1099399
1128 Ga0081539_10000630
1129 Ga0081539_10015247
1130 Ga0070717_10029350
1131 Ga0075365_10049319
1132 Ga0075368_10040175
1133 Ga0075368_10040364
1134 Ga0075363_100208221
1135 Ga0075364_10196049
1136 Ga0070712_100013161
1137 Ga0070712_100133172
1138 Ga0075367_10012607
1139 Ga0075366_10267384
1140 Ga0097621_100165838
1141 Ga0097621_100319131
1142 Ga0075370_10038007
1143 Ga0075428_101147550
1144 Ga0075430_100009905
1145 Ga0075430_100124499
1146 Ga0075431_100044225
1147 Ga0075431_100123947
1148 Ga0075431_100713411
1149 Ga0075433_10091906
1150 Ga0075433_10108020
1151 Ga0075433_10179345
1152 Ga0075433_10447440
1153 Ga0075434_100059788
1154 Ga0075434_100576201
1155 Ga0075429_100194276
1156 Ga0075429_100414285
1157 Ga0068865_100033651
1158 Ga0075436_100073103
1159 Ga0097620_100007576
1160 Ga0097620_100092342
1161 Ga0097620_100118524
1162 Ga0099822_1018218
1163 Ga0075435_100000748
1164 Ga0075435_100764568
1165 Ga0099794_10011757
1166 Ga0099795_10017844
1167 Ga0105250_10003347
1168 Ga0105240_10001826
1169 Ga0105240_10017056
1170 Ga0105240_10024259
1171 Ga0105240_10120529
1172 Ga0105240_10178234
1173 Ga0105240_10180093
1174 Ga0105240_10438205
1175 Ga0111539_10040038
1176 Ga0111539_10148878
1177 Ga0111539_10261612
1178 Ga0105245_10153275
1179 Ga0105247_10006851
1180 Ga0105247_10013904
1181 Ga0105247_10194142
1182 Ga0114129_10034752
1183 Ga0114129_10154721
1184 Ga0114129_10224048
1185 Ga0114129_10786479
1186 Ga0114129_10825084
1187 Ga0105243_10018993
1188 Ga0105243_10023265
1189 Ga0105241_10026612
1190 Ga0105241_10239527
1191 Ga0105242_10699585
1192 Ga0105248_10003133
1193 Ga0105248_10097999
1194 Ga0105248_10417122
1195 Ga0105248_10528864
1196 Ga0105248_10757863
1197 Ga0105237_10014432
1198 Ga0105237_10026052
1199 Ga0105237_10077928
1200 Ga0105237_10101019
1201 Ga0105237_10205762
1202 Ga0105237_10535237
1203 Ga0105238_10002530
1204 Ga0105238_10005146
1205 Ga0105238_10017925
1206 Ga0105238_10900145
1207 Ga0105249_10219662
1208 Ga0099796_10052193
1209 Ga0105239_10000113
1210 Ga0105239_10019468
1211 Ga0105239_10066367
1212 Ga0105239_10075749
1213 Ga0105239_10480984
1214 Ga0105239_10541965
1215 Ga0105246_10051796
1216 Ga0105246_10197976
1217 Ga0157373_10366462
1218 Ga0157371_10011722
1219 Ga0157371_10012947
1220 Ga0157371_10145373
1221 Ga0157370_10018266
1222 Ga0157370_10043871
1223 Ga0157370_10058936
1224 Ga0157370_10105073
1225 Ga0157370_10106002
1226 Ga0157370_10642799
1227 Ga0157369_10063928
1228 Ga0157369_10531302
1229 Ga0157374_10208558
1230 Ga0157378_10082070
1231 Ga0157378_10278021
1232 Ga0163162_10270255
1233 Ga0157372_10086714
1234 Ga0157372_10385677
1235 Ga0157375_10177401
1236 Ga0157375_10281728
1237 Ga0163163_10010202
1238 Ga0157380_10004569
1239 Ga0157380_10223094
1240 Ga0182008_10063793
1241 Ga0182008_10153861
1242 Ga0157377_10060639
1243 Ga0157379_10003720
1244 Ga0157379_10397176
1245 Ga0157376_10062605
1246 Ga0182006_1042338
1247 Ga0182006_1099721
1248 Ga0182007_10010394
1249 Ga0182007_10014124
1250 Ga0163161_10051522
1251 Ga0213872_10001206
1252 Ga0209435_100020
1253 Ga0209436_100699
1254 Ga0209566_100507
1255 Ga0209672_100020
1256 Ga0209672_100045
1257 Ga0209672_100337
1258 Ga0209147_100024
1259 Ga0209147_101591
1260 Ga0209147_101614
1261 Ga0207427_100228
1262 Ga0207427_100229
1263 Ga0209437_100039
1264 Ga0209437_100370
1265 Ga0209258_100084
1266 Ga0209258_100200
1267 Ga0209258_100587
1268 Ga0209646_1000070
1269 Ga0209646_1003227
1270 Ga0209026_1000057
1271 Ga0209026_1001184
1272 Ga0209148_1000045
1273 Ga0209148_1000737
1274 Ga0209148_1001237
1275 Ga0209759_1000047
1276 Ga0209759_1000247
1277 Ga0209759_1006664
1278 Ga0209233_1000090
1279 Ga0209233_1000336
1280 Ga0209233_1003552
1281 Ga0209455_1000035
1282 Ga0209455_1000551
1283 Ga0209455_1000585
1284 Ga0209673_1000057
1285 Ga0209130_1000039
1286 Ga0209676_1001587
1287 Ga0209025_1000301
1288 Ga0209564_1000081
1289 Ga0209564_1025857
1290 Ga0209758_1015407
1291 Ga0209050_1004758
1292 Ga0209256_1004366
1293 Ga0207426_1000099
1294 Ga0209051_1002050
1295 Ga0209257_1004214
1296 Ga0207697_10023834
1297 Ga0207656_10000902
1298 Ga0207656_10011143
1299 Ga0207653_10000611
1300 Ga0207653_10022033
1301 Ga0207688_10027182
1302 Ga0207680_10012423
1303 Ga0207647_10018202
1304 Ga0207647_10021487
1305 Ga0207647_10187769
1306 Ga0207699_10078486
1307 Ga0207699_10234709
1308 Ga0207645_10001251
1309 Ga0207645_10064837
1310 Ga0207645_10237160
1311 Ga0207643_10155789
1312 Ga0207705_10020240
1313 Ga0207684_10003614
1314 Ga0207684_10082993
1315 Ga0207684_10123171
1316 Ga0207654_10000757
1317 Ga0207707_10039025
1318 Ga0207695_10000424
1319 Ga0207695_10010815
1320 Ga0207695_10190939
1321 Ga0207695_10214386
1322 Ga0207671_10001235
1323 Ga0207671_10011113
1324 Ga0207693_10006679
1325 Ga0207663_10007556
1326 Ga0207663_10019288
1327 Ga0207660_10227086
1328 Ga0207662_10035802
1329 Ga0207657_10000003
1330 Ga0207657_10096721
1331 Ga0207657_10464446
1332 Ga0207657_10670452
1333 Ga0207649_10363980
1334 Ga0207652_10117474
1335 Ga0207646_10003526
1336 Ga0207646_10022870
1337 Ga0207646_10053986
1338 Ga0207646_10446914
1339 Ga0207681_10024743
1340 Ga0207694_10000119
1341 Ga0207694_10177937
1342 Ga0207694_10341400
1343 Ga0207650_10178754
1344 Ga0207659_10336684
1345 Ga0207659_10497149
1346 Ga0207687_10032388
1347 Ga0207687_10091412
1348 Ga0207687_10434323
1349 Ga0207687_10458836
1350 Ga0207700_10042572
1351 Ga0207700_10262141
1352 Ga0207700_10406019
1353 Ga0207664_10000056
1354 Ga0207664_10000450
1355 Ga0207664_10524318
1356 Ga0207664_10733636
1357 Ga0207644_10007235
1358 Ga0207644_10143337
1359 Ga0207690_10000007
1360 Ga0207690_10001320
1361 Ga0207690_10001889
1362 Ga0207706_10021389
1363 Ga0207706_10034381
1364 Ga0207706_10043987
1365 Ga0207706_10207904
1366 Ga0207706_10391852
1367 Ga0207669_10048456
1368 Ga0207669_10142489
1369 Ga0207704_10015826
1370 Ga0207665_10042770
1371 Ga0207691_10103452
1372 Ga0207691_10177994
1373 Ga0207691_10208364
1374 Ga0207711_10002028
1375 Ga0207711_10007642
1376 Ga0207711_10084405
1377 Ga0207711_10102941
1378 Ga0207689_10443695
1379 Ga0207689_10449896
1380 Ga0207679_10054338
1381 Ga0207679_10282687
1382 Ga0207667_10011792
1383 Ga0207667_10069173
1384 Ga0207712_10092440
1385 Ga0207712_10184990
1386 Ga0207668_10076649
1387 Ga0207668_10188752
1388 Ga0207668_10260231
1389 Ga0207668_10371323
1390 Ga0207640_10129871
1391 Ga0207640_10355157
1392 Ga0207640_10825419
1393 Ga0207658_10279908
1394 Ga0207658_10341194
1395 Ga0207677_10014286
1396 Ga0207703_10055143
1397 Ga0207639_10043078
1398 Ga0207639_10093870
1399 Ga0207639_10295513
1400 Ga0207678_10013434
1401 Ga0207678_10090834
1402 Ga0207678_10099553
1403 Ga0207708_10005041
1404 Ga0207708_10029087
1405 Ga0207708_10165564
1406 Ga0207708_10270394
1407 Ga0207702_10000002
1408 Ga0207648_10006160
1409 Ga0207648_10521339
1410 Ga0207676_10014754
1411 Ga0207676_10081564
1412 Ga0207674_10001403
1413 Ga0207674_10015407
1414 Ga0207674_10068310
1415 Ga0207674_10177159
1416 Ga0207675_100002884
1417 Ga0207675_100013923
1418 Ga0207675_100018711
1419 Ga0207675_100030538
1420 Ga0207675_100049980
1421 Ga0207675_100069329
1422 Ga0207675_100083403
1423 Ga0207675_100107381
1424 Ga0207675_100206193
1425 Ga0207683_10028300
1426 Ga0207683_10125286
1427 Ga0207683_10199734
1428 Ga0207698_10053661
1429 Ga0207698_10054333
1430 Ga0207698_10121806
1431 Ga0209371_1000702
1432 Ga0209589_1000014
1433 Ga0209489_100014
1434 Ga0209700_100024
1435 Ga0209981_1012178
1436 Ga0207428_10444557
1437 Ga0268266_10010004
1438 Ga0268266_10026299
1439 Ga0268266_10157936
1440 Ga0268266_10170493
1441 Ga0268265_10256350
1442 Ga0307515_10190819
1443 Ga0268256_1000556
1444 Ga0265327_10008242
1445 Ga0307513_10137611
1446 Ga0307408_100024450
1447 Ga0307408_100309395
1448 Ga0307413_10226858
1449 Ga0307410_10044340
1450 Ga0307406_10088911
1451 Ga0307409_100154977
1452 Ga0307409_100193548
1453 Ga0307409_100206223
1454 Ga0307409_100568438
1455 Ga0307416_100076081
1456 Ga0307415_100233043
1457 Ga0315911_1000002
1458 Ga0373930_0011250
1459 Ga0373948_0006739
1460 Ga0373950_0003489
1461 Ga0373959_0002098
1462 Ga0373929_0004062
1463 Ga0373940_0100503
1464 Ga0373952_0002581
1465 Ga0373923_0120695
1466 Ga0373936_0246338
1467 Ga0373945_0075004
1468 Ga0373953_0006443
1469 Ga0373954_0054030
1470 Ga0373957_0005268
1471 Ga0373960_0003165
1472 Ga0373943_0089740
1473 Ga0373943_0139370
1474 Ga0373946_0067368
1475 Ga0373955_0002074
1476 Ga0373961_0003205
1477 Ga0373924_0046362
1478 Ga0373924_0132897
1479 Ga0373935_0053895
1480 Ga0373927_0008495
1481 Ga0373927_0334073
1482 Ga0373933_0010030
1483 Ga0373933_0016787
1484 Ga0373933_0160114
1485 Ga0373947_0044182
1486 Ga0373947_0070557
1487 Ga0373947_0123929
1488 Ga0373937_0044597
1489 Ga0373937_0443514
1490 Ga0373925_0028650
1491 Ga0395899_0044666
1492 Ga0395898_0310753
1493 Ga0395898_0556901
1494 Ga0395905_0324024
1495 Ga0395901_0006786
1496 Ga0436365_0236368
1497 Ga0436365_1466936
1498 Ga0436361_0698579
1499 Ga0436362_1225507
1500 Ga0439459_0017955
1501 Ga0466969_0003121
1502 Ga0466969_0103227
1503 Ga0466972_0013917
1504 Ga0466977_0009355
1505 Ga0466965_0001628
1506 Ga0466966_0046859
1507 Ga0466961_0003701
1508 Ga0466961_0063884
1509 Ga0466963_0006820
1510 Ga0466971_0011871
1511 Ga0466970_0037273
1512 Ga0466970_0071317
1513 Ga0466970_0114130
1514 Ga0466957_0007716
1515 Ga0466957_0100042
1516 Ga0466959_0015180
1517 Ga0466959_0069106
1518 Ga0451576_0093229
1519 Ga0451576_0325862
1520 Ga0451576_0472454
1521 Ga0466958_0045691
1522 Ga0495617_010330
1523 Ga0495592_0045902
1524 Ga0495592_0048096
1525 Ga0495592_0217136
1526 Ga0495603_0049213
1527 Ga0495603_0156717
1528 Ga0495629_0003054
1529 Ga0495629_0196029
1530 Ga0495638_0001126
1531 Ga0495638_0021100
1532 Ga0495638_0070134
1533 Ga0495638_0107341
1534 Ga0495651_0017660
1535 Ga0495651_0107020
1536 Ga0495653_0017249
1537 Ga0495653_0407542
1538 Ga0495580_0019874
1539 Ga0495580_0041543
1540 Ga0495664_0012705
1541 Ga0495585_0184633
1542 Ga0495594_0134907
1543 Ga0495594_0231876
1544 Ga0495596_0104505
1545 Ga0495608_0022212
1546 Ga0495608_0045817
1547 Ga0495610_0000086
1548 Ga0495616_0001081
1549 Ga0495618_0122661
1550 Ga0495628_0136792
1551 Ga0495628_0678123
1552 Ga0495632_0049486
1553 Ga0495632_0053856
1554 Ga0495644_0044594
1555 Ga0495648_0000936
1556 Ga0495652_0120457
1557 Ga0495640_0066024
1558 Ga0495587_0004567
1559 Ga0495587_0136985
1560 Ga0495587_0303972
1561 Ga0495587_0384465
1562 Ga0495609_0062910
1563 Ga0495645_0003461
1564 Ga0495667_0020587
1565 Ga0495667_0087092
1566 Ga0495656_0009149
1567 Ga0495668_0018052
1568 Ga0495634_0017271
1569 Ga0495635_0016639
1570 Ga0495588_0081253
1571 Ga0495657_0023414
1572 Ga0495657_0062041
1573 Ga0495599_0007931
1574 Ga0495599_0010784
1575 Ga0495623_0145069
1576 Ga0495646_0001905
1577 Ga0495646_0068538
1578 Ga0495646_0102140
1579 Ga0495671_0090991
1580 Ga0495600_0010880
1581 Ga0495600_0057288
1582 Ga0495600_0172757
1583 Ga0495604_0072545
1584 Ga0495604_0099751
1585 Ga0495674_0045817
1586 Ga0495674_0231420
1587 Ga0495676_0370093
1588 Ga0495680_0025590
1589 Ga0495680_0178611
1590 Ga0495680_0214914
1591 Ga0495687_114774
1592 Ga0495675_0018890
1593 Ga0495675_0034469
1594 Ga0495673_0142716
1595 Ga0495684_0004673
1596 Ga0495684_0111827
1597 Ga0495686_0269948
1598 Ga0495593_0008595
1599 Ga0495602_0014901
1600 Ga0495602_0289274
1601 Ga0495615_0052924
1602 Ga0496100_0244548
1603 Ga0496101_0007381
1604 Ga0496101_0379966
1605 Ga0496102_0001771
1606 Ga0496104_0037931
1607 Ga0496104_0077578
1608 Ga0496104_0318801
1609 Ga0496104_0726908
1610 Ga0496105_0060698
1611 Ga0496105_0136182
1612 Ga0496106_0001552
1613 Ga0496106_0068759
1614 Ga0496106_0242069
1615 Ga0496106_0276704
1616 Ga0496106_0298829
1617 Ga0496106_0477665
1618 Ga0496107_0001619
1619 Ga0496107_0005793
1620 Ga0496107_0046874
1621 Ga0496107_0360284
1622 Ga0496108_0000259
1623 Ga0496108_0249097
1624 Ga0496109_0000250
1625 Ga0496109_0043844
1626 Ga0496109_0076016
1627 Ga0496109_0167877
1628 Ga0496109_0400524
1629 Ga0496110_0002671
1630 Ga0496110_0070696
1631 Ga0496111_0008568
1632 Ga0496111_0014483
1633 Ga0496112_0024688
1634 Ga0496112_0181083
1635 Ga0496112_0320189
1636 Ga0496113_0006361
1637 Ga0496113_0054860
1638 Ga0496113_0067440
1639 Ga0496114_0031799
1640 Ga0496114_0531084
1641 Ga0496115_0001917
1642 Ga0496115_0002446
1643 Ga0496115_0009899
1644 Ga0496115_0056504
1645 Ga0496115_0099672
1646 Ga0496115_0221107
1647 Ga0496117_0040595
1648 Ga0496118_0058241
1649 Ga0496121_0000079
1650 Ga0496121_0000341
1651 Ga0496121_0050547
1652 Ga0496121_0149099
1653 Ga0496126_0002328
1654 Ga0496126_0029864
1655 Ga0496126_0096800
1656 Ga0496126_0189423
1657 Ga0496126_0535909
1658 Ga0466983_0148994
1659 Ga0501031_0013588
1660 Ga0501031_0069781
1661 Ga0501032_0000224
1662 Ga0501033_0000095
1663 Ga0501033_0008094
1664 Ga0501033_0019549
1665 Ga0501033_0063547
1666 Ga0501033_0070461
1667 Ga0501034_0001937
1668 Ga0501034_0110645
1669 Ga0501034_0124580
1670 Ga0501036_0000007
1671 Ga0501036_0037423
1672 Ga0501036_0037901
1673 Ga0501037_0000159
1674 Ga0501037_0098107
1675 Ga0501038_0000028
1676 Ga0501038_0028614
1677 Ga0501038_0060072
1678 Ga0501038_0090141
1679 Ga0501038_0097703
1680 Ga0501039_0000005
1681 Ga0501039_0050244
1682 Ga0501041_0032755
1683 Ga0501042_0313535
1684 Ga0501042_0715480
1685 Ga0501043_0000127
1686 Ga0501043_0062526
1687 Ga0501043_0074873
1688 Ga0501043_0138330
1689 Ga0501046_0000032
1690 Ga0501046_0030989
1691 Ga0501046_0098687
1692 Ga0501046_0128821
1693 Ga0501047_0000077
1694 Ga0501047_0035748
1695 Ga0501048_0002484
1696 Ga0501048_0061521
1697 Ga0501048_0102916
1698 Ga0501067_0053609
1699 Ga0501068_0000392
1700 Ga0501068_0050380
1701 Ga0501069_0013965
1702 Ga0501069_0018465
1703 Ga0501070_0000070
1704 Ga0501071_0089544
1705 Ga0501073_0002575
1706 Ga0501074_0014705
1707 Ga0501075_0075228
1708 Ga0501076_0078925
1709 Ga0501076_0562270
1710 Ga0501077_0112896
1711 Ga0501077_0151350
1712 Ga0501202_010534
1713 Ga0501217_015738
1714 Ga0501243_012481
1715 Ga0501249_038482
1716 Ga0501225_0009988
1717 Ga0501234_009724
1718 Ga0501079_0026702
1719 Ga0501080_0000035
1720 Ga0501080_0046925
1721 Ga0501080_0155841
1722 Ga0501081_0391942
1723 Ga0501081_0467581
1724 Ga0501083_0000460
1725 Ga0501035_0000016
1726 Ga0501035_0022425
1727 Ga0501035_0030789
1728 Ga0501035_0050686
1729 Ga0501035_0114557
1730 Ga0501035_0230244
1731 Ga0501044_0000184
1732 Ga0501044_0077905
1733 Ga0501044_0137313
1734 Ga0501044_0456807
1735 Ga0501045_0211840
1736 nmdc:mga0yw44_1411_c1
1737 nmdc:mga0yw44_3789_c1
1738 nmdc:mga07m45_29739_c1
1739 nmdc:mga05p37_121400_c1
1740 nmdc:mga05p37_1391_c1
1741 nmdc:mga05p37_258881_c1
1742 nmdc:mga05p37_306443_c1
1743 nmdc:mga05p37_631178_c1
1744 nmdc:mga05p37_986060_c1
1745 nmdc:mga09592_394980_c1
1746 nmdc:mga0qj67_153842_c1
1747 nmdc:mga0qj67_178900_c1
1748 nmdc:mga06r32_637880_c1
1749 nmdc:mga08y16_166574_c1
1750 nmdc:mga08y16_225475_c1
1751 nmdc:mga08y16_32007_c1
1752 nmdc:mga08y16_493251_c1
1753 nmdc:mga08y16_624339_c1
1754 nmdc:mga0n895_27191_c1
1755 nmdc:mga0n895_3566_c1
1756 nmdc:mga0n895_369373_c1
1757 nmdc:mga0rr50_613_c1
1758 nmdc:mga0rr50_776309_c1
1759 nmdc:mga08x19_110311_c1
1760 nmdc:mga0a205_125710_c1
1761 nmdc:mga0a205_249058_c1
1762 nmdc:mga0a205_30785_c1
1763 nmdc:mga0a205_322267_c1
1764 nmdc:mga0a205_500548_c1
1765 nmdc:mga0a205_71037_c1
1766 nmdc:mga0sz30_47647_c1
1767 Ga0495601_0002804
1768 Ga0495601_0296756
1769 Ga0495601_0353664
1770 Ga0495612_0013808
1771 Ga0495595_0002193
1772 Ga0495595_0011788
1773 Ga0495619_0009059
1774 Ga0495619_0089462
1775 Ga0495619_0144342
1776 Ga0500566_0000043
1777 Ga0500566_0004911
1778 Ga0500641_0009742
1779 Ga0500572_000024
1780 Ga0500591_065678
1781 Ga0500614_001091
1782 Ga0500642_0019497
1783 Ga0500642_0040489
1784 Ga0500658_0066813
1785 Ga0500585_027304
1786 Ga0500589_184579
1787 Ga0500603_000121
1788 Ga0500603_001758
1789 Ga0500604_0000045
1790 Ga0500616_0004754
1791 Ga0500616_0079029
1792 Ga0500630_000112
1793 Ga0500638_022422
1794 Ga0500639_000040
1795 Ga0501084_0008371
1796 Ga0501084_0040639
1797 Ga0501082_0039048
1798 Ga0501082_0295050
1799 Ga0501082_0590850
1800 Ga0466962_0007393
1801 Ga0530510_0011295
1802 2513654077
1803 2513856829
1804 2513918417
1805 2517891349
1806 2519460451
1807 2524540887
1808 2585265258
1809 2585295706
1810 2585385608
1811 2599740669
1812 2599748324
1813 2600192813
1814 2600210236
1815 2644672979
1816 2671118871
1817 2676745726
1818 2728750062
1819 2793066717
1820 2817257758
1821 2817281844
1822 2817451415
1823 2819637568
1824 2838034875
1825 2842481631
1826 2842507990
1827 2863427079
1828 2870073732
1829 2876817721
1830 2879111853
1831 2885374997
1832 2895395720
1833 2903755310
1834 2904571061
1835 2904578227
1836 2904691218
1837 2904701303
1838 2906616535
1839 2906635308
1840 2906666853
1841 2908741703
1842 2908759141
1843 2922387363
1844 2922431445
1845 2928158199
1846 2928167580
1847 2928177899
1848 2928542843
1849 2935634041
1850 2941510656
1851 2941518040
1852 2941527089
1853 2981997256
1854 3005481238
1855 8005488077
1856 8006939471
1857 8006979221
1858 8006984415
1859 8018852274
1860 8019565349
1861 8019575449
1862 8020808278
1863 8020943817
1864 8020952834
1865 8020954657
1866 8021123679
1867 8039104403
1868 8040172327
1869 8040178996
1870 8056693075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

77

250

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3smh-assembly1.cif.gz_C crystal structure of major peanut allergen ara h 1 0.7822 138 241
3s7e-assembly2.cif.gz_B crystal structure of ara h 1 0.7705 138 241
7u1j-assembly1.cif.gz_A crystal structure of pisum sativum convicilin 0.7333 138 244
6v7j-assembly1.cif.gz_B the c2221 crystal form of canavalin at 173 k 0.7291 126 243
6km8-assembly1.cif.gz_A crystal structure of momordica charantia 7s globulin 0.7153 138 241
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9607 81 247 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9281 81 247 2.60.120.590
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7011 137 246 2.60.120.10
af_P93000_22_217_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6994 137 244 2.60.120.10
af_Q54PP0_7_193_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6926 37 241 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A4Q5PTC2-F1-model_v4 Proline hydroxylase 0.9999 29 248
AF-A0A0A7PC52-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9995 44 248 GO:0016491
GO:0046872
AF-A0A536UGM0-F1-model_v4 Proline hydroxylase 0.9994 26 248 GO:0016491
GO:0046872
AF-A0A2V2ANZ7-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9994 29 248
AF-A0A7Z2SR82-F1-model_v4 Proline hydroxylase 0.9986 16 248 GO:0016491
GO:0046872

Map