F486154

General Info

Members Datasets Scaffolds Average Seq Length
935 418 1870 170

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10301358|Ga0105245_103013582
Length 180
Sequence MTPTQTTAVGCGNGSKAPGGPPLKERKAAEIEAIMKCYPMRRSGVMAVLHLVQREQGWISGESMLEVAEICDMTPAEVGEMVTFYTMYHRQPVGKYVFWVCGTLPCALCGSDGLFNYLKEKLGVGLDEVSPDGLFTIKRAECLGACSDAPLMLVNEKMEIKLTRAKVDEIIERCRKESQQ

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
95 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
239 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
249 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
250 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
251 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
252 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
253 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
254 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
255 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
256 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
257 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
262 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
263 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
296 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
343 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
344 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
356 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
357 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
358 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
359 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
360 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
361 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
362 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
363 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
364 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
365 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
366 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
367 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
370 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
371 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
372 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
373 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
378 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
379 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
380 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
381 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
382 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
391 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
392 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
395 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
396 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
399 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
400 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
408 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
411 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
414 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
415 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
416 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
417 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
418 2738541337 Pelomonas sp. BT06 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.75
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.58
Nodule 0.21
Rhizoplane 4.39
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10301358 3300009098 Bacteria 1573
2 JGI25152J39213_1002778 3300002773 Bacteria 6340
3 JGI25150J39212_1003353 3300002774 Bacteria 3764
4 Ga0006759J45824_1162501 3300003163 Bacteria 780
5 JGI25153J46596_10004292 3300003215 Bacteria 7707
6 JGI25153J46596_10004567 3300003215 Bacteria 7427
7 Ga0055526_1004412 3300003771 Bacteria 8463
8 Ga0055524_1000258 3300003775 Bacteria 53898
9 Ga0055540_1000002 3300003792 Bacteria 436954
10 Ga0055531_10000310 3300003794 Bacteria 47933
11 Ga0065165_1001683 3300005262 Bacteria 22344
12 Ga0065165_1002834 3300005262 Bacteria 13518
13 Ga0065707_10090927 3300005295 Bacteria 4037
14 Ga0070658_10128269 3300005327 Bacteria 2112
15 Ga0070658_10195691 3300005327 Bacteria 1704
16 Ga0070658_10311785 3300005327 Bacteria 1342
17 Ga0070676_10022319 3300005328 Bacteria 3548
18 Ga0070676_10032285 3300005328 Bacteria 2999
19 Ga0070676_10078693 3300005328 Bacteria 1995
20 Ga0070676_10205394 3300005328 Bacteria 1293
21 Ga0070676_10445334 3300005328 Bacteria 909
22 Ga0070683_100059203 3300005329 Bacteria 3558
23 Ga0070683_100734937 3300005329 Bacteria 945
24 Ga0070683_101446738 3300005329 Bacteria 660
25 Ga0070690_100062162 3300005330 Bacteria 2407
26 Ga0070690_100197702 3300005330 Bacteria 1397
27 Ga0070690_100589333 3300005330 Bacteria 843
28 Ga0070670_100040957 3300005331 Bacteria 3981
29 Ga0070670_100232746 3300005331 Bacteria 1603
30 Ga0070670_100258512 3300005331 Bacteria 1518
31 Ga0070670_100513497 3300005331 Bacteria 1066
32 Ga0070670_100540004 3300005331 Bacteria 1039
33 Ga0070677_10000889 3300005333 Bacteria 9835
34 Ga0070677_10020130 3300005333 Bacteria 2426
35 Ga0070677_10071765 3300005333 Bacteria 1458
36 Ga0068869_100001619 3300005334 Bacteria 13391
37 Ga0068869_100028259 3300005334 Bacteria 3918
38 Ga0068869_100267404 3300005334 Bacteria 1371
39 Ga0068869_100336979 3300005334 Bacteria 1227
40 Ga0070666_10003167 3300005335 Bacteria 10000
41 Ga0070666_10175887 3300005335 Bacteria 1500
42 Ga0070666_10318867 3300005335 Bacteria 1109
43 Ga0068868_100002256 3300005338 Bacteria 13331
44 Ga0068868_100022436 3300005338 Bacteria 4763
45 Ga0068868_100310847 3300005338 Bacteria 1341
46 Ga0068868_100352570 3300005338 Bacteria 1260
47 Ga0068868_100565641 3300005338 Bacteria 1003
48 Ga0068868_100596848 3300005338 Bacteria 978
49 Ga0070660_100108933 3300005339 Bacteria 2202
50 Ga0070660_100137835 3300005339 Bacteria 1956
51 Ga0070660_100520543 3300005339 Bacteria 990
52 Ga0070689_100123161 3300005340 Bacteria 2073
53 Ga0070689_101061758 3300005340 Bacteria 723
54 Ga0070687_100046687 3300005343 Bacteria 2218
55 Ga0070661_100001720 3300005344 Bacteria 15174
56 Ga0070661_100062266 3300005344 Bacteria 2739
57 Ga0070661_100153871 3300005344 Bacteria 1739
58 Ga0070692_10628905 3300005345 Bacteria 714
59 Ga0070692_10637652 3300005345 Bacteria 710
60 Ga0070692_10880403 3300005345 Bacteria 618
61 Ga0070668_100038073 3300005347 Bacteria 3674
62 Ga0070668_100173960 3300005347 Bacteria 1754
63 Ga0070668_100270769 3300005347 Bacteria 1415
64 Ga0070668_101413636 3300005347 Bacteria 634
65 Ga0070669_100010395 3300005353 Bacteria 6608
66 Ga0070669_100119122 3300005353 Bacteria 2011
67 Ga0070669_100169862 3300005353 Bacteria 1699
68 Ga0070669_100462242 3300005353 Bacteria 1047
69 Ga0070669_100675668 3300005353 Bacteria 870
70 Ga0070669_100963289 3300005353 Bacteria 731
71 Ga0070669_101303080 3300005353 Bacteria 629
72 Ga0070675_100001116 3300005354 Bacteria 19361
73 Ga0070675_100005842 3300005354 Bacteria 9425
74 Ga0070675_100006338 3300005354 Bacteria 9081
75 Ga0070675_100101383 3300005354 Bacteria 2425
76 Ga0070675_100327718 3300005354 Bacteria 1354
77 Ga0070675_100831920 3300005354 Bacteria 844
78 Ga0070671_100043592 3300005355 Bacteria 3728
79 Ga0070671_100058823 3300005355 Bacteria 3198
80 Ga0070671_100086176 3300005355 Bacteria 2627
81 Ga0070671_100150147 3300005355 Bacteria 1967
82 Ga0070671_100163810 3300005355 Bacteria 1880
83 Ga0070671_100402259 3300005355 Bacteria 1171
84 Ga0070671_100597473 3300005355 Bacteria 953
85 Ga0070674_100011236 3300005356 Bacteria 5443
86 Ga0070674_100043625 3300005356 Bacteria 3052
87 Ga0070674_100512928 3300005356 Bacteria 1000
88 Ga0070674_101435740 3300005356 Bacteria 619
89 Ga0070673_100077140 3300005364 Bacteria 2692
90 Ga0070673_100194781 3300005364 Bacteria 1742
91 Ga0070673_100201685 3300005364 Bacteria 1713
92 Ga0070673_100239696 3300005364 Bacteria 1576
93 Ga0070673_100774542 3300005364 Bacteria 885
94 Ga0070673_100863976 3300005364 Bacteria 837
95 Ga0070688_100200240 3300005365 Bacteria 1397
96 Ga0070688_100434073 3300005365 Bacteria 979
97 Ga0070659_100012251 3300005366 Bacteria 6357
98 Ga0070659_100256775 3300005366 Bacteria 1449
99 Ga0070659_100300001 3300005366 Bacteria 1340
100 Ga0070667_100036949 3300005367 Bacteria 4095
101 Ga0070667_100068104 3300005367 Bacteria 3028
102 Ga0070667_100114657 3300005367 Bacteria 2340
103 Ga0070667_100247073 3300005367 Bacteria 1594
104 Ga0070701_10141653 3300005438 Bacteria 1376
105 Ga0070700_100323039 3300005441 Bacteria 1135
106 Ga0070700_101195184 3300005441 Bacteria 635
107 Ga0070708_101005957 3300005445 Bacteria 782
108 Ga0070663_100199898 3300005455 Bacteria 1559
109 Ga0070663_100458604 3300005455 Bacteria 1052
110 Ga0070678_100061342 3300005456 Bacteria 2771
111 Ga0070678_100087270 3300005456 Bacteria 2382
112 Ga0070678_100095294 3300005456 Bacteria 2293
113 Ga0070678_100112832 3300005456 Bacteria 2129
114 Ga0070678_100120555 3300005456 Bacteria 2067
115 Ga0070678_100369234 3300005456 Bacteria 1238
116 Ga0070678_100505912 3300005456 Bacteria 1066
117 Ga0070662_100174879 3300005457 Bacteria 1688
118 Ga0070662_100181241 3300005457 Bacteria 1660
119 Ga0070662_100189479 3300005457 Bacteria 1626
120 Ga0070662_100242966 3300005457 Bacteria 1445
121 Ga0070662_100458861 3300005457 Bacteria 1059
122 Ga0070662_100788198 3300005457 Bacteria 807
123 Ga0068867_100002101 3300005459 Bacteria 13955
124 Ga0068867_100014473 3300005459 Bacteria 5590
125 Ga0068867_100050575 3300005459 Bacteria 3063
126 Ga0068867_100092642 3300005459 Bacteria 2295
127 Ga0068867_100133445 3300005459 Bacteria 1932
128 Ga0068867_100204200 3300005459 Bacteria 1583
129 Ga0068867_100222289 3300005459 Bacteria 1522
130 Ga0068867_100593901 3300005459 Bacteria 965
131 Ga0068867_100598959 3300005459 Bacteria 961
132 Ga0070706_100996449 3300005467 Bacteria 773
133 Ga0070707_101381555 3300005468 Bacteria 671
134 Ga0070679_100024034 3300005530 Bacteria 5969
135 Ga0070684_100208863 3300005535 Bacteria 1779
136 Ga0070684_100280877 3300005535 Bacteria 1525
137 Ga0068853_100011273 3300005539 Bacteria 7255
138 Ga0068853_100151805 3300005539 Bacteria 2085
139 Ga0068853_100694070 3300005539 Bacteria 970
140 Ga0068853_100802067 3300005539 Bacteria 902
141 Ga0068853_101276325 3300005539 Bacteria 710
142 Ga0070672_100000244 3300005543 Bacteria 30475
143 Ga0070672_100019755 3300005543 Bacteria 4898
144 Ga0070672_100150914 3300005543 Bacteria 1922
145 Ga0070672_100187777 3300005543 Bacteria 1724
146 Ga0070672_100214396 3300005543 Bacteria 1613
147 Ga0070672_100541021 3300005543 Bacteria 1010
148 Ga0070686_101276126 3300005544 Bacteria 612
149 Ga0070693_100648313 3300005547 Bacteria 768
150 Ga0070693_100818077 3300005547 Bacteria 692
151 Ga0070665_100008133 3300005548 Bacteria 10616
152 Ga0070665_100982552 3300005548 Bacteria 856
153 Ga0068855_100621985 3300005563 Bacteria 1163
154 Ga0070664_100009115 3300005564 Bacteria 8054
155 Ga0070664_100117970 3300005564 Bacteria 2321
156 Ga0070664_100239528 3300005564 Bacteria 1628
157 Ga0070664_100508964 3300005564 Bacteria 1110
158 Ga0070664_100514284 3300005564 Bacteria 1104
159 Ga0070664_100976897 3300005564 Bacteria 795
160 Ga0068857_100125208 3300005577 Bacteria 2315
161 Ga0068857_100547883 3300005577 Bacteria 1089
162 Ga0068857_100804719 3300005577 Bacteria 898
163 Ga0068854_100126594 3300005578 Bacteria 1946
164 Ga0068854_100226214 3300005578 Bacteria 1482
165 Ga0068854_100392402 3300005578 Bacteria 1146
166 Ga0068854_100480746 3300005578 Bacteria 1043
167 Ga0068854_100885983 3300005578 Bacteria 783
168 Ga0068856_100077915 3300005614 Bacteria 3285
169 Ga0068856_100553326 3300005614 Bacteria 1172
170 Ga0068856_100965724 3300005614 Bacteria 871
171 Ga0068852_100200214 3300005616 Bacteria 1890
172 Ga0068852_100322165 3300005616 Bacteria 1501
173 Ga0068852_101014730 3300005616 Bacteria 848
174 Ga0068859_100024272 3300005617 Bacteria 6083
175 Ga0068859_100233033 3300005617 Bacteria 1930
176 Ga0068859_100322219 3300005617 Bacteria 1639
177 Ga0068864_100015636 3300005618 Bacteria 6313
178 Ga0068864_100093815 3300005618 Bacteria 2651
179 Ga0068864_100104109 3300005618 Bacteria 2520
180 Ga0068864_100148041 3300005618 Bacteria 2124
181 Ga0068864_100298983 3300005618 Bacteria 1506
182 Ga0068864_100341785 3300005618 Bacteria 1410
183 Ga0068864_100632353 3300005618 Bacteria 1041
184 Ga0068864_100902415 3300005618 Bacteria 873
185 Ga0068864_101123779 3300005618 Bacteria 782
186 Ga0068866_10026830 3300005718 Bacteria 2726
187 Ga0068861_100003805 3300005719 Bacteria 10073
188 Ga0068861_100018886 3300005719 Bacteria 4915
189 Ga0068861_100597339 3300005719 Bacteria 1012
190 Ga0068861_100764448 3300005719 Bacteria 904
191 Ga0068851_10009452 3300005834 Bacteria 4534
192 Ga0068851_10030511 3300005834 Bacteria 2673
193 Ga0068851_10112872 3300005834 Bacteria 1452
194 Ga0068863_100013406 3300005841 Bacteria 7903
195 Ga0068863_100076784 3300005841 Bacteria 3160
196 Ga0068863_100082990 3300005841 Bacteria 3036
197 Ga0068863_100148747 3300005841 Bacteria 2240
198 Ga0068863_100185414 3300005841 Bacteria 1998
199 Ga0068863_100201758 3300005841 Bacteria 1913
200 Ga0068863_100254263 3300005841 Bacteria 1697
201 Ga0068863_100500231 3300005841 Bacteria 1197
202 Ga0068863_100623135 3300005841 Bacteria 1069
203 Ga0068863_101500081 3300005841 Bacteria 683
204 Ga0068858_100000560 3300005842 Bacteria 38798
205 Ga0068858_100445393 3300005842 Bacteria 1248
206 Ga0068858_100936736 3300005842 Bacteria 847
207 Ga0068858_101672262 3300005842 Bacteria 628
208 Ga0068860_100002632 3300005843 Bacteria 18674
209 Ga0068860_100059751 3300005843 Bacteria 3623
210 Ga0068860_100142990 3300005843 Bacteria 2300
211 Ga0068860_100223468 3300005843 Bacteria 1829
212 Ga0068860_100503369 3300005843 Bacteria 1209
213 Ga0068860_100555350 3300005843 Bacteria 1151
214 Ga0068862_101399903 3300005844 Bacteria 703
215 Ga0075365_10396561 3300006038 Bacteria 974
216 Ga0075368_10093591 3300006042 Bacteria 1230
217 Ga0075363_100032710 3300006048 Bacteria 2703
218 Ga0075363_100176142 3300006048 Bacteria 1215
219 Ga0075363_100397695 3300006048 Bacteria 809
220 Ga0075364_10023919 3300006051 Bacteria 3872
221 Ga0070715_10573139 3300006163 Bacteria 658
222 Ga0075362_10018795 3300006177 Bacteria 2864
223 Ga0075362_10046032 3300006177 Bacteria 1939
224 Ga0075367_10018059 3300006178 Bacteria 3884
225 Ga0075367_10208504 3300006178 Bacteria 1222
226 Ga0075369_10017625 3300006186 Bacteria 2898
227 Ga0075369_10205109 3300006186 Bacteria 910
228 Ga0075366_10019883 3300006195 Bacteria 3890
229 Ga0075366_10179915 3300006195 Bacteria 1284
230 Ga0075366_10195197 3300006195 Bacteria 1230
231 Ga0075366_10269532 3300006195 Bacteria 1040
232 Ga0075366_10273019 3300006195 Bacteria 1033
233 Ga0075366_10464317 3300006195 Bacteria 781
234 Ga0075366_10523858 3300006195 Bacteria 733
235 Ga0075366_10541554 3300006195 Bacteria 720
236 Ga0075366_10657265 3300006195 Bacteria 650
237 Ga0075366_10672449 3300006195 Bacteria 643
238 Ga0075366_10714192 3300006195 Bacteria 622
239 Ga0097621_100093294 3300006237 Bacteria 2522
240 Ga0097621_100201380 3300006237 Bacteria 1728
241 Ga0097621_100209747 3300006237 Bacteria 1694
242 Ga0097621_100251202 3300006237 Bacteria 1548
243 Ga0075370_10002549 3300006353 Bacteria 8476
244 Ga0075370_10017281 3300006353 Bacteria 3896
245 Ga0075370_10218219 3300006353 Bacteria 1127
246 Ga0075370_10400184 3300006353 Bacteria 824
247 Ga0075370_10541992 3300006353 Bacteria 703
248 Ga0068871_100072898 3300006358 Bacteria 2829
249 Ga0068871_100502932 3300006358 Bacteria 1092
250 Ga0068871_100633144 3300006358 Bacteria 975
251 Ga0068871_100806605 3300006358 Bacteria 865
252 Ga0075429_100017695 3300006880 Bacteria 6163
253 Ga0068865_100026195 3300006881 Bacteria 3843
254 Ga0068865_100242858 3300006881 Bacteria 1418
255 Ga0068865_100324471 3300006881 Bacteria 1240
256 Ga0097620_100024272 3300006931 Bacteria 6083
257 Ga0097620_100233044 3300006931 Bacteria 1930
258 Ga0097620_100322205 3300006931 Bacteria 1639
259 Ga0079104_1000017 3300006946 Bacteria 313784
260 Ga0105240_10023861 3300009093 Bacteria 8079
261 Ga0105240_10551334 3300009093 Bacteria 1275
262 Ga0111539_10814893 3300009094 Bacteria 1086
263 Ga0105245_10213536 3300009098 Bacteria 1858
264 Ga0105245_10553135 3300009098 Bacteria 1173
265 Ga0105245_10724763 3300009098 Bacteria 1029
266 Ga0105247_10210157 3300009101 Bacteria 1312
267 Ga0105243_10165716 3300009148 Bacteria 1909
268 Ga0105243_10193011 3300009148 Bacteria 1780
269 Ga0105243_10575371 3300009148 Bacteria 1080
270 Ga0105243_11219407 3300009148 Bacteria 766
271 Ga0105243_11541577 3300009148 Bacteria 689
272 Ga0105243_12392434 3300009148 Bacteria 566
273 Ga0105241_10379803 3300009174 Bacteria 1234
274 Ga0105241_11001217 3300009174 Bacteria 782
275 Ga0105241_11424631 3300009174 Bacteria 664
276 Ga0105242_10112655 3300009176 Bacteria 2322
277 Ga0105242_10383024 3300009176 Bacteria 1308
278 Ga0105242_11271822 3300009176 Bacteria 758
279 Ga0105248_10000679 3300009177 Bacteria 38513
280 Ga0105248_10104296 3300009177 Bacteria 3196
281 Ga0105248_10215206 3300009177 Bacteria 2164
282 Ga0105248_10440998 3300009177 Bacteria 1467
283 Ga0105248_10952569 3300009177 Bacteria 969
284 Ga0105237_10000548 3300009545 Bacteria 52739
285 Ga0105237_10205148 3300009545 Bacteria 1971
286 Ga0105237_10212429 3300009545 Bacteria 1934
287 Ga0105237_11882952 3300009545 Bacteria 606
288 Ga0105238_10002440 3300009551 Bacteria 18658
289 Ga0105238_10203940 3300009551 Bacteria 1953
290 Ga0105238_10590832 3300009551 Bacteria 1117
291 Ga0105249_10082168 3300009553 Bacteria 2997
292 Ga0105249_10123056 3300009553 Bacteria 2468
293 Ga0105249_10419696 3300009553 Bacteria 1371
294 Ga0105239_10001569 3300010375 Bacteria 30171
295 Ga0105239_10207920 3300010375 Bacteria 2193
296 Ga0105246_10203731 3300011119 Bacteria 1540
297 Ga0105246_10480590 3300011119 Bacteria 1051
298 Ga0157317_1010853 3300012475 Bacteria 702
299 Ga0157325_1013941 3300012485 Bacteria 639
300 Ga0157314_1004058 3300012500 Bacteria 1063
301 Ga0157327_1012605 3300012512 Bacteria 836
302 Ga0157373_10179324 3300013100 Bacteria 1491
303 Ga0157371_10248832 3300013102 Bacteria 1279
304 Ga0157369_10413052 3300013105 Bacteria 1399
305 Ga0157374_10187745 3300013296 Bacteria 2021
306 Ga0157374_10188942 3300013296 Bacteria 2015
307 Ga0157374_10328547 3300013296 Bacteria 1516
308 Ga0157374_10347703 3300013296 Bacteria 1473
309 Ga0157374_10561553 3300013296 Bacteria 1150
310 Ga0157374_10912581 3300013296 Bacteria 896
311 Ga0157378_10015886 3300013297 Bacteria 6592
312 Ga0157378_10293204 3300013297 Bacteria 1572
313 Ga0163162_10031729 3300013306 Bacteria 5242
314 Ga0163162_10084966 3300013306 Bacteria 3241
315 Ga0163162_10143147 3300013306 Bacteria 2505
316 Ga0163162_10180091 3300013306 Bacteria 2239
317 Ga0163162_10240544 3300013306 Bacteria 1941
318 Ga0163162_10270788 3300013306 Bacteria 1830
319 Ga0163162_11672085 3300013306 Bacteria 727
320 Ga0157372_10241788 3300013307 Bacteria 2095
321 Ga0157372_10312214 3300013307 Bacteria 1830
322 Ga0157375_10363747 3300013308 Bacteria 1613
323 Ga0157375_10452069 3300013308 Bacteria 1450
324 Ga0157375_10457926 3300013308 Bacteria 1441
325 Ga0157375_10531556 3300013308 Bacteria 1339
326 Ga0157375_10570710 3300013308 Bacteria 1292
327 Ga0157375_10600266 3300013308 Bacteria 1260
328 Ga0157375_10986810 3300013308 Bacteria 982
329 Ga0157375_12023634 3300013308 Bacteria 685
330 Ga0163163_10378171 3300014325 Bacteria 1474
331 Ga0163163_10634539 3300014325 Bacteria 1132
332 Ga0163163_12285584 3300014325 Bacteria 600
333 Ga0157380_10046803 3300014326 Bacteria 3399
334 Ga0157380_10566735 3300014326 Bacteria 1117
335 Ga0157380_11358722 3300014326 Bacteria 760
336 Ga0157377_10000028 3300014745 Bacteria 134810
337 Ga0157377_10121179 3300014745 Bacteria 1585
338 Ga0157377_10328756 3300014745 Bacteria 1018
339 Ga0157377_10733992 3300014745 Bacteria 721
340 Ga0157379_10092313 3300014968 Bacteria 2716
341 Ga0157379_10099041 3300014968 Bacteria 2617
342 Ga0157379_10297504 3300014968 Bacteria 1471
343 Ga0157379_10591146 3300014968 Bacteria 1035
344 Ga0157379_10843928 3300014968 Bacteria 867
345 Ga0157376_10191548 3300014969 Bacteria 1875
346 Ga0157376_10202583 3300014969 Bacteria 1827
347 Ga0157376_10214959 3300014969 Bacteria 1777
348 Ga0157376_10348211 3300014969 Bacteria 1417
349 Ga0157376_11979580 3300014969 Bacteria 620
350 Ga0182005_1065056 3300015265 Bacteria 998
351 Ga0163161_10049799 3300017792 Bacteria 3029
352 Ga0163161_10197542 3300017792 Bacteria 1549
353 Ga0163161_10218131 3300017792 Bacteria 1476
354 Ga0213872_10000272 3300021361 Bacteria 44319
355 Ga0213874_10066914 3300021377 Bacteria 1138
356 Ga0207425_1000175 3300025245 Bacteria 52768
357 Ga0209129_1000369 3300025258 Bacteria 36698
358 Ga0209129_1020485 3300025258 Bacteria 1230
359 Ga0209565_1008817 3300025263 Bacteria 2610
360 Ga0209673_1013442 3300025273 Bacteria 3229
361 Ga0209673_1020769 3300025273 Bacteria 2316
362 Ga0209675_1034267 3300025291 Bacteria 1169
363 Ga0209564_1000046 3300025295 Bacteria 373787
364 Ga0209758_1000369 3300025297 Bacteria 79541
365 Ga0209758_1000709 3300025297 Bacteria 49238
366 Ga0209050_1001458 3300025298 Bacteria 25343
367 Ga0209050_1002755 3300025298 Bacteria 14143
368 Ga0209256_1000011 3300025299 Bacteria 865309
369 Ga0209256_1061640 3300025299 Bacteria 871
370 Ga0209051_1000024 3300025303 Bacteria 437007
371 Ga0209051_1064691 3300025303 Bacteria 1132
372 Ga0209257_1000032 3300025304 Bacteria 680354
373 Ga0209257_1001131 3300025304 Bacteria 34256
374 Ga0209257_1036354 3300025304 Bacteria 1514
375 Ga0207697_10065232 3300025315 Bacteria 1519
376 Ga0207697_10083469 3300025315 Bacteria 1348
377 Ga0207682_10023212 3300025893 Bacteria 2449
378 Ga0207682_10031176 3300025893 Bacteria 2139
379 Ga0207682_10089675 3300025893 Bacteria 1331
380 Ga0207682_10261204 3300025893 Bacteria 807
381 Ga0207642_10015721 3300025899 Bacteria 2830
382 Ga0207710_10522813 3300025900 Bacteria 617
383 Ga0207688_10124569 3300025901 Bacteria 1506
384 Ga0207688_10129378 3300025901 Bacteria 1479
385 Ga0207680_10030133 3300025903 Bacteria 3057
386 Ga0207680_10070936 3300025903 Bacteria 2158
387 Ga0207680_10397817 3300025903 Bacteria 973
388 Ga0207680_10640532 3300025903 Bacteria 761
389 Ga0207645_10113834 3300025907 Bacteria 1753
390 Ga0207645_10114701 3300025907 Bacteria 1746
391 Ga0207645_10120719 3300025907 Bacteria 1701
392 Ga0207645_10342310 3300025907 Bacteria 1000
393 Ga0207643_10053505 3300025908 Bacteria 2293
394 Ga0207684_10664280 3300025910 Bacteria 887
395 Ga0207654_10281957 3300025911 Bacteria 1124
396 Ga0207695_10006897 3300025913 Bacteria 14612
397 Ga0207695_10762062 3300025913 Bacteria 848
398 Ga0207671_10112614 3300025914 Bacteria 2072
399 Ga0207671_10152404 3300025914 Bacteria 1786
400 Ga0207662_10026112 3300025918 Bacteria 3368
401 Ga0207657_10071817 3300025919 Bacteria 2930
402 Ga0207657_10439388 3300025919 Bacteria 1024
403 Ga0207649_10004884 3300025920 Bacteria 7251
404 Ga0207649_10279507 3300025920 Bacteria 1213
405 Ga0207652_10015790 3300025921 Bacteria 6152
406 Ga0207681_10025698 3300025923 Bacteria 3790
407 Ga0207681_10393127 3300025923 Bacteria 1118
408 Ga0207681_10625466 3300025923 Bacteria 891
409 Ga0207694_11241528 3300025924 Bacteria 630
410 Ga0207650_10001071 3300025925 Bacteria 20336
411 Ga0207650_10371194 3300025925 Bacteria 1180
412 Ga0207659_10005352 3300025926 Bacteria 7776
413 Ga0207659_10009622 3300025926 Bacteria 6045
414 Ga0207659_10010862 3300025926 Bacteria 5734
415 Ga0207659_10217604 3300025926 Bacteria 1534
416 Ga0207659_10242146 3300025926 Bacteria 1460
417 Ga0207687_10126159 3300025927 Bacteria 1922
418 Ga0207687_10773800 3300025927 Bacteria 818
419 Ga0207644_10005144 3300025931 Bacteria 8547
420 Ga0207644_10017413 3300025931 Bacteria 4850
421 Ga0207644_10046792 3300025931 Bacteria 3083
422 Ga0207644_10068487 3300025931 Bacteria 2589
423 Ga0207644_10154523 3300025931 Bacteria 1778
424 Ga0207644_10703977 3300025931 Bacteria 842
425 Ga0207644_10796382 3300025931 Bacteria 790
426 Ga0207690_10041779 3300025932 Bacteria 3007
427 Ga0207690_10500428 3300025932 Bacteria 983
428 Ga0207690_10780731 3300025932 Bacteria 789
429 Ga0207706_10050990 3300025933 Bacteria 3656
430 Ga0207706_10247604 3300025933 Bacteria 1557
431 Ga0207706_10386379 3300025933 Bacteria 1214
432 Ga0207686_10171832 3300025934 Bacteria 1529
433 Ga0207686_10287350 3300025934 Bacteria 1216
434 Ga0207709_10090802 3300025935 Bacteria 1996
435 Ga0207709_10100997 3300025935 Bacteria 1907
436 Ga0207709_10104333 3300025935 Bacteria 1881
437 Ga0207709_10173664 3300025935 Bacteria 1515
438 Ga0207670_10072769 3300025936 Bacteria 2381
439 Ga0207670_10167041 3300025936 Bacteria 1647
440 Ga0207669_10031978 3300025937 Bacteria 2948
441 Ga0207669_10061104 3300025937 Bacteria 2313
442 Ga0207669_10189516 3300025937 Bacteria 1482
443 Ga0207669_10244419 3300025937 Bacteria 1332
444 Ga0207704_10014262 3300025938 Bacteria 4008
445 Ga0207704_10036194 3300025938 Bacteria 2838
446 Ga0207691_10010002 3300025940 Bacteria 9107
447 Ga0207691_10032268 3300025940 Bacteria 4884
448 Ga0207691_10246574 3300025940 Bacteria 1543
449 Ga0207691_10253581 3300025940 Bacteria 1518
450 Ga0207711_10027473 3300025941 Bacteria 4779
451 Ga0207711_10084791 3300025941 Bacteria 2774
452 Ga0207711_10162102 3300025941 Bacteria 2025
453 Ga0207711_10346164 3300025941 Bacteria 1376
454 Ga0207689_10000534 3300025942 Bacteria 36072
455 Ga0207689_10083775 3300025942 Bacteria 2621
456 Ga0207689_10299797 3300025942 Bacteria 1332
457 Ga0207689_10370353 3300025942 Bacteria 1192
458 Ga0207661_10444263 3300025944 Bacteria 1180
459 Ga0207679_10000448 3300025945 Bacteria 29103
460 Ga0207679_10457130 3300025945 Bacteria 1133
461 Ga0207679_11272405 3300025945 Bacteria 675
462 Ga0207679_11606128 3300025945 Bacteria 596
463 Ga0207667_10122369 3300025949 Bacteria 2681
464 Ga0207651_10003222 3300025960 Bacteria 7983
465 Ga0207651_10059933 3300025960 Bacteria 2639
466 Ga0207651_10062440 3300025960 Bacteria 2596
467 Ga0207651_10337841 3300025960 Bacteria 1264
468 Ga0207712_10097667 3300025961 Bacteria 2177
469 Ga0207712_10239438 3300025961 Bacteria 1461
470 Ga0207712_10329465 3300025961 Bacteria 1262
471 Ga0207712_10530694 3300025961 Bacteria 1010
472 Ga0207668_10014791 3300025972 Bacteria 4836
473 Ga0207640_10146799 3300025981 Bacteria 1727
474 Ga0207640_10282985 3300025981 Bacteria 1303
475 Ga0207640_10844654 3300025981 Bacteria 796
476 Ga0207658_10007924 3300025986 Bacteria 7234
477 Ga0207658_10009896 3300025986 Bacteria 6479
478 Ga0207658_10017278 3300025986 Bacteria 4970
479 Ga0207658_10027882 3300025986 Bacteria 3972
480 Ga0207658_10423460 3300025986 Bacteria 1174
481 Ga0207658_10446912 3300025986 Bacteria 1144
482 Ga0207658_11352921 3300025986 Bacteria 651
483 Ga0207677_10012100 3300026023 Bacteria 4946
484 Ga0207677_10327620 3300026023 Bacteria 1275
485 Ga0207677_10595225 3300026023 Bacteria 970
486 Ga0207703_10008539 3300026035 Bacteria 8090
487 Ga0207703_10009811 3300026035 Bacteria 7510
488 Ga0207703_10048570 3300026035 Bacteria 3426
489 Ga0207703_11380089 3300026035 Bacteria 678
490 Ga0207639_10231352 3300026041 Bacteria 1602
491 Ga0207639_10623791 3300026041 Bacteria 996
492 Ga0207639_10629695 3300026041 Bacteria 991
493 Ga0207639_10735103 3300026041 Bacteria 917
494 Ga0207678_10002683 3300026067 Bacteria 16152
495 Ga0207678_10085112 3300026067 Bacteria 2703
496 Ga0207678_10188619 3300026067 Bacteria 1762
497 Ga0207678_10352068 3300026067 Bacteria 1270
498 Ga0207678_10415926 3300026067 Bacteria 1165
499 Ga0207708_10138120 3300026075 Bacteria 1910
500 Ga0207708_11124279 3300026075 Bacteria 685
501 Ga0207702_10070651 3300026078 Bacteria 3003
502 Ga0207702_10206812 3300026078 Bacteria 1823
503 Ga0207702_10312958 3300026078 Bacteria 1493
504 Ga0207641_10010893 3300026088 Bacteria 7450
505 Ga0207641_10032107 3300026088 Bacteria 4359
506 Ga0207641_10072444 3300026088 Bacteria 2967
507 Ga0207641_10193163 3300026088 Bacteria 1872
508 Ga0207641_10215012 3300026088 Bacteria 1779
509 Ga0207641_10338665 3300026088 Bacteria 1431
510 Ga0207641_10348957 3300026088 Bacteria 1410
511 Ga0207641_10437943 3300026088 Bacteria 1261
512 Ga0207641_10876990 3300026088 Bacteria 890
513 Ga0207648_10000146 3300026089 Bacteria 70573
514 Ga0207648_10180628 3300026089 Bacteria 1868
515 Ga0207648_10405381 3300026089 Bacteria 1236
516 Ga0207648_10415584 3300026089 Bacteria 1221
517 Ga0207648_10502418 3300026089 Bacteria 1110
518 Ga0207648_10574954 3300026089 Bacteria 1037
519 Ga0207648_10658168 3300026089 Bacteria 968
520 Ga0207676_10001000 3300026095 Bacteria 21763
521 Ga0207676_10013494 3300026095 Bacteria 5869
522 Ga0207676_10125282 3300026095 Bacteria 2174
523 Ga0207676_10128132 3300026095 Bacteria 2153
524 Ga0207676_10221449 3300026095 Bacteria 1685
525 Ga0207676_10282704 3300026095 Bacteria 1507
526 Ga0207676_10489285 3300026095 Bacteria 1166
527 Ga0207674_10070720 3300026116 Bacteria 3508
528 Ga0207674_10542940 3300026116 Bacteria 1123
529 Ga0207675_100004784 3300026118 Bacteria 13041
530 Ga0207675_100010268 3300026118 Bacteria 8775
531 Ga0207675_100080286 3300026118 Bacteria 3058
532 Ga0207675_100189997 3300026118 Bacteria 1970
533 Ga0207683_10104581 3300026121 Bacteria 2530
534 Ga0207683_10189853 3300026121 Bacteria 1865
535 Ga0207683_10194820 3300026121 Bacteria 1841
536 Ga0207683_10222442 3300026121 Bacteria 1720
537 Ga0207683_10276405 3300026121 Bacteria 1535
538 Ga0207683_10472223 3300026121 Bacteria 1157
539 Ga0207683_10497205 3300026121 Bacteria 1126
540 Ga0207683_10678436 3300026121 Bacteria 955
541 Ga0207698_10054473 3300026142 Bacteria 3078
542 Ga0207698_10069209 3300026142 Bacteria 2790
543 Ga0207698_10196779 3300026142 Bacteria 1801
544 Ga0207698_10213285 3300026142 Bacteria 1739
545 Ga0207698_10586767 3300026142 Bacteria 1097
546 Ga0207698_10815313 3300026142 Bacteria 936
547 Ga0207698_10975844 3300026142 Bacteria 857
548 Ga0207698_11068334 3300026142 Bacteria 819
549 Ga0209281_1000042 3300027111 Bacteria 344748
550 Ga0209813_10001279 3300027866 Bacteria 5620
551 Ga0209813_10063817 3300027866 Bacteria 1182
552 Ga0268266_10024018 3300028379 Bacteria 5187
553 Ga0268266_10225307 3300028379 Bacteria 1725
554 Ga0268265_10018225 3300028380 Bacteria 4862
555 Ga0268265_10499010 3300028380 Bacteria 1146
556 Ga0268265_11776673 3300028380 Bacteria 623
557 Ga0268264_10048840 3300028381 Bacteria 3520
558 Ga0268264_10064893 3300028381 Bacteria 3074
559 Ga0268264_10124323 3300028381 Bacteria 2278
560 Ga0268264_11002586 3300028381 Bacteria 842
561 Ga0307517_10000964 3300028786 Bacteria 48825
562 Ga0307517_10171950 3300028786 Bacteria 1422
563 Ga0307517_10326751 3300028786 Bacteria 845
564 Ga0307517_10443576 3300028786 Bacteria 674
565 Ga0307515_10001342 3300028794 Bacteria 55698
566 Ga0307515_10006289 3300028794 Bacteria 23807
567 Ga0307515_10011462 3300028794 Bacteria 16827
568 Ga0307515_10012893 3300028794 Bacteria 15679
569 Ga0307515_10111378 3300028794 Bacteria 3194
570 Ga0307515_10231500 3300028794 Bacteria 1639
571 Ga0307515_10247342 3300028794 Bacteria 1542
572 Ga0307515_10401135 3300028794 Bacteria 997
573 Ga0307512_10055753 3300030522 Bacteria 3112
574 Ga0307512_10130854 3300030522 Bacteria 1574
575 Ga0265327_10000235 3300031251 Bacteria 111362
576 Ga0307513_10095382 3300031456 Bacteria 3016
577 Ga0307513_10163563 3300031456 Bacteria 2113
578 Ga0307513_10183548 3300031456 Bacteria 1952
579 Ga0307513_10436038 3300031456 Bacteria 1037
580 Ga0307509_10005272 3300031507 Bacteria 18096
581 Ga0307509_10111411 3300031507 Bacteria 2739
582 Ga0307509_10112829 3300031507 Bacteria 2717
583 Ga0307509_10174984 3300031507 Bacteria 2020
584 Ga0307509_10249237 3300031507 Bacteria 1561
585 Ga0307509_10361944 3300031507 Bacteria 1170
586 Ga0307408_100000150 3300031548 Bacteria 77682
587 Ga0307408_100479530 3300031548 Bacteria 1085
588 Ga0307408_100788620 3300031548 Bacteria 861
589 Ga0307508_10000004 3300031616 Bacteria 287547
590 Ga0307508_10005233 3300031616 Bacteria 12395
591 Ga0307514_10039660 3300031649 Bacteria 3718
592 Ga0307514_10055656 3300031649 Bacteria 3039
593 Ga0307516_10004922 3300031730 Bacteria 16245
594 Ga0307516_10213071 3300031730 Bacteria 1645
595 Ga0307516_10352612 3300031730 Bacteria 1137
596 Ga0307516_10396019 3300031730 Bacteria 1041
597 Ga0307516_10424210 3300031730 Bacteria 988
598 Ga0307405_10088968 3300031731 Bacteria 2039
599 Ga0307405_10104429 3300031731 Bacteria 1907
600 Ga0307405_10156842 3300031731 Bacteria 1607
601 Ga0307413_10400222 3300031824 Bacteria 1075
602 Ga0307410_10036099 3300031852 Bacteria 3215
603 Ga0307406_10224467 3300031901 Bacteria 1398
604 Ga0307407_10088901 3300031903 Bacteria 1888
605 Ga0307412_10042878 3300031911 Bacteria 2943
606 Ga0307412_10516181 3300031911 Bacteria 997
607 Ga0307412_10540539 3300031911 Bacteria 977
608 Ga0307412_10683394 3300031911 Bacteria 879
609 Ga0307409_100007456 3300031995 Bacteria 6546
610 Ga0307409_100277245 3300031995 Bacteria 1547
611 Ga0307409_100419518 3300031995 Bacteria 1283
612 Ga0307416_100001653 3300032002 Bacteria 12301
613 Ga0307416_100245850 3300032002 Bacteria 1737
614 Ga0307416_100828774 3300032002 Bacteria 1022
615 Ga0307414_10062390 3300032004 Bacteria 2645
616 Ga0307414_10211838 3300032004 Bacteria 1584
617 Ga0307414_10617794 3300032004 Bacteria 974
618 Ga0307414_10867468 3300032004 Bacteria 826
619 Ga0307414_11014622 3300032004 Bacteria 764
620 Ga0307411_10018300 3300032005 Bacteria 4015
621 Ga0307411_10022995 3300032005 Bacteria 3682
622 Ga0307411_10233236 3300032005 Bacteria 1436
623 Ga0307415_100002497 3300032126 Bacteria 9187
624 Ga0307415_100087979 3300032126 Bacteria 2240
625 Ga0307507_10025171 3300033179 Bacteria 6462
626 Ga0307510_10063259 3300033180 Bacteria 3770
627 Ga0307510_10119653 3300033180 Bacteria 2343
628 Ga0307510_10143713 3300033180 Bacteria 2023
629 Ga0307510_10265109 3300033180 Bacteria 1197
630 Ga0307510_10284347 3300033180 Bacteria 1123
631 Ga0373948_0019519 3300034817 Bacteria 1283
632 Ga0373959_0018329 3300034820 Bacteria 1316
633 Ga0373959_0028246 3300034820 Bacteria 1119
634 Ga0373926_0173366 3300035083 Bacteria 826
635 Ga0373928_0006006 3300035084 Bacteria 2328
636 Ga0373940_0090358 3300035088 Bacteria 916
637 Ga0373944_0011058 3300035089 Bacteria 2469
638 Ga0373944_0086606 3300035089 Bacteria 1042
639 Ga0373944_0172941 3300035089 Bacteria 771
640 Ga0373951_0088149 3300035091 Bacteria 811
641 Ga0373952_0021267 3300035092 Bacteria 1368
642 Ga0373952_0092819 3300035092 Bacteria 786
643 Ga0373923_0264758 3300035111 Bacteria 807
644 Ga0373939_0000712 3300035114 Bacteria 8237
645 Ga0373939_0108930 3300035114 Bacteria 962
646 Ga0373939_0326895 3300035114 Bacteria 618
647 Ga0373945_0075448 3300035116 Bacteria 1284
648 Ga0373953_0053355 3300035117 Bacteria 1639
649 Ga0373960_0000489 3300035121 Bacteria 7867
650 Ga0373943_0128915 3300035170 Bacteria 1352
651 Ga0373946_0072576 3300035171 Bacteria 1490
652 Ga0373955_0114491 3300035172 Bacteria 1562
653 Ga0373955_0720773 3300035172 Bacteria 612
654 Ga0373942_0090771 3300035207 Bacteria 920
655 Ga0373962_0008572 3300035242 Bacteria 2517
656 Ga0373924_0042699 3300035410 Bacteria 1861
657 Ga0373924_0109650 3300035410 Bacteria 1192
658 Ga0373931_0000200 3300035691 Bacteria 25528
659 Ga0373931_0217854 3300035691 Bacteria 1148
660 Ga0373927_0639313 3300035695 Bacteria 703
661 Ga0373933_0254543 3300035724 Bacteria 1131
662 Ga0373947_0081144 3300035725 Bacteria 2008
663 Ga0373947_0546354 3300035725 Bacteria 788
664 Ga0373937_0163889 3300036401 Bacteria 2084
665 Ga0373937_0460190 3300036401 Bacteria 1208
666 Ga0373925_0176091 3300037068 Bacteria 1691
667 Ga0373925_0399978 3300037068 Bacteria 1120
668 Ga0395898_0001070 3300037466 Bacteria 42389
669 Ga0395905_0002212 3300037471 Bacteria 21946
670 Ga0395905_0009343 3300037471 Bacteria 9587
671 Ga0395905_0587701 3300037471 Bacteria 1015
672 Ga0436361_0214541 3300039447 Bacteria 41289
673 Ga0436363_0840428 3300039450 Bacteria 927
674 Ga0439461_0007827 3300041410 Bacteria 1904
675 Ga0451793_0241110 3300041452 Bacteria 907
676 Ga0451793_1521968 3300041452 Bacteria 2036
677 Ga0451795_0279382 3300041456 Bacteria 975
678 Ga0451798_0538262 3300041458 Bacteria 1162
679 Ga0451800_0693871 3300041459 Bacteria 836
680 Ga0451800_0937711 3300041459 Bacteria 709
681 Ga0451800_0994505 3300041459 Bacteria 2472
682 Ga0451802_0094819 3300041460 Bacteria 611
683 Ga0451802_0200560 3300041460 Bacteria 841
684 Ga0451802_2084031 3300041460 Bacteria 964
685 Ga0451807_1211661 3300041486 Bacteria 675
686 Ga0451807_1697411 3300041486 Bacteria 961
687 Ga0451849_1501812 3300041505 Bacteria 1197
688 Ga0451851_0215488 3300041507 Bacteria 802
689 Ga0451853_1703130 3300041512 Bacteria 534
690 Ga0451853_2872717 3300041512 Bacteria 1182
691 Ga0439437_006931 3300042000 Bacteria 1260
692 Ga0439445_0088021 3300042004 Bacteria 873
693 Ga0450913_010757 3300042117 Bacteria 737
694 Ga0450917_001882 3300042120 Bacteria 1491
695 Ga0450917_022120 3300042120 Bacteria 573
696 Ga0450919_000761 3300042121 Bacteria 4104
697 Ga0450888_008076 3300042126 Bacteria 1179
698 Ga0450888_010253 3300042126 Bacteria 1083
699 Ga0450891_002889 3300042129 Bacteria 1696
700 Ga0450892_001021 3300042130 Bacteria 2962
701 Ga0450898_023639 3300042134 Bacteria 1094
702 Ga0450899_020271 3300042135 Bacteria 775
703 Ga0450889_001684 3300042144 Bacteria 2248
704 Ga0450910_052933 3300042147 Bacteria 674
705 Ga0439446_0040999 3300042156 Bacteria 1364
706 Ga0439434_0134992 3300042435 Bacteria 811
707 Ga0439464_0008192 3300042439 Bacteria 2740
708 Ga0439464_0041972 3300042439 Bacteria 1306
709 Ga0450916_028255 3300042530 Bacteria 805
710 Ga0450918_000001 3300042531 Bacteria 65425
711 Ga0450893_0002619 3300042532 Bacteria 2813
712 Ga0466969_0030298 3300044656 Bacteria 2757
713 Ga0466966_0064736 3300044684 Bacteria 2300
714 Ga0466961_0224018 3300044693 Bacteria 1158
715 Ga0466963_0007961 3300044694 Bacteria 6344
716 Ga0466964_0031131 3300044706 Bacteria 2114
717 Ga0453684_0889375 3300044712 Bacteria 954
718 Ga0466971_0016403 3300044719 Bacteria 3268
719 Ga0466968_0310907 3300044735 Bacteria 759
720 Ga0466957_0099578 3300044842 Bacteria 1830
721 Ga0466957_0208414 3300044842 Bacteria 1286
722 Ga0466959_0001653 3300045049 Bacteria 13795
723 Ga0451576_0132417 3300045051 Bacteria 2599
724 Ga0451576_0312200 3300045051 Bacteria 1645
725 Ga0466958_0030970 3300045836 Bacteria 3179
726 Ga0495592_0006237 3300046454 Bacteria 8868
727 Ga0495603_0276929 3300046455 Bacteria 965
728 Ga0495629_0635263 3300046459 Bacteria 712
729 Ga0495650_0019828 3300046471 Bacteria 3296
730 Ga0495580_0308634 3300046472 Bacteria 1076
731 Ga0495582_0250520 3300046473 Bacteria 1016
732 Ga0495606_0141738 3300046507 Bacteria 1419
733 Ga0495608_0553518 3300046511 Bacteria 693
734 Ga0495610_0125844 3300046512 Bacteria 1118
735 Ga0495610_0275033 3300046512 Bacteria 658
736 Ga0495628_0222980 3300046516 Bacteria 1415
737 Ga0495630_0690316 3300046517 Bacteria 781
738 Ga0495632_0077063 3300046519 Bacteria 1594
739 Ga0495632_0079573 3300046519 Bacteria 1564
740 Ga0495632_0120826 3300046519 Bacteria 1224
741 Ga0495643_0325999 3300046522 Bacteria 693
742 Ga0495666_0099846 3300046526 Bacteria 1368
743 Ga0495642_0080749 3300046528 Bacteria 1369
744 Ga0495642_0154458 3300046528 Bacteria 994
745 Ga0495654_0232546 3300046530 Bacteria 775
746 Ga0495640_0154051 3300046533 Bacteria 1476
747 Ga0495586_0099766 3300046535 Bacteria 1611
748 Ga0495587_0216877 3300046536 Bacteria 1080
749 Ga0495598_0013601 3300046537 Bacteria 2021
750 Ga0495621_0043118 3300046539 Bacteria 1591
751 Ga0495597_0078206 3300046542 Bacteria 1417
752 Ga0495645_0168671 3300046543 Bacteria 1508
753 Ga0495645_0180227 3300046543 Bacteria 1448
754 Ga0495622_0019347 3300046557 Bacteria 3170
755 Ga0495668_0336188 3300046616 Bacteria 829
756 Ga0495634_0229414 3300046642 Bacteria 1143
757 Ga0495611_0073439 3300046648 Bacteria 1566
758 Ga0495625_0008638 3300046660 Bacteria 8663
759 Ga0495635_0221927 3300046663 Bacteria 1278
760 Ga0495646_0125053 3300046680 Bacteria 1452
761 Ga0495647_0255060 3300046681 Bacteria 781
762 Ga0495658_0209665 3300046683 Bacteria 1217
763 Ga0495658_0236107 3300046683 Bacteria 1147
764 Ga0495658_0282552 3300046683 Bacteria 1047
765 Ga0495658_0316589 3300046683 Bacteria 988
766 Ga0495624_0122869 3300046690 Bacteria 1594
767 Ga0495670_0173174 3300046691 Bacteria 1137
768 Ga0495670_0255477 3300046691 Bacteria 935
769 Ga0495649_0002642 3300046694 Bacteria 12482
770 Ga0495660_0111528 3300046810 Bacteria 1395
771 Ga0495674_0471027 3300047319 Bacteria 1007
772 Ga0495676_0303751 3300047321 Bacteria 1076
773 Ga0495676_0458680 3300047321 Bacteria 840
774 Ga0495683_0210537 3300047323 Bacteria 872
775 Ga0495687_025118 3300047443 Bacteria 2822
776 Ga0495677_0251842 3300047445 Bacteria 691
777 Ga0495673_0136258 3300047469 Bacteria 961
778 Ga0495684_0088066 3300047471 Bacteria 2353
779 Ga0495686_0008187 3300047472 Bacteria 7715
780 Ga0495686_0311941 3300047472 Bacteria 865
781 Ga0495686_0331184 3300047472 Bacteria 832
782 Ga0495593_0038761 3300047673 Bacteria 2573
783 Ga0495626_0035491 3300048091 Bacteria 2380
784 Ga0495626_0129612 3300048091 Bacteria 1078
785 Ga0496100_0047651 3300048903 Bacteria 2763
786 Ga0496100_0525094 3300048903 Bacteria 914
787 Ga0496100_1027540 3300048903 Bacteria 649
788 Ga0496101_0164452 3300048904 Bacteria 1703
789 Ga0496102_0120399 3300048905 Bacteria 2451
790 Ga0496102_0290176 3300048905 Bacteria 1542
791 Ga0496104_0287567 3300048907 Bacteria 1556
792 Ga0496104_0490024 3300048907 Bacteria 1140
793 Ga0496104_0870950 3300048907 Bacteria 806
794 Ga0496106_0052636 3300048909 Bacteria 3072
795 Ga0496107_0010834 3300048910 Bacteria 6344
796 Ga0496107_0386649 3300048910 Bacteria 1041
797 Ga0496108_0124482 3300048911 Bacteria 2213
798 Ga0496108_0213521 3300048911 Bacteria 1675
799 Ga0496108_0343420 3300048911 Bacteria 1302
800 Ga0496108_0581377 3300048911 Bacteria 976
801 Ga0496109_0077698 3300048912 Bacteria 3055
802 Ga0496109_0239810 3300048912 Bacteria 1706
803 Ga0496109_0452798 3300048912 Bacteria 1212
804 Ga0496110_0133370 3300048913 Bacteria 2243
805 Ga0496110_0238652 3300048913 Bacteria 1654
806 Ga0496110_0595509 3300048913 Bacteria 1003
807 Ga0496110_1377220 3300048913 Bacteria 615
808 Ga0496111_0268195 3300048914 Bacteria 1266
809 Ga0496112_0032377 3300048915 Bacteria 5076
810 Ga0496112_0199727 3300048915 Bacteria 1959
811 Ga0496113_0086979 3300048916 Bacteria 2402
812 Ga0496114_0169441 3300048917 Bacteria 1902
813 Ga0496115_0101325 3300048918 Bacteria 2361
814 Ga0496121_0240920 3300048924 Bacteria 1260
815 Ga0496124_0001201 3300048927 Bacteria 40242
816 Ga0496125_0089687 3300048928 Bacteria 2312
817 Ga0501310_009437 3300049130 Bacteria 1076
818 Ga0501305_009816 3300049161 Bacteria 1266
819 Ga0501307_014046 3300049162 Bacteria 974
820 Ga0501292_007725 3300049515 Bacteria 1559
821 Ga0501297_012007 3300049520 Bacteria 1002
822 Ga0501314_000114 3300049530 Bacteria 3744
823 Ga0501320_000236 3300049536 Bacteria 2881
824 Ga0501323_003960 3300049539 Bacteria 1541
825 Ga0501032_0168653 3300049569 Bacteria 1436
826 Ga0501034_0815988 3300049571 Bacteria 825
827 Ga0501043_0000023 3300049579 Bacteria 154331
828 Ga0501046_0000018 3300049580 Bacteria 220589
829 Ga0501047_0000020 3300049581 Bacteria 259377
830 Ga0501048_0002498 3300049582 Bacteria 14043
831 Ga0501067_0380820 3300049583 Bacteria 787
832 Ga0501068_0455520 3300049584 Bacteria 828
833 Ga0501198_000011 3300049649 Bacteria 115612
834 Ga0501206_020207 3300049653 Bacteria 946
835 Ga0501211_000654 3300049658 Bacteria 3487
836 Ga0501222_002058 3300049662 Bacteria 2783
837 Ga0501227_004413 3300049665 Bacteria 3027
838 Ga0501236_011757 3300049670 Bacteria 1168
839 Ga0501253_014967 3300049683 Bacteria 1266
840 Ga0501255_027400 3300049684 Bacteria 775
841 Ga0501256_023838 3300049685 Bacteria 657
842 Ga0501258_003277 3300049687 Bacteria 1476
843 Ga0501221_020662 3300049704 Bacteria 1289
844 Ga0501229_000229 3300049706 Bacteria 6247
845 Ga0501245_041219 3300049708 Bacteria 795
846 Ga0501079_0944471 3300049741 Bacteria 679
847 Ga0501262_001349 3300049759 Bacteria 2747
848 Ga0501262_001499 3300049759 Bacteria 2622
849 Ga0501264_010326 3300049761 Bacteria 897
850 Ga0501265_011353 3300049762 Bacteria 1098
851 Ga0501267_000626 3300049764 Bacteria 2809
852 Ga0501274_011614 3300049771 Bacteria 825
853 Ga0501045_0162758 3300049824 Bacteria 1661
854 Ga0501226_016951 3300049853 Bacteria 802
855 nmdc:mga03683_11128_c1 3300050489 Bacteria 3246
856 nmdc:mga03683_278803_c1 3300050489 Bacteria 781
857 nmdc:mga03683_94154_c1 3300050489 Bacteria 1309
858 nmdc:mga03n38_36305_c1 3300050490 Bacteria 2118
859 nmdc:mga03n38_45853_c1 3300050490 Bacteria 1927
860 nmdc:mga00v17_77895_c1 3300050491 Bacteria 2065
861 nmdc:mga0yw44_473004_c1 3300050492 Bacteria 850
862 nmdc:mga0k408_114951_c1 3300050493 Bacteria 1592
863 nmdc:mga0k408_127965_c1 3300050493 Bacteria 1507
864 nmdc:mga0k408_180461_c1 3300050493 Bacteria 1259
865 nmdc:mga0k408_220904_c1 3300050493 Bacteria 1131
866 nmdc:mga0k408_264052_c1 3300050493 Bacteria 1028
867 nmdc:mga0k408_26554_c1 3300050493 Bacteria 3284
868 nmdc:mga0k408_294919_c1 3300050493 Bacteria 968
869 nmdc:mga0k408_33080_c1 3300050493 Bacteria 2956
870 nmdc:mga0k408_33260_c1 3300050493 Bacteria 2949
871 nmdc:mga0k408_36174_c1 3300050493 Bacteria 2834
872 nmdc:mga0k408_362595_c1 3300050493 Bacteria 864
873 nmdc:mga0k408_44665_c1 3300050493 Bacteria 2556
874 nmdc:mga0k408_481962_c1 3300050493 Bacteria 736
875 nmdc:mga0k408_5004_c1 3300050493 Bacteria 7019
876 nmdc:mga0k408_527848_c1 3300050493 Bacteria 699
877 nmdc:mga0k408_74615_c1 3300050493 Bacteria 1982
878 nmdc:mga0k408_87495_c1 3300050493 Bacteria 1830
879 nmdc:mga06z11_103176_c1 3300050494 Bacteria 1568
880 nmdc:mga06z11_293141_c1 3300050494 Bacteria 966
881 nmdc:mga06z11_40445_c1 3300050494 Bacteria 2327
882 nmdc:mga04h51_177215_c1 3300050495 Bacteria 828
883 nmdc:mga07m45_120854_c1 3300050496 Bacteria 1513
884 nmdc:mga07m45_141775_c1 3300050496 Bacteria 1392
885 nmdc:mga07m45_20100_c1 3300050496 Bacteria 3625
886 nmdc:mga07m45_2170_c1 3300050496 Bacteria 9145
887 nmdc:mga07m45_268375_c1 3300050496 Bacteria 993
888 nmdc:mga07m45_37211_c1 3300050496 Bacteria 2714
889 nmdc:mga07m45_43311_c1 3300050496 Bacteria 2524
890 nmdc:mga07m45_463620_c1 3300050496 Bacteria 735
891 nmdc:mga07m45_5555_c1 3300050496 Bacteria 6290
892 nmdc:mga07m45_59879_c1 3300050496 Bacteria 2155
893 nmdc:mga07m45_9036_c1 3300050496 Bacteria 5149
894 nmdc:mga09592_89084_c1 3300050508 Bacteria 2636
895 nmdc:mga0n895_312497_c1 3300050512 Bacteria 1592
896 nmdc:mga0sz30_27975_c1 3300050516 Bacteria 2318
897 nmdc:mga0sz30_299891_c1 3300050516 Bacteria 716
898 Ga0495601_0325754 3300053077 Bacteria 1000
899 Ga0495612_0197714 3300053078 Bacteria 886
900 Ga0495619_0098090 3300053085 Bacteria 1992
901 Ga0500578_0000787 3300053086 Bacteria 37120
902 Ga0500646_0156246 3300053090 Bacteria 758
903 Ga0500583_0394511 3300053092 Bacteria 665
904 Ga0500651_0017600 3300053093 Bacteria 4411
905 Ga0500651_0134166 3300053093 Bacteria 1496
906 Ga0500651_0167992 3300053093 Bacteria 1309
907 Ga0500650_0171868 3300053098 Bacteria 996
908 Ga0500650_0178800 3300053098 Bacteria 972
909 Ga0500594_0046354 3300053118 Bacteria 1209
910 Ga0500628_019167 3300053129 Bacteria 1358
911 Ga0500642_0003445 3300053130 Bacteria 4787
912 Ga0500652_001710 3300053131 Bacteria 6657
913 Ga0500652_203248 3300053131 Bacteria 803
914 Ga0500655_020064 3300053133 Bacteria 1247
915 Ga0500655_073109 3300053133 Bacteria 700
916 Ga0500658_0048810 3300053134 Bacteria 1722
917 Ga0500559_0000059 3300053136 Bacteria 87846
918 Ga0500568_0044642 3300053139 Bacteria 1767
919 Ga0500577_0128395 3300053142 Bacteria 1060
920 Ga0500616_0207163 3300053153 Bacteria 864
921 Ga0500619_000133 3300053154 Bacteria 19267
922 Ga0500622_0000160 3300053156 Bacteria 70774
923 Ga0500622_0032625 3300053156 Bacteria 2730
924 Ga0500636_0204412 3300053177 Bacteria 1042
925 Ga0500570_116184 3300053724 Bacteria 1067
926 Ga0500645_038481 3300053730 Bacteria 1419
927 Ga0500587_004300 3300053739 Bacteria 1960
928 Ga0590071_053166 3300059421 Bacteria 984
929 Ga0466962_0009564 3300061719 Bacteria 4648
930 2587755912 2585428062 Bacteria 6842168
931 2643745467 2643221544 Bacteria 5886209
932 2644221328 2643221639 Bacteria 6649903
933 2644244450 2643221644 Bacteria 6865017
934 2644257914 2643221646 Bacteria 6433402
935 2739057833 2738541337 Bacteria 6183410
936 Ga0105245_10301358
937 JGI25152J39213_1002778
938 JGI25150J39212_1003353
939 Ga0006759J45824_1162501
940 JGI25153J46596_10004292
941 JGI25153J46596_10004567
942 Ga0055526_1004412
943 Ga0055524_1000258
944 Ga0055540_1000002
945 Ga0055531_10000310
946 Ga0065165_1001683
947 Ga0065165_1002834
948 Ga0065707_10090927
949 Ga0070658_10128269
950 Ga0070658_10195691
951 Ga0070658_10311785
952 Ga0070676_10022319
953 Ga0070676_10032285
954 Ga0070676_10078693
955 Ga0070676_10205394
956 Ga0070676_10445334
957 Ga0070683_100059203
958 Ga0070683_100734937
959 Ga0070683_101446738
960 Ga0070690_100062162
961 Ga0070690_100197702
962 Ga0070690_100589333
963 Ga0070670_100040957
964 Ga0070670_100232746
965 Ga0070670_100258512
966 Ga0070670_100513497
967 Ga0070670_100540004
968 Ga0070677_10000889
969 Ga0070677_10020130
970 Ga0070677_10071765
971 Ga0068869_100001619
972 Ga0068869_100028259
973 Ga0068869_100267404
974 Ga0068869_100336979
975 Ga0070666_10003167
976 Ga0070666_10175887
977 Ga0070666_10318867
978 Ga0068868_100002256
979 Ga0068868_100022436
980 Ga0068868_100310847
981 Ga0068868_100352570
982 Ga0068868_100565641
983 Ga0068868_100596848
984 Ga0070660_100108933
985 Ga0070660_100137835
986 Ga0070660_100520543
987 Ga0070689_100123161
988 Ga0070689_101061758
989 Ga0070687_100046687
990 Ga0070661_100001720
991 Ga0070661_100062266
992 Ga0070661_100153871
993 Ga0070692_10628905
994 Ga0070692_10637652
995 Ga0070692_10880403
996 Ga0070668_100038073
997 Ga0070668_100173960
998 Ga0070668_100270769
999 Ga0070668_101413636
1000 Ga0070669_100010395
1001 Ga0070669_100119122
1002 Ga0070669_100169862
1003 Ga0070669_100462242
1004 Ga0070669_100675668
1005 Ga0070669_100963289
1006 Ga0070669_101303080
1007 Ga0070675_100001116
1008 Ga0070675_100005842
1009 Ga0070675_100006338
1010 Ga0070675_100101383
1011 Ga0070675_100327718
1012 Ga0070675_100831920
1013 Ga0070671_100043592
1014 Ga0070671_100058823
1015 Ga0070671_100086176
1016 Ga0070671_100150147
1017 Ga0070671_100163810
1018 Ga0070671_100402259
1019 Ga0070671_100597473
1020 Ga0070674_100011236
1021 Ga0070674_100043625
1022 Ga0070674_100512928
1023 Ga0070674_101435740
1024 Ga0070673_100077140
1025 Ga0070673_100194781
1026 Ga0070673_100201685
1027 Ga0070673_100239696
1028 Ga0070673_100774542
1029 Ga0070673_100863976
1030 Ga0070688_100200240
1031 Ga0070688_100434073
1032 Ga0070659_100012251
1033 Ga0070659_100256775
1034 Ga0070659_100300001
1035 Ga0070667_100036949
1036 Ga0070667_100068104
1037 Ga0070667_100114657
1038 Ga0070667_100247073
1039 Ga0070701_10141653
1040 Ga0070700_100323039
1041 Ga0070700_101195184
1042 Ga0070708_101005957
1043 Ga0070663_100199898
1044 Ga0070663_100458604
1045 Ga0070678_100061342
1046 Ga0070678_100087270
1047 Ga0070678_100095294
1048 Ga0070678_100112832
1049 Ga0070678_100120555
1050 Ga0070678_100369234
1051 Ga0070678_100505912
1052 Ga0070662_100174879
1053 Ga0070662_100181241
1054 Ga0070662_100189479
1055 Ga0070662_100242966
1056 Ga0070662_100458861
1057 Ga0070662_100788198
1058 Ga0068867_100002101
1059 Ga0068867_100014473
1060 Ga0068867_100050575
1061 Ga0068867_100092642
1062 Ga0068867_100133445
1063 Ga0068867_100204200
1064 Ga0068867_100222289
1065 Ga0068867_100593901
1066 Ga0068867_100598959
1067 Ga0070706_100996449
1068 Ga0070707_101381555
1069 Ga0070679_100024034
1070 Ga0070684_100208863
1071 Ga0070684_100280877
1072 Ga0068853_100011273
1073 Ga0068853_100151805
1074 Ga0068853_100694070
1075 Ga0068853_100802067
1076 Ga0068853_101276325
1077 Ga0070672_100000244
1078 Ga0070672_100019755
1079 Ga0070672_100150914
1080 Ga0070672_100187777
1081 Ga0070672_100214396
1082 Ga0070672_100541021
1083 Ga0070686_101276126
1084 Ga0070693_100648313
1085 Ga0070693_100818077
1086 Ga0070665_100008133
1087 Ga0070665_100982552
1088 Ga0068855_100621985
1089 Ga0070664_100009115
1090 Ga0070664_100117970
1091 Ga0070664_100239528
1092 Ga0070664_100508964
1093 Ga0070664_100514284
1094 Ga0070664_100976897
1095 Ga0068857_100125208
1096 Ga0068857_100547883
1097 Ga0068857_100804719
1098 Ga0068854_100126594
1099 Ga0068854_100226214
1100 Ga0068854_100392402
1101 Ga0068854_100480746
1102 Ga0068854_100885983
1103 Ga0068856_100077915
1104 Ga0068856_100553326
1105 Ga0068856_100965724
1106 Ga0068852_100200214
1107 Ga0068852_100322165
1108 Ga0068852_101014730
1109 Ga0068859_100024272
1110 Ga0068859_100233033
1111 Ga0068859_100322219
1112 Ga0068864_100015636
1113 Ga0068864_100093815
1114 Ga0068864_100104109
1115 Ga0068864_100148041
1116 Ga0068864_100298983
1117 Ga0068864_100341785
1118 Ga0068864_100632353
1119 Ga0068864_100902415
1120 Ga0068864_101123779
1121 Ga0068866_10026830
1122 Ga0068861_100003805
1123 Ga0068861_100018886
1124 Ga0068861_100597339
1125 Ga0068861_100764448
1126 Ga0068851_10009452
1127 Ga0068851_10030511
1128 Ga0068851_10112872
1129 Ga0068863_100013406
1130 Ga0068863_100076784
1131 Ga0068863_100082990
1132 Ga0068863_100148747
1133 Ga0068863_100185414
1134 Ga0068863_100201758
1135 Ga0068863_100254263
1136 Ga0068863_100500231
1137 Ga0068863_100623135
1138 Ga0068863_101500081
1139 Ga0068858_100000560
1140 Ga0068858_100445393
1141 Ga0068858_100936736
1142 Ga0068858_101672262
1143 Ga0068860_100002632
1144 Ga0068860_100059751
1145 Ga0068860_100142990
1146 Ga0068860_100223468
1147 Ga0068860_100503369
1148 Ga0068860_100555350
1149 Ga0068862_101399903
1150 Ga0075365_10396561
1151 Ga0075368_10093591
1152 Ga0075363_100032710
1153 Ga0075363_100176142
1154 Ga0075363_100397695
1155 Ga0075364_10023919
1156 Ga0070715_10573139
1157 Ga0075362_10018795
1158 Ga0075362_10046032
1159 Ga0075367_10018059
1160 Ga0075367_10208504
1161 Ga0075369_10017625
1162 Ga0075369_10205109
1163 Ga0075366_10019883
1164 Ga0075366_10179915
1165 Ga0075366_10195197
1166 Ga0075366_10269532
1167 Ga0075366_10273019
1168 Ga0075366_10464317
1169 Ga0075366_10523858
1170 Ga0075366_10541554
1171 Ga0075366_10657265
1172 Ga0075366_10672449
1173 Ga0075366_10714192
1174 Ga0097621_100093294
1175 Ga0097621_100201380
1176 Ga0097621_100209747
1177 Ga0097621_100251202
1178 Ga0075370_10002549
1179 Ga0075370_10017281
1180 Ga0075370_10218219
1181 Ga0075370_10400184
1182 Ga0075370_10541992
1183 Ga0068871_100072898
1184 Ga0068871_100502932
1185 Ga0068871_100633144
1186 Ga0068871_100806605
1187 Ga0075429_100017695
1188 Ga0068865_100026195
1189 Ga0068865_100242858
1190 Ga0068865_100324471
1191 Ga0097620_100024272
1192 Ga0097620_100233044
1193 Ga0097620_100322205
1194 Ga0079104_1000017
1195 Ga0105240_10023861
1196 Ga0105240_10551334
1197 Ga0111539_10814893
1198 Ga0105245_10213536
1199 Ga0105245_10553135
1200 Ga0105245_10724763
1201 Ga0105247_10210157
1202 Ga0105243_10165716
1203 Ga0105243_10193011
1204 Ga0105243_10575371
1205 Ga0105243_11219407
1206 Ga0105243_11541577
1207 Ga0105243_12392434
1208 Ga0105241_10379803
1209 Ga0105241_11001217
1210 Ga0105241_11424631
1211 Ga0105242_10112655
1212 Ga0105242_10383024
1213 Ga0105242_11271822
1214 Ga0105248_10000679
1215 Ga0105248_10104296
1216 Ga0105248_10215206
1217 Ga0105248_10440998
1218 Ga0105248_10952569
1219 Ga0105237_10000548
1220 Ga0105237_10205148
1221 Ga0105237_10212429
1222 Ga0105237_11882952
1223 Ga0105238_10002440
1224 Ga0105238_10203940
1225 Ga0105238_10590832
1226 Ga0105249_10082168
1227 Ga0105249_10123056
1228 Ga0105249_10419696
1229 Ga0105239_10001569
1230 Ga0105239_10207920
1231 Ga0105246_10203731
1232 Ga0105246_10480590
1233 Ga0157317_1010853
1234 Ga0157325_1013941
1235 Ga0157314_1004058
1236 Ga0157327_1012605
1237 Ga0157373_10179324
1238 Ga0157371_10248832
1239 Ga0157369_10413052
1240 Ga0157374_10187745
1241 Ga0157374_10188942
1242 Ga0157374_10328547
1243 Ga0157374_10347703
1244 Ga0157374_10561553
1245 Ga0157374_10912581
1246 Ga0157378_10015886
1247 Ga0157378_10293204
1248 Ga0163162_10031729
1249 Ga0163162_10084966
1250 Ga0163162_10143147
1251 Ga0163162_10180091
1252 Ga0163162_10240544
1253 Ga0163162_10270788
1254 Ga0163162_11672085
1255 Ga0157372_10241788
1256 Ga0157372_10312214
1257 Ga0157375_10363747
1258 Ga0157375_10452069
1259 Ga0157375_10457926
1260 Ga0157375_10531556
1261 Ga0157375_10570710
1262 Ga0157375_10600266
1263 Ga0157375_10986810
1264 Ga0157375_12023634
1265 Ga0163163_10378171
1266 Ga0163163_10634539
1267 Ga0163163_12285584
1268 Ga0157380_10046803
1269 Ga0157380_10566735
1270 Ga0157380_11358722
1271 Ga0157377_10000028
1272 Ga0157377_10121179
1273 Ga0157377_10328756
1274 Ga0157377_10733992
1275 Ga0157379_10092313
1276 Ga0157379_10099041
1277 Ga0157379_10297504
1278 Ga0157379_10591146
1279 Ga0157379_10843928
1280 Ga0157376_10191548
1281 Ga0157376_10202583
1282 Ga0157376_10214959
1283 Ga0157376_10348211
1284 Ga0157376_11979580
1285 Ga0182005_1065056
1286 Ga0163161_10049799
1287 Ga0163161_10197542
1288 Ga0163161_10218131
1289 Ga0213872_10000272
1290 Ga0213874_10066914
1291 Ga0207425_1000175
1292 Ga0209129_1000369
1293 Ga0209129_1020485
1294 Ga0209565_1008817
1295 Ga0209673_1013442
1296 Ga0209673_1020769
1297 Ga0209675_1034267
1298 Ga0209564_1000046
1299 Ga0209758_1000369
1300 Ga0209758_1000709
1301 Ga0209050_1001458
1302 Ga0209050_1002755
1303 Ga0209256_1000011
1304 Ga0209256_1061640
1305 Ga0209051_1000024
1306 Ga0209051_1064691
1307 Ga0209257_1000032
1308 Ga0209257_1001131
1309 Ga0209257_1036354
1310 Ga0207697_10065232
1311 Ga0207697_10083469
1312 Ga0207682_10023212
1313 Ga0207682_10031176
1314 Ga0207682_10089675
1315 Ga0207682_10261204
1316 Ga0207642_10015721
1317 Ga0207710_10522813
1318 Ga0207688_10124569
1319 Ga0207688_10129378
1320 Ga0207680_10030133
1321 Ga0207680_10070936
1322 Ga0207680_10397817
1323 Ga0207680_10640532
1324 Ga0207645_10113834
1325 Ga0207645_10114701
1326 Ga0207645_10120719
1327 Ga0207645_10342310
1328 Ga0207643_10053505
1329 Ga0207684_10664280
1330 Ga0207654_10281957
1331 Ga0207695_10006897
1332 Ga0207695_10762062
1333 Ga0207671_10112614
1334 Ga0207671_10152404
1335 Ga0207662_10026112
1336 Ga0207657_10071817
1337 Ga0207657_10439388
1338 Ga0207649_10004884
1339 Ga0207649_10279507
1340 Ga0207652_10015790
1341 Ga0207681_10025698
1342 Ga0207681_10393127
1343 Ga0207681_10625466
1344 Ga0207694_11241528
1345 Ga0207650_10001071
1346 Ga0207650_10371194
1347 Ga0207659_10005352
1348 Ga0207659_10009622
1349 Ga0207659_10010862
1350 Ga0207659_10217604
1351 Ga0207659_10242146
1352 Ga0207687_10126159
1353 Ga0207687_10773800
1354 Ga0207644_10005144
1355 Ga0207644_10017413
1356 Ga0207644_10046792
1357 Ga0207644_10068487
1358 Ga0207644_10154523
1359 Ga0207644_10703977
1360 Ga0207644_10796382
1361 Ga0207690_10041779
1362 Ga0207690_10500428
1363 Ga0207690_10780731
1364 Ga0207706_10050990
1365 Ga0207706_10247604
1366 Ga0207706_10386379
1367 Ga0207686_10171832
1368 Ga0207686_10287350
1369 Ga0207709_10090802
1370 Ga0207709_10100997
1371 Ga0207709_10104333
1372 Ga0207709_10173664
1373 Ga0207670_10072769
1374 Ga0207670_10167041
1375 Ga0207669_10031978
1376 Ga0207669_10061104
1377 Ga0207669_10189516
1378 Ga0207669_10244419
1379 Ga0207704_10014262
1380 Ga0207704_10036194
1381 Ga0207691_10010002
1382 Ga0207691_10032268
1383 Ga0207691_10246574
1384 Ga0207691_10253581
1385 Ga0207711_10027473
1386 Ga0207711_10084791
1387 Ga0207711_10162102
1388 Ga0207711_10346164
1389 Ga0207689_10000534
1390 Ga0207689_10083775
1391 Ga0207689_10299797
1392 Ga0207689_10370353
1393 Ga0207661_10444263
1394 Ga0207679_10000448
1395 Ga0207679_10457130
1396 Ga0207679_11272405
1397 Ga0207679_11606128
1398 Ga0207667_10122369
1399 Ga0207651_10003222
1400 Ga0207651_10059933
1401 Ga0207651_10062440
1402 Ga0207651_10337841
1403 Ga0207712_10097667
1404 Ga0207712_10239438
1405 Ga0207712_10329465
1406 Ga0207712_10530694
1407 Ga0207668_10014791
1408 Ga0207640_10146799
1409 Ga0207640_10282985
1410 Ga0207640_10844654
1411 Ga0207658_10007924
1412 Ga0207658_10009896
1413 Ga0207658_10017278
1414 Ga0207658_10027882
1415 Ga0207658_10423460
1416 Ga0207658_10446912
1417 Ga0207658_11352921
1418 Ga0207677_10012100
1419 Ga0207677_10327620
1420 Ga0207677_10595225
1421 Ga0207703_10008539
1422 Ga0207703_10009811
1423 Ga0207703_10048570
1424 Ga0207703_11380089
1425 Ga0207639_10231352
1426 Ga0207639_10623791
1427 Ga0207639_10629695
1428 Ga0207639_10735103
1429 Ga0207678_10002683
1430 Ga0207678_10085112
1431 Ga0207678_10188619
1432 Ga0207678_10352068
1433 Ga0207678_10415926
1434 Ga0207708_10138120
1435 Ga0207708_11124279
1436 Ga0207702_10070651
1437 Ga0207702_10206812
1438 Ga0207702_10312958
1439 Ga0207641_10010893
1440 Ga0207641_10032107
1441 Ga0207641_10072444
1442 Ga0207641_10193163
1443 Ga0207641_10215012
1444 Ga0207641_10338665
1445 Ga0207641_10348957
1446 Ga0207641_10437943
1447 Ga0207641_10876990
1448 Ga0207648_10000146
1449 Ga0207648_10180628
1450 Ga0207648_10405381
1451 Ga0207648_10415584
1452 Ga0207648_10502418
1453 Ga0207648_10574954
1454 Ga0207648_10658168
1455 Ga0207676_10001000
1456 Ga0207676_10013494
1457 Ga0207676_10125282
1458 Ga0207676_10128132
1459 Ga0207676_10221449
1460 Ga0207676_10282704
1461 Ga0207676_10489285
1462 Ga0207674_10070720
1463 Ga0207674_10542940
1464 Ga0207675_100004784
1465 Ga0207675_100010268
1466 Ga0207675_100080286
1467 Ga0207675_100189997
1468 Ga0207683_10104581
1469 Ga0207683_10189853
1470 Ga0207683_10194820
1471 Ga0207683_10222442
1472 Ga0207683_10276405
1473 Ga0207683_10472223
1474 Ga0207683_10497205
1475 Ga0207683_10678436
1476 Ga0207698_10054473
1477 Ga0207698_10069209
1478 Ga0207698_10196779
1479 Ga0207698_10213285
1480 Ga0207698_10586767
1481 Ga0207698_10815313
1482 Ga0207698_10975844
1483 Ga0207698_11068334
1484 Ga0209281_1000042
1485 Ga0209813_10001279
1486 Ga0209813_10063817
1487 Ga0268266_10024018
1488 Ga0268266_10225307
1489 Ga0268265_10018225
1490 Ga0268265_10499010
1491 Ga0268265_11776673
1492 Ga0268264_10048840
1493 Ga0268264_10064893
1494 Ga0268264_10124323
1495 Ga0268264_11002586
1496 Ga0307517_10000964
1497 Ga0307517_10171950
1498 Ga0307517_10326751
1499 Ga0307517_10443576
1500 Ga0307515_10001342
1501 Ga0307515_10006289
1502 Ga0307515_10011462
1503 Ga0307515_10012893
1504 Ga0307515_10111378
1505 Ga0307515_10231500
1506 Ga0307515_10247342
1507 Ga0307515_10401135
1508 Ga0307512_10055753
1509 Ga0307512_10130854
1510 Ga0265327_10000235
1511 Ga0307513_10095382
1512 Ga0307513_10163563
1513 Ga0307513_10183548
1514 Ga0307513_10436038
1515 Ga0307509_10005272
1516 Ga0307509_10111411
1517 Ga0307509_10112829
1518 Ga0307509_10174984
1519 Ga0307509_10249237
1520 Ga0307509_10361944
1521 Ga0307408_100000150
1522 Ga0307408_100479530
1523 Ga0307408_100788620
1524 Ga0307508_10000004
1525 Ga0307508_10005233
1526 Ga0307514_10039660
1527 Ga0307514_10055656
1528 Ga0307516_10004922
1529 Ga0307516_10213071
1530 Ga0307516_10352612
1531 Ga0307516_10396019
1532 Ga0307516_10424210
1533 Ga0307405_10088968
1534 Ga0307405_10104429
1535 Ga0307405_10156842
1536 Ga0307413_10400222
1537 Ga0307410_10036099
1538 Ga0307406_10224467
1539 Ga0307407_10088901
1540 Ga0307412_10042878
1541 Ga0307412_10516181
1542 Ga0307412_10540539
1543 Ga0307412_10683394
1544 Ga0307409_100007456
1545 Ga0307409_100277245
1546 Ga0307409_100419518
1547 Ga0307416_100001653
1548 Ga0307416_100245850
1549 Ga0307416_100828774
1550 Ga0307414_10062390
1551 Ga0307414_10211838
1552 Ga0307414_10617794
1553 Ga0307414_10867468
1554 Ga0307414_11014622
1555 Ga0307411_10018300
1556 Ga0307411_10022995
1557 Ga0307411_10233236
1558 Ga0307415_100002497
1559 Ga0307415_100087979
1560 Ga0307507_10025171
1561 Ga0307510_10063259
1562 Ga0307510_10119653
1563 Ga0307510_10143713
1564 Ga0307510_10265109
1565 Ga0307510_10284347
1566 Ga0373948_0019519
1567 Ga0373959_0018329
1568 Ga0373959_0028246
1569 Ga0373926_0173366
1570 Ga0373928_0006006
1571 Ga0373940_0090358
1572 Ga0373944_0011058
1573 Ga0373944_0086606
1574 Ga0373944_0172941
1575 Ga0373951_0088149
1576 Ga0373952_0021267
1577 Ga0373952_0092819
1578 Ga0373923_0264758
1579 Ga0373939_0000712
1580 Ga0373939_0108930
1581 Ga0373939_0326895
1582 Ga0373945_0075448
1583 Ga0373953_0053355
1584 Ga0373960_0000489
1585 Ga0373943_0128915
1586 Ga0373946_0072576
1587 Ga0373955_0114491
1588 Ga0373955_0720773
1589 Ga0373942_0090771
1590 Ga0373962_0008572
1591 Ga0373924_0042699
1592 Ga0373924_0109650
1593 Ga0373931_0000200
1594 Ga0373931_0217854
1595 Ga0373927_0639313
1596 Ga0373933_0254543
1597 Ga0373947_0081144
1598 Ga0373947_0546354
1599 Ga0373937_0163889
1600 Ga0373937_0460190
1601 Ga0373925_0176091
1602 Ga0373925_0399978
1603 Ga0395898_0001070
1604 Ga0395905_0002212
1605 Ga0395905_0009343
1606 Ga0395905_0587701
1607 Ga0436361_0214541
1608 Ga0436363_0840428
1609 Ga0439461_0007827
1610 Ga0451793_0241110
1611 Ga0451793_1521968
1612 Ga0451795_0279382
1613 Ga0451798_0538262
1614 Ga0451800_0693871
1615 Ga0451800_0937711
1616 Ga0451800_0994505
1617 Ga0451802_0094819
1618 Ga0451802_0200560
1619 Ga0451802_2084031
1620 Ga0451807_1211661
1621 Ga0451807_1697411
1622 Ga0451849_1501812
1623 Ga0451851_0215488
1624 Ga0451853_1703130
1625 Ga0451853_2872717
1626 Ga0439437_006931
1627 Ga0439445_0088021
1628 Ga0450913_010757
1629 Ga0450917_001882
1630 Ga0450917_022120
1631 Ga0450919_000761
1632 Ga0450888_008076
1633 Ga0450888_010253
1634 Ga0450891_002889
1635 Ga0450892_001021
1636 Ga0450898_023639
1637 Ga0450899_020271
1638 Ga0450889_001684
1639 Ga0450910_052933
1640 Ga0439446_0040999
1641 Ga0439434_0134992
1642 Ga0439464_0008192
1643 Ga0439464_0041972
1644 Ga0450916_028255
1645 Ga0450918_000001
1646 Ga0450893_0002619
1647 Ga0466969_0030298
1648 Ga0466966_0064736
1649 Ga0466961_0224018
1650 Ga0466963_0007961
1651 Ga0466964_0031131
1652 Ga0453684_0889375
1653 Ga0466971_0016403
1654 Ga0466968_0310907
1655 Ga0466957_0099578
1656 Ga0466957_0208414
1657 Ga0466959_0001653
1658 Ga0451576_0132417
1659 Ga0451576_0312200
1660 Ga0466958_0030970
1661 Ga0495592_0006237
1662 Ga0495603_0276929
1663 Ga0495629_0635263
1664 Ga0495650_0019828
1665 Ga0495580_0308634
1666 Ga0495582_0250520
1667 Ga0495606_0141738
1668 Ga0495608_0553518
1669 Ga0495610_0125844
1670 Ga0495610_0275033
1671 Ga0495628_0222980
1672 Ga0495630_0690316
1673 Ga0495632_0077063
1674 Ga0495632_0079573
1675 Ga0495632_0120826
1676 Ga0495643_0325999
1677 Ga0495666_0099846
1678 Ga0495642_0080749
1679 Ga0495642_0154458
1680 Ga0495654_0232546
1681 Ga0495640_0154051
1682 Ga0495586_0099766
1683 Ga0495587_0216877
1684 Ga0495598_0013601
1685 Ga0495621_0043118
1686 Ga0495597_0078206
1687 Ga0495645_0168671
1688 Ga0495645_0180227
1689 Ga0495622_0019347
1690 Ga0495668_0336188
1691 Ga0495634_0229414
1692 Ga0495611_0073439
1693 Ga0495625_0008638
1694 Ga0495635_0221927
1695 Ga0495646_0125053
1696 Ga0495647_0255060
1697 Ga0495658_0209665
1698 Ga0495658_0236107
1699 Ga0495658_0282552
1700 Ga0495658_0316589
1701 Ga0495624_0122869
1702 Ga0495670_0173174
1703 Ga0495670_0255477
1704 Ga0495649_0002642
1705 Ga0495660_0111528
1706 Ga0495674_0471027
1707 Ga0495676_0303751
1708 Ga0495676_0458680
1709 Ga0495683_0210537
1710 Ga0495687_025118
1711 Ga0495677_0251842
1712 Ga0495673_0136258
1713 Ga0495684_0088066
1714 Ga0495686_0008187
1715 Ga0495686_0311941
1716 Ga0495686_0331184
1717 Ga0495593_0038761
1718 Ga0495626_0035491
1719 Ga0495626_0129612
1720 Ga0496100_0047651
1721 Ga0496100_0525094
1722 Ga0496100_1027540
1723 Ga0496101_0164452
1724 Ga0496102_0120399
1725 Ga0496102_0290176
1726 Ga0496104_0287567
1727 Ga0496104_0490024
1728 Ga0496104_0870950
1729 Ga0496106_0052636
1730 Ga0496107_0010834
1731 Ga0496107_0386649
1732 Ga0496108_0124482
1733 Ga0496108_0213521
1734 Ga0496108_0343420
1735 Ga0496108_0581377
1736 Ga0496109_0077698
1737 Ga0496109_0239810
1738 Ga0496109_0452798
1739 Ga0496110_0133370
1740 Ga0496110_0238652
1741 Ga0496110_0595509
1742 Ga0496110_1377220
1743 Ga0496111_0268195
1744 Ga0496112_0032377
1745 Ga0496112_0199727
1746 Ga0496113_0086979
1747 Ga0496114_0169441
1748 Ga0496115_0101325
1749 Ga0496121_0240920
1750 Ga0496124_0001201
1751 Ga0496125_0089687
1752 Ga0501310_009437
1753 Ga0501305_009816
1754 Ga0501307_014046
1755 Ga0501292_007725
1756 Ga0501297_012007
1757 Ga0501314_000114
1758 Ga0501320_000236
1759 Ga0501323_003960
1760 Ga0501032_0168653
1761 Ga0501034_0815988
1762 Ga0501043_0000023
1763 Ga0501046_0000018
1764 Ga0501047_0000020
1765 Ga0501048_0002498
1766 Ga0501067_0380820
1767 Ga0501068_0455520
1768 Ga0501198_000011
1769 Ga0501206_020207
1770 Ga0501211_000654
1771 Ga0501222_002058
1772 Ga0501227_004413
1773 Ga0501236_011757
1774 Ga0501253_014967
1775 Ga0501255_027400
1776 Ga0501256_023838
1777 Ga0501258_003277
1778 Ga0501221_020662
1779 Ga0501229_000229
1780 Ga0501245_041219
1781 Ga0501079_0944471
1782 Ga0501262_001349
1783 Ga0501262_001499
1784 Ga0501264_010326
1785 Ga0501265_011353
1786 Ga0501267_000626
1787 Ga0501274_011614
1788 Ga0501045_0162758
1789 Ga0501226_016951
1790 nmdc:mga03683_11128_c1
1791 nmdc:mga03683_278803_c1
1792 nmdc:mga03683_94154_c1
1793 nmdc:mga03n38_36305_c1
1794 nmdc:mga03n38_45853_c1
1795 nmdc:mga00v17_77895_c1
1796 nmdc:mga0yw44_473004_c1
1797 nmdc:mga0k408_114951_c1
1798 nmdc:mga0k408_127965_c1
1799 nmdc:mga0k408_180461_c1
1800 nmdc:mga0k408_220904_c1
1801 nmdc:mga0k408_264052_c1
1802 nmdc:mga0k408_26554_c1
1803 nmdc:mga0k408_294919_c1
1804 nmdc:mga0k408_33080_c1
1805 nmdc:mga0k408_33260_c1
1806 nmdc:mga0k408_36174_c1
1807 nmdc:mga0k408_362595_c1
1808 nmdc:mga0k408_44665_c1
1809 nmdc:mga0k408_481962_c1
1810 nmdc:mga0k408_5004_c1
1811 nmdc:mga0k408_527848_c1
1812 nmdc:mga0k408_74615_c1
1813 nmdc:mga0k408_87495_c1
1814 nmdc:mga06z11_103176_c1
1815 nmdc:mga06z11_293141_c1
1816 nmdc:mga06z11_40445_c1
1817 nmdc:mga04h51_177215_c1
1818 nmdc:mga07m45_120854_c1
1819 nmdc:mga07m45_141775_c1
1820 nmdc:mga07m45_20100_c1
1821 nmdc:mga07m45_2170_c1
1822 nmdc:mga07m45_268375_c1
1823 nmdc:mga07m45_37211_c1
1824 nmdc:mga07m45_43311_c1
1825 nmdc:mga07m45_463620_c1
1826 nmdc:mga07m45_5555_c1
1827 nmdc:mga07m45_59879_c1
1828 nmdc:mga07m45_9036_c1
1829 nmdc:mga09592_89084_c1
1830 nmdc:mga0n895_312497_c1
1831 nmdc:mga0sz30_27975_c1
1832 nmdc:mga0sz30_299891_c1
1833 Ga0495601_0325754
1834 Ga0495612_0197714
1835 Ga0495619_0098090
1836 Ga0500578_0000787
1837 Ga0500646_0156246
1838 Ga0500583_0394511
1839 Ga0500651_0017600
1840 Ga0500651_0134166
1841 Ga0500651_0167992
1842 Ga0500650_0171868
1843 Ga0500650_0178800
1844 Ga0500594_0046354
1845 Ga0500628_019167
1846 Ga0500642_0003445
1847 Ga0500652_001710
1848 Ga0500652_203248
1849 Ga0500655_020064
1850 Ga0500655_073109
1851 Ga0500658_0048810
1852 Ga0500559_0000059
1853 Ga0500568_0044642
1854 Ga0500577_0128395
1855 Ga0500616_0207163
1856 Ga0500619_000133
1857 Ga0500622_0000160
1858 Ga0500622_0032625
1859 Ga0500636_0204412
1860 Ga0500570_116184
1861 Ga0500645_038481
1862 Ga0500587_004300
1863 Ga0590071_053166
1864 Ga0466962_0009564
1865 2587755912
1866 2643745467
1867 2644221328
1868 2644244450
1869 2644257914
1870 2739057833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

31

175

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_B assembly intermediate of the plant mitochondrial complex i 0.8442 6 163
6r7p-assembly1.cif.gz_A crystal structure of oxidized aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof s96m 0.837 6 159
7v2c-assembly1.cif.gz_O active state complex i from q10 dataset 0.8351 6 163
7zm7-assembly1.cif.gz_H cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) 0.8345 5 162
6q9j-assembly1.cif.gz_A crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129s and nuof bound to nadh 0.8343 6 159
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9383 77 163 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9333 78 162 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9276 76 157 3.40.30.10
af_O13691_6_74_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9254 4 69 1.10.10.1590
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9238 77 163 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3MPB9-F1-model_v4 deleted 0.9095 30 163
AF-A0A381RF00-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9055 33 160 GO:0003954
GO:0046872
GO:0051537
AF-A0A4Q3MPB9-F1-model_v4 deleted 0.8969 30 163
AF-A0A257RWA4-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.8936 33 162 GO:0003954
GO:0046872
GO:0051537
AF-A0A520VRS8-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.8918 6 162 GO:0003954
GO:0046872
GO:0051537

Map