F486156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 386 | 1870 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10000485|Ga0105237_1000048540 |
| Length | 288 |
| Sequence | MLRDDADDADYCLLSASSAQSIEISASLFLLLTVTKPTSPQSNSKKYMQPLITLKDIGRKYVIGTEIIHALKSVSLTINKGEFVALMGPSGSGKSTLMNILGCLDTPTKGEYILNGINVSHMTDNQLAEVRNEEIGFVFQTFNLLPRNTALDNVALPLVYAGVGKEKRQARAKTSLENVGLGNRVDHKPNELSGGQRQRVAVARALINDPSIILADEPTGNLDTKTSIEIMGLMEDIHKKGNTIILVTHEEDIAMHAHRIVRMRDGLVENDYANTNIITVDRSKATTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 203 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 204 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 205 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 333 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 334 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 335 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 339 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 340 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 342 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 347 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 368 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 372 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 373 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 374 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 375 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 376 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 377 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 378 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 379 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 380 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 381 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 382 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 383 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 384 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 385 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 386 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0.43 |
| Isolates | 1.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 91.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105237_10000485 | 3300009545 | Bacteria | 56664 |
| 2 | SwRhRL2b_contig_731410 | 2162886007 | Bacteria | 1251 |
| 3 | CNAas_1000829 | 3300000532 | Bacteria | 2940 |
| 4 | JGI24741J21665_1012612 | 3300001915 | Bacteria | 1448 |
| 5 | JGI24740J21852_10016887 | 3300001979 | Bacteria | 2625 |
| 6 | JGI24737J22298_10000143 | 3300001990 | Bacteria | 22223 |
| 7 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 8 | JGI24748J21848_1000051 | 3300002074 | Bacteria | 52353 |
| 9 | JGI24744J21845_10002026 | 3300002077 | Bacteria | 4104 |
| 10 | JGI24034J26672_10000030 | 3300002239 | Bacteria | 97515 |
| 11 | JGI24751J29686_10054973 | 3300002459 | Bacteria | 820 |
| 12 | JGI25162J39368_1000089 | 3300002737 | Bacteria | 104054 |
| 13 | JGI25162J39368_1000498 | 3300002737 | Bacteria | 29793 |
| 14 | JGI25157J39369_1005927 | 3300002741 | Bacteria | 1921 |
| 15 | JGI25165J46597_1000618 | 3300003214 | Bacteria | 30063 |
| 16 | rootH1_10029777 | 3300003316 | Bacteria | 8945 |
| 17 | rootH2_10018591 | 3300003320 | Bacteria | 30571 |
| 18 | rootH2_10039562 | 3300003320 | Bacteria | 6649 |
| 19 | rootH2_10186211 | 3300003320 | Bacteria | 1640 |
| 20 | rootL2_10211276 | 3300003322 | Bacteria | 2534 |
| 21 | rootH1_10010194 | 3300003323 | Bacteria | 43591 |
| 22 | rootH1_10105642 | 3300003323 | Bacteria | 3000 |
| 23 | rootH1_10379396 | 3300003323 | Bacteria | 1393 |
| 24 | Ga0058863_11791471 | 3300004799 | Bacteria | 1797 |
| 25 | Ga0058861_11760232 | 3300004800 | Bacteria | 1356 |
| 26 | Ga0058862_12416007 | 3300004803 | Bacteria | 1780 |
| 27 | Ga0065714_10064422 | 3300005288 | Bacteria | 270668 |
| 28 | Ga0065714_10148595 | 3300005288 | Bacteria | 1121 |
| 29 | Ga0065704_10009526 | 3300005289 | Bacteria | 3117 |
| 30 | Ga0065704_10023815 | 3300005289 | Bacteria | 1152 |
| 31 | Ga0065704_10092483 | 3300005289 | Bacteria | 2647 |
| 32 | Ga0065704_10092834 | 3300005289 | Bacteria | 2578 |
| 33 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 34 | Ga0065712_10089641 | 3300005290 | Bacteria | 2461 |
| 35 | Ga0065712_10204759 | 3300005290 | Bacteria | 1095 |
| 36 | Ga0065715_10004474 | 3300005293 | Bacteria | 3796 |
| 37 | Ga0065715_10089181 | 3300005293 | Bacteria | 13047 |
| 38 | Ga0065715_10095696 | 3300005293 | Bacteria | 4020 |
| 39 | Ga0065715_10105987 | 3300005293 | Bacteria | 2858 |
| 40 | Ga0065715_10343798 | 3300005293 | Bacteria | 963 |
| 41 | Ga0065715_10443342 | 3300005293 | Bacteria | 833 |
| 42 | Ga0065707_10091424 | 3300005295 | Bacteria | 3950 |
| 43 | Ga0065707_10190589 | 3300005295 | Bacteria | 1363 |
| 44 | Ga0065707_10246444 | 3300005295 | Bacteria | 1139 |
| 45 | Ga0065707_10322946 | 3300005295 | Bacteria | 963 |
| 46 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 47 | Ga0070658_10080753 | 3300005327 | Bacteria | 2671 |
| 48 | Ga0070658_10338790 | 3300005327 | Bacteria | 1286 |
| 49 | Ga0070658_10563895 | 3300005327 | Bacteria | 986 |
| 50 | Ga0070676_10004488 | 3300005328 | Bacteria | 7345 |
| 51 | Ga0070676_10093607 | 3300005328 | Bacteria | 1845 |
| 52 | Ga0070676_10149873 | 3300005328 | Bacteria | 1492 |
| 53 | Ga0070676_10503680 | 3300005328 | Bacteria | 860 |
| 54 | Ga0070683_100301639 | 3300005329 | Bacteria | 1524 |
| 55 | Ga0070690_100054471 | 3300005330 | Bacteria | 2561 |
| 56 | Ga0070690_100219957 | 3300005330 | Bacteria | 1330 |
| 57 | Ga0070690_100225321 | 3300005330 | Bacteria | 1315 |
| 58 | Ga0070670_100000165 | 3300005331 | Bacteria | 59984 |
| 59 | Ga0070670_100000767 | 3300005331 | Bacteria | 24964 |
| 60 | Ga0070670_100224439 | 3300005331 | Bacteria | 1635 |
| 61 | Ga0068869_100035202 | 3300005334 | Bacteria | 3548 |
| 62 | Ga0068869_100080076 | 3300005334 | Bacteria | 2436 |
| 63 | Ga0068869_100090184 | 3300005334 | Bacteria | 2303 |
| 64 | Ga0068869_100165587 | 3300005334 | Bacteria | 1724 |
| 65 | Ga0068869_100184623 | 3300005334 | Bacteria | 1636 |
| 66 | Ga0070680_100302537 | 3300005336 | Bacteria | 1356 |
| 67 | Ga0070680_100458117 | 3300005336 | Bacteria | 1089 |
| 68 | Ga0070682_100041994 | 3300005337 | Bacteria | 2821 |
| 69 | Ga0068868_100013908 | 3300005338 | Bacteria | 5917 |
| 70 | Ga0070660_100091736 | 3300005339 | Bacteria | 2396 |
| 71 | Ga0070689_100000816 | 3300005340 | Bacteria | 19247 |
| 72 | Ga0070689_100023397 | 3300005340 | Bacteria | 4624 |
| 73 | Ga0070689_100779276 | 3300005340 | Bacteria | 840 |
| 74 | Ga0070691_10113953 | 3300005341 | Bacteria | 1355 |
| 75 | Ga0070691_10313527 | 3300005341 | Bacteria | 860 |
| 76 | Ga0070687_100057385 | 3300005343 | Bacteria | 2041 |
| 77 | Ga0070687_100226986 | 3300005343 | Bacteria | 1147 |
| 78 | Ga0070661_100050498 | 3300005344 | Bacteria | 3043 |
| 79 | Ga0070692_10016459 | 3300005345 | Bacteria | 3517 |
| 80 | Ga0070692_10031317 | 3300005345 | Bacteria | 2666 |
| 81 | Ga0070692_10060528 | 3300005345 | Bacteria | 1993 |
| 82 | Ga0070692_10203511 | 3300005345 | Bacteria | 1161 |
| 83 | Ga0070669_100011817 | 3300005353 | Bacteria | 6193 |
| 84 | Ga0070669_100026199 | 3300005353 | Bacteria | 4195 |
| 85 | Ga0070669_100324176 | 3300005353 | Bacteria | 1245 |
| 86 | Ga0070675_100047495 | 3300005354 | Bacteria | 3517 |
| 87 | Ga0070671_100027615 | 3300005355 | Bacteria | 4673 |
| 88 | Ga0070671_100208803 | 3300005355 | Bacteria | 1656 |
| 89 | Ga0070673_100008881 | 3300005364 | Bacteria | 6715 |
| 90 | Ga0070673_100014675 | 3300005364 | Bacteria | 5470 |
| 91 | Ga0070673_100028970 | 3300005364 | Bacteria | 4125 |
| 92 | Ga0070688_100000427 | 3300005365 | Bacteria | 21283 |
| 93 | Ga0070688_100009040 | 3300005365 | Bacteria | 5432 |
| 94 | Ga0070659_100018374 | 3300005366 | Bacteria | 5277 |
| 95 | Ga0070659_100026796 | 3300005366 | Bacteria | 4437 |
| 96 | Ga0070667_100139335 | 3300005367 | Bacteria | 2123 |
| 97 | Ga0070701_10026549 | 3300005438 | Bacteria | 2825 |
| 98 | Ga0070701_10065272 | 3300005438 | Bacteria | 1931 |
| 99 | Ga0070705_100022136 | 3300005440 | Unclassified | 3392 |
| 100 | Ga0070705_100193364 | 3300005440 | Bacteria | 1389 |
| 101 | Ga0070700_100004173 | 3300005441 | Bacteria | 7533 |
| 102 | Ga0070700_100118473 | 3300005441 | Bacteria | 1770 |
| 103 | Ga0070700_100138605 | 3300005441 | Bacteria | 1650 |
| 104 | Ga0070700_100199413 | 3300005441 | Bacteria | 1405 |
| 105 | Ga0070694_100005028 | 3300005444 | Bacteria | 7979 |
| 106 | Ga0070694_100029319 | 3300005444 | Bacteria | 3590 |
| 107 | Ga0070694_100067292 | 3300005444 | Bacteria | 2459 |
| 108 | Ga0070694_100200135 | 3300005444 | Bacteria | 1488 |
| 109 | Ga0070694_100210428 | 3300005444 | Bacteria | 1454 |
| 110 | Ga0070694_100359661 | 3300005444 | Bacteria | 1130 |
| 111 | Ga0070694_100696880 | 3300005444 | Bacteria | 826 |
| 112 | Ga0070708_100002619 | 3300005445 | Bacteria | 13932 |
| 113 | Ga0070708_100259342 | 3300005445 | Bacteria | 1634 |
| 114 | Ga0070708_100329329 | 3300005445 | Bacteria | 1439 |
| 115 | Ga0070708_100369972 | 3300005445 | Bacteria | 1351 |
| 116 | Ga0070678_100018207 | 3300005456 | Bacteria | 4549 |
| 117 | Ga0070678_100110744 | 3300005456 | Bacteria | 2147 |
| 118 | Ga0070662_100000626 | 3300005457 | Bacteria | 21383 |
| 119 | Ga0070662_100173729 | 3300005457 | Bacteria | 1694 |
| 120 | Ga0070681_10001768 | 3300005458 | Bacteria | 19378 |
| 121 | Ga0070681_10022542 | 3300005458 | Bacteria | 6324 |
| 122 | Ga0070681_10029377 | 3300005458 | Bacteria | 5520 |
| 123 | Ga0068867_100016777 | 3300005459 | Bacteria | 5203 |
| 124 | Ga0068867_100219256 | 3300005459 | Bacteria | 1532 |
| 125 | Ga0068867_100512828 | 3300005459 | Bacteria | 1033 |
| 126 | Ga0070706_100000128 | 3300005467 | Bacteria | 92969 |
| 127 | Ga0070706_100005626 | 3300005467 | Bacteria | 11923 |
| 128 | Ga0070706_100018438 | 3300005467 | Bacteria | 6437 |
| 129 | Ga0070706_100037115 | 3300005467 | Bacteria | 4502 |
| 130 | Ga0070706_100049046 | 3300005467 | Bacteria | 3897 |
| 131 | Ga0070706_100093641 | 3300005467 | Bacteria | 2788 |
| 132 | Ga0070706_100223588 | 3300005467 | Bacteria | 1757 |
| 133 | Ga0070706_100539125 | 3300005467 | Bacteria | 1085 |
| 134 | Ga0070707_100006408 | 3300005468 | Bacteria | 10942 |
| 135 | Ga0070707_100029831 | 3300005468 | Bacteria | 5191 |
| 136 | Ga0070707_100078663 | 3300005468 | Bacteria | 3182 |
| 137 | Ga0070707_100180455 | 3300005468 | Bacteria | 2058 |
| 138 | Ga0070707_100180813 | 3300005468 | Bacteria | 2056 |
| 139 | Ga0070707_100768365 | 3300005468 | Bacteria | 927 |
| 140 | Ga0070698_100000663 | 3300005471 | Bacteria | 36731 |
| 141 | Ga0070698_100004577 | 3300005471 | Bacteria | 15185 |
| 142 | Ga0070698_100005014 | 3300005471 | Bacteria | 14509 |
| 143 | Ga0070698_100051295 | 3300005471 | Bacteria | 4202 |
| 144 | Ga0070698_100053534 | 3300005471 | Bacteria | 4101 |
| 145 | Ga0070698_100185010 | 3300005471 | Bacteria | 2021 |
| 146 | Ga0070698_100209354 | 3300005471 | Bacteria | 1885 |
| 147 | Ga0070699_100001336 | 3300005518 | Bacteria | 22693 |
| 148 | Ga0070699_100014592 | 3300005518 | Bacteria | 6757 |
| 149 | Ga0070699_100049669 | 3300005518 | Bacteria | 3631 |
| 150 | Ga0070699_100576079 | 3300005518 | Bacteria | 1025 |
| 151 | Ga0070679_100008363 | 3300005530 | Bacteria | 9736 |
| 152 | Ga0070679_100111586 | 3300005530 | Bacteria | 2721 |
| 153 | Ga0070697_100003936 | 3300005536 | Bacteria | 11413 |
| 154 | Ga0070697_100036822 | 3300005536 | Bacteria | 3952 |
| 155 | Ga0070697_100063878 | 3300005536 | Bacteria | 3007 |
| 156 | Ga0070697_100094122 | 3300005536 | Bacteria | 2482 |
| 157 | Ga0070697_100101472 | 3300005536 | Bacteria | 2391 |
| 158 | Ga0070697_100182476 | 3300005536 | Bacteria | 1779 |
| 159 | Ga0070697_100213432 | 3300005536 | Bacteria | 1643 |
| 160 | Ga0070697_100259760 | 3300005536 | Bacteria | 1487 |
| 161 | Ga0068853_100014510 | 3300005539 | Bacteria | 6455 |
| 162 | Ga0068853_100019819 | 3300005539 | Bacteria | 5586 |
| 163 | Ga0068853_100167119 | 3300005539 | Bacteria | 1988 |
| 164 | Ga0068853_100234649 | 3300005539 | Bacteria | 1679 |
| 165 | Ga0068853_100695547 | 3300005539 | Bacteria | 969 |
| 166 | Ga0070672_100019003 | 3300005543 | Bacteria | 4980 |
| 167 | Ga0070672_100104518 | 3300005543 | Bacteria | 2301 |
| 168 | Ga0070672_100124054 | 3300005543 | Bacteria | 2117 |
| 169 | Ga0070672_100235441 | 3300005543 | Bacteria | 1539 |
| 170 | Ga0070686_100011130 | 3300005544 | Bacteria | 5096 |
| 171 | Ga0070686_100014560 | 3300005544 | Bacteria | 4538 |
| 172 | Ga0070695_100011147 | 3300005545 | Bacteria | 5374 |
| 173 | Ga0070695_100035049 | 3300005545 | Bacteria | 3151 |
| 174 | Ga0070695_100051867 | 3300005545 | Bacteria | 2634 |
| 175 | Ga0070695_100172942 | 3300005545 | Bacteria | 1525 |
| 176 | Ga0070695_100174986 | 3300005545 | Bacteria | 1517 |
| 177 | Ga0070695_100356052 | 3300005545 | Bacteria | 1098 |
| 178 | Ga0070696_100008944 | 3300005546 | Bacteria | 6701 |
| 179 | Ga0070696_100123279 | 3300005546 | Bacteria | 1878 |
| 180 | Ga0070693_100031294 | 3300005547 | Bacteria | 2914 |
| 181 | Ga0070693_100303516 | 3300005547 | Bacteria | 1077 |
| 182 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 183 | Ga0070665_100149900 | 3300005548 | Bacteria | 2335 |
| 184 | Ga0070704_100031410 | 3300005549 | Bacteria | 3572 |
| 185 | Ga0070704_100098350 | 3300005549 | Bacteria | 2198 |
| 186 | Ga0070704_100288435 | 3300005549 | Bacteria | 1363 |
| 187 | Ga0068855_100000070 | 3300005563 | Bacteria | 123584 |
| 188 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 189 | Ga0068855_100012445 | 3300005563 | Bacteria | 10276 |
| 190 | Ga0068855_100063242 | 3300005563 | Bacteria | 4319 |
| 191 | Ga0068855_100152225 | 3300005563 | Bacteria | 2630 |
| 192 | Ga0068855_100204197 | 3300005563 | Bacteria | 2224 |
| 193 | Ga0068855_100416203 | 3300005563 | Bacteria | 1471 |
| 194 | Ga0070664_100004294 | 3300005564 | Bacteria | 11459 |
| 195 | Ga0070664_100025146 | 3300005564 | Bacteria | 4933 |
| 196 | Ga0070664_100461099 | 3300005564 | Bacteria | 1168 |
| 197 | Ga0070664_100549184 | 3300005564 | Bacteria | 1068 |
| 198 | Ga0068857_100006559 | 3300005577 | Bacteria | 9988 |
| 199 | Ga0068857_100127604 | 3300005577 | Bacteria | 2292 |
| 200 | Ga0068857_100164685 | 3300005577 | Bacteria | 2013 |
| 201 | Ga0068857_100578922 | 3300005577 | Bacteria | 1059 |
| 202 | Ga0068854_100095077 | 3300005578 | Bacteria | 2224 |
| 203 | Ga0068854_100271233 | 3300005578 | Bacteria | 1362 |
| 204 | Ga0068856_100000897 | 3300005614 | Bacteria | 31872 |
| 205 | Ga0068856_100003887 | 3300005614 | Bacteria | 14987 |
| 206 | Ga0068856_100005676 | 3300005614 | Bacteria | 12288 |
| 207 | Ga0068856_100009016 | 3300005614 | Bacteria | 9706 |
| 208 | Ga0068856_100013111 | 3300005614 | Bacteria | 8029 |
| 209 | Ga0068856_100194332 | 3300005614 | Bacteria | 2043 |
| 210 | Ga0070702_100001061 | 3300005615 | Bacteria | 10965 |
| 211 | Ga0070702_100184429 | 3300005615 | Bacteria | 1368 |
| 212 | Ga0070702_100340747 | 3300005615 | Bacteria | 1052 |
| 213 | Ga0068852_100017595 | 3300005616 | Bacteria | 5613 |
| 214 | Ga0068852_100230360 | 3300005616 | Bacteria | 1766 |
| 215 | Ga0068859_100054835 | 3300005617 | Bacteria | 4010 |
| 216 | Ga0068859_100079747 | 3300005617 | Bacteria | 3314 |
| 217 | Ga0068859_100112551 | 3300005617 | Bacteria | 2785 |
| 218 | Ga0068859_100169538 | 3300005617 | Bacteria | 2264 |
| 219 | Ga0068859_100287541 | 3300005617 | Bacteria | 1737 |
| 220 | Ga0068859_100411653 | 3300005617 | Bacteria | 1448 |
| 221 | Ga0068864_100002141 | 3300005618 | Bacteria | 16331 |
| 222 | Ga0068864_100034796 | 3300005618 | Bacteria | 4286 |
| 223 | Ga0068864_100106485 | 3300005618 | Bacteria | 2493 |
| 224 | Ga0068864_100652402 | 3300005618 | Bacteria | 1025 |
| 225 | Ga0068866_10012210 | 3300005718 | Bacteria | 3741 |
| 226 | Ga0068866_10017052 | 3300005718 | Bacteria | 3260 |
| 227 | Ga0068861_100002200 | 3300005719 | Bacteria | 12657 |
| 228 | Ga0068861_100126572 | 3300005719 | Bacteria | 2068 |
| 229 | Ga0068861_100512790 | 3300005719 | Bacteria | 1086 |
| 230 | Ga0068870_10064483 | 3300005840 | Unclassified | 1979 |
| 231 | Ga0068870_10203280 | 3300005840 | Bacteria | 1202 |
| 232 | Ga0068863_100092530 | 3300005841 | Bacteria | 2868 |
| 233 | Ga0068863_100210158 | 3300005841 | Bacteria | 1874 |
| 234 | Ga0068863_100257220 | 3300005841 | Bacteria | 1687 |
| 235 | Ga0068858_100000405 | 3300005842 | Bacteria | 44934 |
| 236 | Ga0068858_100014535 | 3300005842 | Bacteria | 7417 |
| 237 | Ga0068858_100058092 | 3300005842 | Bacteria | 3576 |
| 238 | Ga0068858_100068571 | 3300005842 | Bacteria | 3287 |
| 239 | Ga0068858_100089413 | 3300005842 | Bacteria | 2866 |
| 240 | Ga0068858_100269722 | 3300005842 | Bacteria | 1619 |
| 241 | Ga0068860_100002487 | 3300005843 | Bacteria | 19327 |
| 242 | Ga0068860_100027839 | 3300005843 | Bacteria | 5443 |
| 243 | Ga0068860_100096792 | 3300005843 | Bacteria | 2813 |
| 244 | Ga0068860_100195015 | 3300005843 | Bacteria | 1961 |
| 245 | Ga0068862_100033821 | 3300005844 | Bacteria | 4323 |
| 246 | Ga0068862_100038785 | 3300005844 | Bacteria | 4042 |
| 247 | Ga0068862_100102426 | 3300005844 | Bacteria | 2506 |
| 248 | Ga0081455_10422222 | 3300005937 | Bacteria | 919 |
| 249 | Ga0081540_1097925 | 3300005983 | Bacteria | 1271 |
| 250 | Ga0081539_10000858 | 3300005985 | Bacteria | 58194 |
| 251 | Ga0070715_10000024 | 3300006163 | Bacteria | 110647 |
| 252 | Ga0070716_100015207 | 3300006173 | Bacteria | 3950 |
| 253 | Ga0075366_10001711 | 3300006195 | Bacteria | 11028 |
| 254 | Ga0097621_100000028 | 3300006237 | Bacteria | 71678 |
| 255 | Ga0097621_100003157 | 3300006237 | Bacteria | 11316 |
| 256 | Ga0097621_100006010 | 3300006237 | Bacteria | 8579 |
| 257 | Ga0068871_100006906 | 3300006358 | Bacteria | 8084 |
| 258 | Ga0068871_100024567 | 3300006358 | Bacteria | 4674 |
| 259 | Ga0068871_100037044 | 3300006358 | Bacteria | 3888 |
| 260 | Ga0075430_100014761 | 3300006846 | Bacteria | 6651 |
| 261 | Ga0075430_100017128 | 3300006846 | Bacteria | 6171 |
| 262 | Ga0075430_100066766 | 3300006846 | Bacteria | 3021 |
| 263 | Ga0075430_100088661 | 3300006846 | Bacteria | 2589 |
| 264 | Ga0075431_100095920 | 3300006847 | Bacteria | 3062 |
| 265 | Ga0075431_100166135 | 3300006847 | Bacteria | 2268 |
| 266 | Ga0075433_10015116 | 3300006852 | Bacteria | 6323 |
| 267 | Ga0075433_10021849 | 3300006852 | Bacteria | 5368 |
| 268 | Ga0075433_10049863 | 3300006852 | Bacteria | 3642 |
| 269 | Ga0075433_10282341 | 3300006852 | Bacteria | 1471 |
| 270 | Ga0075433_10366468 | 3300006852 | Bacteria | 1272 |
| 271 | Ga0075434_100000831 | 3300006871 | Bacteria | 24539 |
| 272 | Ga0075434_100010744 | 3300006871 | Bacteria | 8599 |
| 273 | Ga0075434_100147427 | 3300006871 | Bacteria | 2373 |
| 274 | Ga0075434_100160548 | 3300006871 | Bacteria | 2267 |
| 275 | Ga0075434_100706617 | 3300006871 | Bacteria | 1025 |
| 276 | Ga0075429_100011725 | 3300006880 | Bacteria | 7604 |
| 277 | Ga0075429_100018935 | 3300006880 | Bacteria | 5963 |
| 278 | Ga0075429_100031368 | 3300006880 | Bacteria | 4619 |
| 279 | Ga0075429_100092571 | 3300006880 | Bacteria | 2637 |
| 280 | Ga0075429_100234498 | 3300006880 | Bacteria | 1607 |
| 281 | Ga0068865_100000127 | 3300006881 | Bacteria | 39327 |
| 282 | Ga0068865_100032927 | 3300006881 | Bacteria | 3468 |
| 283 | Ga0068865_100071929 | 3300006881 | Bacteria | 2455 |
| 284 | Ga0068865_100305617 | 3300006881 | Bacteria | 1274 |
| 285 | Ga0075436_100000020 | 3300006914 | Bacteria | 124822 |
| 286 | Ga0075436_100327712 | 3300006914 | Bacteria | 1101 |
| 287 | Ga0075436_100389832 | 3300006914 | Bacteria | 1008 |
| 288 | Ga0097620_100011064 | 3300006931 | Bacteria | 9075 |
| 289 | Ga0097620_100054836 | 3300006931 | Bacteria | 4010 |
| 290 | Ga0097620_100079748 | 3300006931 | Bacteria | 3314 |
| 291 | Ga0097620_100112549 | 3300006931 | Bacteria | 2785 |
| 292 | Ga0097620_100169531 | 3300006931 | Bacteria | 2264 |
| 293 | Ga0097620_100287541 | 3300006931 | Bacteria | 1737 |
| 294 | Ga0097620_100411662 | 3300006931 | Bacteria | 1448 |
| 295 | Ga0075435_100000165 | 3300007076 | Bacteria | 38337 |
| 296 | Ga0075435_100032986 | 3300007076 | Bacteria | 4092 |
| 297 | Ga0075435_100095774 | 3300007076 | Bacteria | 2455 |
| 298 | Ga0075435_100281110 | 3300007076 | Bacteria | 1421 |
| 299 | Ga0099794_10001218 | 3300007265 | Bacteria | 8883 |
| 300 | Ga0105251_10061955 | 3300009011 | Bacteria | 1758 |
| 301 | Ga0105251_10116981 | 3300009011 | Bacteria | 1212 |
| 302 | Ga0105240_10000237 | 3300009093 | Bacteria | 109895 |
| 303 | Ga0105240_10014965 | 3300009093 | Bacteria | 10571 |
| 304 | Ga0105240_10020594 | 3300009093 | Bacteria | 8792 |
| 305 | Ga0105240_10048025 | 3300009093 | Bacteria | 5397 |
| 306 | Ga0105240_10187598 | 3300009093 | Bacteria | 2434 |
| 307 | Ga0105240_10227132 | 3300009093 | Bacteria | 2171 |
| 308 | Ga0105240_10365364 | 3300009093 | Bacteria | 1633 |
| 309 | Ga0105240_11082324 | 3300009093 | Bacteria | 854 |
| 310 | Ga0111539_10079406 | 3300009094 | Bacteria | 3860 |
| 311 | Ga0111539_10211199 | 3300009094 | Bacteria | 2261 |
| 312 | Ga0105245_10243938 | 3300009098 | Bacteria | 1743 |
| 313 | Ga0105245_10607140 | 3300009098 | Bacteria | 1121 |
| 314 | Ga0105247_10000153 | 3300009101 | Bacteria | 67393 |
| 315 | Ga0105247_10005769 | 3300009101 | Bacteria | 7752 |
| 316 | Ga0105247_10009777 | 3300009101 | Bacteria | 5813 |
| 317 | Ga0114129_10007783 | 3300009147 | Bacteria | 15246 |
| 318 | Ga0114129_10018669 | 3300009147 | Bacteria | 9874 |
| 319 | Ga0114129_10213288 | 3300009147 | Bacteria | 2609 |
| 320 | Ga0114129_10654159 | 3300009147 | Bacteria | 1356 |
| 321 | Ga0114129_10843987 | 3300009147 | Bacteria | 1165 |
| 322 | Ga0105243_10000785 | 3300009148 | Bacteria | 30459 |
| 323 | Ga0105243_10080793 | 3300009148 | Bacteria | 2652 |
| 324 | Ga0105243_10133231 | 3300009148 | Bacteria | 2111 |
| 325 | Ga0105243_10189222 | 3300009148 | Bacteria | 1796 |
| 326 | Ga0105243_10298058 | 3300009148 | Bacteria | 1460 |
| 327 | Ga0105241_10535967 | 3300009174 | Bacteria | 1049 |
| 328 | Ga0105242_10001383 | 3300009176 | Bacteria | 19124 |
| 329 | Ga0105242_10029494 | 3300009176 | Bacteria | 4376 |
| 330 | Ga0105242_10187229 | 3300009176 | Bacteria | 1830 |
| 331 | Ga0105242_10256131 | 3300009176 | Bacteria | 1579 |
| 332 | Ga0105248_10015522 | 3300009177 | Bacteria | 8397 |
| 333 | Ga0105248_10015913 | 3300009177 | Bacteria | 8284 |
| 334 | Ga0105248_10165246 | 3300009177 | Bacteria | 2495 |
| 335 | Ga0105237_10000224 | 3300009545 | Bacteria | 79854 |
| 336 | Ga0105237_10001308 | 3300009545 | Bacteria | 33108 |
| 337 | Ga0105237_10037976 | 3300009545 | Bacteria | 4865 |
| 338 | Ga0105237_10041051 | 3300009545 | Bacteria | 4667 |
| 339 | Ga0105237_10065000 | 3300009545 | Bacteria | 3644 |
| 340 | Ga0105237_10093882 | 3300009545 | Bacteria | 2989 |
| 341 | Ga0105237_10279937 | 3300009545 | Bacteria | 1671 |
| 342 | Ga0105237_10385476 | 3300009545 | Bacteria | 1406 |
| 343 | Ga0105237_10411591 | 3300009545 | Bacteria | 1357 |
| 344 | Ga0105237_10442625 | 3300009545 | Bacteria | 1305 |
| 345 | Ga0105237_10553924 | 3300009545 | Bacteria | 1156 |
| 346 | Ga0105238_10133400 | 3300009551 | Bacteria | 2461 |
| 347 | Ga0105238_11076560 | 3300009551 | Bacteria | 826 |
| 348 | Ga0105249_10013986 | 3300009553 | Bacteria | 7094 |
| 349 | Ga0105249_10063134 | 3300009553 | Bacteria | 3402 |
| 350 | Ga0105249_10087773 | 3300009553 | Bacteria | 2903 |
| 351 | Ga0105249_10237828 | 3300009553 | Bacteria | 1799 |
| 352 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 353 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 354 | Ga0105239_10004436 | 3300010375 | Bacteria | 16776 |
| 355 | Ga0105239_10005560 | 3300010375 | Bacteria | 14739 |
| 356 | Ga0105239_10012917 | 3300010375 | Bacteria | 9289 |
| 357 | Ga0105239_10013753 | 3300010375 | Bacteria | 8983 |
| 358 | Ga0105239_10023687 | 3300010375 | Bacteria | 6759 |
| 359 | Ga0105239_10025250 | 3300010375 | Bacteria | 6543 |
| 360 | Ga0105239_10146195 | 3300010375 | Bacteria | 2636 |
| 361 | Ga0105239_10826509 | 3300010375 | Bacteria | 1062 |
| 362 | Ga0105246_10039466 | 3300011119 | Bacteria | 3181 |
| 363 | Ga0105246_10172179 | 3300011119 | Bacteria | 1659 |
| 364 | Ga0157373_10000208 | 3300013100 | Bacteria | 48082 |
| 365 | Ga0157373_10076454 | 3300013100 | Bacteria | 2362 |
| 366 | Ga0157373_10170348 | 3300013100 | Bacteria | 1532 |
| 367 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 368 | Ga0157370_10095584 | 3300013104 | Bacteria | 2788 |
| 369 | Ga0157369_10617552 | 3300013105 | Bacteria | 1119 |
| 370 | Ga0157374_10001845 | 3300013296 | Bacteria | 17834 |
| 371 | Ga0157374_10044113 | 3300013296 | Bacteria | 4121 |
| 372 | Ga0157374_10155428 | 3300013296 | Bacteria | 2226 |
| 373 | Ga0157374_10357088 | 3300013296 | Bacteria | 1453 |
| 374 | Ga0157378_10000002 | 3300013297 | Bacteria | 222652 |
| 375 | Ga0157378_10009280 | 3300013297 | Bacteria | 8570 |
| 376 | Ga0157378_10010199 | 3300013297 | Bacteria | 8198 |
| 377 | Ga0157378_10039044 | 3300013297 | Bacteria | 4210 |
| 378 | Ga0157378_10043262 | 3300013297 | Bacteria | 3999 |
| 379 | Ga0157378_10046779 | 3300013297 | Bacteria | 3845 |
| 380 | Ga0157378_10235654 | 3300013297 | Bacteria | 1746 |
| 381 | Ga0157378_10322829 | 3300013297 | Bacteria | 1500 |
| 382 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 383 | Ga0163162_10003107 | 3300013306 | Bacteria | 15857 |
| 384 | Ga0163162_10005005 | 3300013306 | Bacteria | 12766 |
| 385 | Ga0163162_10010070 | 3300013306 | Bacteria | 9190 |
| 386 | Ga0163162_10013931 | 3300013306 | Bacteria | 7855 |
| 387 | Ga0163162_10016331 | 3300013306 | Bacteria | 7257 |
| 388 | Ga0163162_10033657 | 3300013306 | Bacteria | 5093 |
| 389 | Ga0163162_10064255 | 3300013306 | Bacteria | 3715 |
| 390 | Ga0163162_10110885 | 3300013306 | Bacteria | 2841 |
| 391 | Ga0163162_10610738 | 3300013306 | Bacteria | 1216 |
| 392 | Ga0163162_10727211 | 3300013306 | Bacteria | 1113 |
| 393 | Ga0157372_10000050 | 3300013307 | Bacteria | 140381 |
| 394 | Ga0157372_10000635 | 3300013307 | Bacteria | 38523 |
| 395 | Ga0157372_10001419 | 3300013307 | Bacteria | 25842 |
| 396 | Ga0157372_10002231 | 3300013307 | Bacteria | 21022 |
| 397 | Ga0157372_10189979 | 3300013307 | Bacteria | 2379 |
| 398 | Ga0157372_10403929 | 3300013307 | Bacteria | 1592 |
| 399 | Ga0157375_10007015 | 3300013308 | Bacteria | 9838 |
| 400 | Ga0157375_10021385 | 3300013308 | Bacteria | 5930 |
| 401 | Ga0157375_10055045 | 3300013308 | Bacteria | 3921 |
| 402 | Ga0157375_11236598 | 3300013308 | Bacteria | 877 |
| 403 | Ga0163163_10002079 | 3300014325 | Bacteria | 16899 |
| 404 | Ga0163163_10004729 | 3300014325 | Bacteria | 11666 |
| 405 | Ga0163163_10014695 | 3300014325 | Bacteria | 7200 |
| 406 | Ga0163163_10018317 | 3300014325 | Bacteria | 6552 |
| 407 | Ga0163163_10215737 | 3300014325 | Bacteria | 1968 |
| 408 | Ga0157380_10001101 | 3300014326 | Bacteria | 17410 |
| 409 | Ga0157380_10012995 | 3300014326 | Bacteria | 6054 |
| 410 | Ga0157380_10027529 | 3300014326 | Bacteria | 4324 |
| 411 | Ga0157380_10093550 | 3300014326 | Bacteria | 2486 |
| 412 | Ga0157380_10534322 | 3300014326 | Bacteria | 1147 |
| 413 | Ga0157380_10925475 | 3300014326 | Bacteria | 900 |
| 414 | Ga0157380_11116714 | 3300014326 | Bacteria | 828 |
| 415 | Ga0157379_10047882 | 3300014968 | Bacteria | 3815 |
| 416 | Ga0157379_10059280 | 3300014968 | Bacteria | 3422 |
| 417 | Ga0157376_10027794 | 3300014969 | Bacteria | 4489 |
| 418 | Ga0182006_1091847 | 3300015261 | Bacteria | 1091 |
| 419 | Ga0163161_10027541 | 3300017792 | Bacteria | 4032 |
| 420 | Ga0207672_1000067 | 3300025223 | Bacteria | 14045 |
| 421 | Ga0207427_100172 | 3300025231 | Bacteria | 71550 |
| 422 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 423 | Ga0209437_100221 | 3300025233 | Bacteria | 104135 |
| 424 | Ga0209026_1000728 | 3300025250 | Bacteria | 19168 |
| 425 | Ga0209026_1003634 | 3300025250 | Bacteria | 4952 |
| 426 | Ga0209026_1015127 | 3300025250 | Bacteria | 1272 |
| 427 | Ga0209148_1017175 | 3300025254 | Bacteria | 1232 |
| 428 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 429 | Ga0209233_1001428 | 3300025261 | Bacteria | 9422 |
| 430 | Ga0209233_1013109 | 3300025261 | Bacteria | 2377 |
| 431 | Ga0209233_1019675 | 3300025261 | Bacteria | 1789 |
| 432 | Ga0209455_1000861 | 3300025272 | Bacteria | 16150 |
| 433 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 434 | Ga0207710_10000702 | 3300025900 | Bacteria | 18777 |
| 435 | Ga0207710_10071792 | 3300025900 | Bacteria | 1589 |
| 436 | Ga0207688_10102635 | 3300025901 | Bacteria | 1653 |
| 437 | Ga0207647_10000076 | 3300025904 | Bacteria | 75824 |
| 438 | Ga0207647_10002660 | 3300025904 | Bacteria | 13488 |
| 439 | Ga0207647_10101115 | 3300025904 | Bacteria | 1710 |
| 440 | Ga0207647_10150889 | 3300025904 | Bacteria | 1358 |
| 441 | Ga0207685_10000018 | 3300025905 | Bacteria | 145715 |
| 442 | Ga0207645_10017477 | 3300025907 | Bacteria | 4734 |
| 443 | Ga0207645_10087794 | 3300025907 | Bacteria | 1998 |
| 444 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 445 | Ga0207684_10000150 | 3300025910 | Bacteria | 121849 |
| 446 | Ga0207684_10004744 | 3300025910 | Bacteria | 12740 |
| 447 | Ga0207684_10007514 | 3300025910 | Bacteria | 9807 |
| 448 | Ga0207684_10017828 | 3300025910 | Bacteria | 6088 |
| 449 | Ga0207684_10022905 | 3300025910 | Bacteria | 5334 |
| 450 | Ga0207684_10121834 | 3300025910 | Bacteria | 2236 |
| 451 | Ga0207684_10297695 | 3300025910 | Bacteria | 1391 |
| 452 | Ga0207684_10361659 | 3300025910 | Bacteria | 1249 |
| 453 | Ga0207654_10103132 | 3300025911 | Bacteria | 1761 |
| 454 | Ga0207654_10118633 | 3300025911 | Bacteria | 1657 |
| 455 | Ga0207654_10425683 | 3300025911 | Bacteria | 927 |
| 456 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 457 | Ga0207707_10030350 | 3300025912 | Bacteria | 4729 |
| 458 | Ga0207707_10268130 | 3300025912 | Bacteria | 1480 |
| 459 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 460 | Ga0207695_10004656 | 3300025913 | Bacteria | 18589 |
| 461 | Ga0207695_10016549 | 3300025913 | Bacteria | 8620 |
| 462 | Ga0207695_10033191 | 3300025913 | Bacteria | 5637 |
| 463 | Ga0207695_10058909 | 3300025913 | Bacteria | 3985 |
| 464 | Ga0207695_10318305 | 3300025913 | Bacteria | 1445 |
| 465 | Ga0207671_10002707 | 3300025914 | Bacteria | 18581 |
| 466 | Ga0207671_10011004 | 3300025914 | Bacteria | 7407 |
| 467 | Ga0207671_10011316 | 3300025914 | Bacteria | 7272 |
| 468 | Ga0207671_10024807 | 3300025914 | Bacteria | 4506 |
| 469 | Ga0207671_10037577 | 3300025914 | Bacteria | 3590 |
| 470 | Ga0207660_10000805 | 3300025917 | Bacteria | 20711 |
| 471 | Ga0207660_10032391 | 3300025917 | Bacteria | 3608 |
| 472 | Ga0207660_10119374 | 3300025917 | Bacteria | 1995 |
| 473 | Ga0207662_10106779 | 3300025918 | Bacteria | 1742 |
| 474 | Ga0207662_10253872 | 3300025918 | Bacteria | 1155 |
| 475 | Ga0207662_10305117 | 3300025918 | Bacteria | 1059 |
| 476 | Ga0207657_10020956 | 3300025919 | Bacteria | 6166 |
| 477 | Ga0207649_10034440 | 3300025920 | Bacteria | 3034 |
| 478 | Ga0207649_10177370 | 3300025920 | Bacteria | 1489 |
| 479 | Ga0207652_10000693 | 3300025921 | Bacteria | 32703 |
| 480 | Ga0207652_10298145 | 3300025921 | Bacteria | 1455 |
| 481 | Ga0207646_10004823 | 3300025922 | Bacteria | 14455 |
| 482 | Ga0207646_10026415 | 3300025922 | Bacteria | 5298 |
| 483 | Ga0207646_10073942 | 3300025922 | Bacteria | 3045 |
| 484 | Ga0207646_10298506 | 3300025922 | Bacteria | 1455 |
| 485 | Ga0207681_10012288 | 3300025923 | Bacteria | 5281 |
| 486 | Ga0207681_10264841 | 3300025923 | Bacteria | 1347 |
| 487 | Ga0207694_10049255 | 3300025924 | Bacteria | 3261 |
| 488 | Ga0207694_10146670 | 3300025924 | Bacteria | 1900 |
| 489 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 490 | Ga0207650_10002299 | 3300025925 | Bacteria | 13320 |
| 491 | Ga0207659_10013295 | 3300025926 | Bacteria | 5266 |
| 492 | Ga0207644_10000882 | 3300025931 | Bacteria | 18926 |
| 493 | Ga0207644_10062324 | 3300025931 | Bacteria | 2704 |
| 494 | Ga0207644_10073528 | 3300025931 | Bacteria | 2507 |
| 495 | Ga0207644_10096507 | 3300025931 | Bacteria | 2213 |
| 496 | Ga0207644_10263654 | 3300025931 | Bacteria | 1378 |
| 497 | Ga0207644_10425065 | 3300025931 | Bacteria | 1089 |
| 498 | Ga0207690_10011536 | 3300025932 | Bacteria | 5278 |
| 499 | Ga0207690_10015769 | 3300025932 | Bacteria | 4586 |
| 500 | Ga0207706_10006487 | 3300025933 | Bacteria | 10861 |
| 501 | Ga0207706_10178930 | 3300025933 | Bacteria | 1863 |
| 502 | Ga0207686_10000952 | 3300025934 | Bacteria | 17283 |
| 503 | Ga0207709_10000524 | 3300025935 | Bacteria | 33443 |
| 504 | Ga0207709_10002326 | 3300025935 | Bacteria | 12000 |
| 505 | Ga0207709_10036889 | 3300025935 | Bacteria | 2900 |
| 506 | Ga0207709_10264132 | 3300025935 | Bacteria | 1264 |
| 507 | Ga0207670_10000065 | 3300025936 | Bacteria | 75480 |
| 508 | Ga0207670_10035418 | 3300025936 | Bacteria | 3236 |
| 509 | Ga0207704_10000044 | 3300025938 | Bacteria | 86753 |
| 510 | Ga0207704_10013016 | 3300025938 | Bacteria | 4148 |
| 511 | Ga0207704_10101785 | 3300025938 | Bacteria | 1917 |
| 512 | Ga0207704_10211159 | 3300025938 | Bacteria | 1429 |
| 513 | Ga0207691_10005500 | 3300025940 | Bacteria | 12241 |
| 514 | Ga0207691_10056180 | 3300025940 | Bacteria | 3587 |
| 515 | Ga0207691_10237566 | 3300025940 | Bacteria | 1576 |
| 516 | Ga0207691_10265208 | 3300025940 | Bacteria | 1480 |
| 517 | Ga0207711_10013164 | 3300025941 | Bacteria | 6870 |
| 518 | Ga0207711_10018170 | 3300025941 | Bacteria | 5845 |
| 519 | Ga0207689_10009519 | 3300025942 | Bacteria | 8385 |
| 520 | Ga0207689_10024086 | 3300025942 | Bacteria | 5106 |
| 521 | Ga0207689_10026884 | 3300025942 | Bacteria | 4816 |
| 522 | Ga0207689_10041222 | 3300025942 | Bacteria | 3820 |
| 523 | Ga0207689_10041530 | 3300025942 | Bacteria | 3806 |
| 524 | Ga0207689_10064294 | 3300025942 | Bacteria | 3019 |
| 525 | Ga0207689_10066062 | 3300025942 | Bacteria | 2975 |
| 526 | Ga0207689_10270225 | 3300025942 | Bacteria | 1407 |
| 527 | Ga0207689_10380763 | 3300025942 | Bacteria | 1175 |
| 528 | Ga0207679_10001977 | 3300025945 | Bacteria | 12712 |
| 529 | Ga0207679_10025207 | 3300025945 | Bacteria | 4087 |
| 530 | Ga0207679_10414295 | 3300025945 | Bacteria | 1188 |
| 531 | Ga0207679_10547559 | 3300025945 | Bacteria | 1038 |
| 532 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 533 | Ga0207667_10000971 | 3300025949 | Bacteria | 36600 |
| 534 | Ga0207667_10051802 | 3300025949 | Bacteria | 4326 |
| 535 | Ga0207667_10085702 | 3300025949 | Bacteria | 3261 |
| 536 | Ga0207667_10205066 | 3300025949 | Bacteria | 2022 |
| 537 | Ga0207667_10553159 | 3300025949 | Bacteria | 1164 |
| 538 | Ga0207667_10758902 | 3300025949 | Bacteria | 969 |
| 539 | Ga0207651_10016587 | 3300025960 | Bacteria | 4321 |
| 540 | Ga0207651_10018113 | 3300025960 | Bacteria | 4182 |
| 541 | Ga0207651_10030254 | 3300025960 | Bacteria | 3445 |
| 542 | Ga0207651_10042500 | 3300025960 | Bacteria | 3026 |
| 543 | Ga0207651_10095736 | 3300025960 | Bacteria | 2187 |
| 544 | Ga0207651_10104905 | 3300025960 | Bacteria | 2107 |
| 545 | Ga0207651_10397315 | 3300025960 | Bacteria | 1172 |
| 546 | Ga0207712_10027437 | 3300025961 | Bacteria | 3802 |
| 547 | Ga0207712_10075328 | 3300025961 | Bacteria | 2439 |
| 548 | Ga0207712_10142459 | 3300025961 | Bacteria | 1841 |
| 549 | Ga0207712_10476213 | 3300025961 | Bacteria | 1063 |
| 550 | Ga0207668_10338072 | 3300025972 | Bacteria | 1255 |
| 551 | Ga0207640_10177008 | 3300025981 | Bacteria | 1596 |
| 552 | Ga0207640_10267992 | 3300025981 | Bacteria | 1334 |
| 553 | Ga0207658_10101237 | 3300025986 | Bacteria | 2257 |
| 554 | Ga0207658_10234206 | 3300025986 | Bacteria | 1552 |
| 555 | Ga0207677_10089034 | 3300026023 | Bacteria | 2240 |
| 556 | Ga0207677_10104836 | 3300026023 | Bacteria | 2091 |
| 557 | Ga0207703_10000045 | 3300026035 | Bacteria | 156669 |
| 558 | Ga0207703_10097306 | 3300026035 | Bacteria | 2486 |
| 559 | Ga0207703_10102201 | 3300026035 | Bacteria | 2432 |
| 560 | Ga0207703_10424570 | 3300026035 | Bacteria | 1238 |
| 561 | Ga0207639_10004531 | 3300026041 | Bacteria | 9364 |
| 562 | Ga0207639_10015887 | 3300026041 | Bacteria | 5316 |
| 563 | Ga0207639_10018588 | 3300026041 | Bacteria | 4943 |
| 564 | Ga0207639_10547352 | 3300026041 | Bacteria | 1062 |
| 565 | Ga0207678_10021588 | 3300026067 | Bacteria | 5646 |
| 566 | Ga0207708_10003530 | 3300026075 | Bacteria | 11518 |
| 567 | Ga0207708_10039998 | 3300026075 | Bacteria | 3574 |
| 568 | Ga0207708_10184541 | 3300026075 | Bacteria | 1657 |
| 569 | Ga0207708_10664032 | 3300026075 | Bacteria | 888 |
| 570 | Ga0207702_10000507 | 3300026078 | Bacteria | 43964 |
| 571 | Ga0207702_10005892 | 3300026078 | Bacteria | 10658 |
| 572 | Ga0207702_10011829 | 3300026078 | Bacteria | 7263 |
| 573 | Ga0207702_10038199 | 3300026078 | Bacteria | 4021 |
| 574 | Ga0207702_10056941 | 3300026078 | Bacteria | 3320 |
| 575 | Ga0207702_10499778 | 3300026078 | Bacteria | 1185 |
| 576 | Ga0207641_10073847 | 3300026088 | Bacteria | 2940 |
| 577 | Ga0207641_10175600 | 3300026088 | Bacteria | 1959 |
| 578 | Ga0207641_10669928 | 3300026088 | Bacteria | 1020 |
| 579 | Ga0207648_10000529 | 3300026089 | Bacteria | 42805 |
| 580 | Ga0207648_10228044 | 3300026089 | Bacteria | 1656 |
| 581 | Ga0207648_10308551 | 3300026089 | Bacteria | 1420 |
| 582 | Ga0207648_10317344 | 3300026089 | Bacteria | 1400 |
| 583 | Ga0207676_10085282 | 3300026095 | Bacteria | 2577 |
| 584 | Ga0207676_10090487 | 3300026095 | Bacteria | 2511 |
| 585 | Ga0207676_10710559 | 3300026095 | Bacteria | 974 |
| 586 | Ga0207676_10833183 | 3300026095 | Bacteria | 901 |
| 587 | Ga0207674_10020588 | 3300026116 | Bacteria | 7123 |
| 588 | Ga0207674_10123397 | 3300026116 | Bacteria | 2556 |
| 589 | Ga0207674_10145605 | 3300026116 | Bacteria | 2328 |
| 590 | Ga0207674_10483995 | 3300026116 | Bacteria | 1196 |
| 591 | Ga0207675_100000849 | 3300026118 | Bacteria | 30412 |
| 592 | Ga0207675_100004603 | 3300026118 | Bacteria | 13293 |
| 593 | Ga0207675_100144676 | 3300026118 | Bacteria | 2260 |
| 594 | Ga0207675_100184473 | 3300026118 | Bacteria | 1999 |
| 595 | Ga0207675_100484499 | 3300026118 | Bacteria | 1230 |
| 596 | Ga0207683_10031312 | 3300026121 | Bacteria | 4616 |
| 597 | Ga0207683_10273793 | 3300026121 | Bacteria | 1542 |
| 598 | Ga0207698_10005251 | 3300026142 | Bacteria | 7971 |
| 599 | Ga0207698_10117485 | 3300026142 | Bacteria | 2244 |
| 600 | Ga0209588_1010709 | 3300027671 | Bacteria | 2761 |
| 601 | Ga0209974_10003508 | 3300027876 | Bacteria | 5647 |
| 602 | Ga0207428_10001623 | 3300027907 | Bacteria | 23347 |
| 603 | Ga0207428_10117762 | 3300027907 | Bacteria | 2039 |
| 604 | Ga0207428_10135769 | 3300027907 | Bacteria | 1880 |
| 605 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 606 | Ga0268266_10088905 | 3300028379 | Bacteria | 2704 |
| 607 | Ga0268265_10018602 | 3300028380 | Bacteria | 4818 |
| 608 | Ga0268265_10026095 | 3300028380 | Bacteria | 4153 |
| 609 | Ga0268265_10026318 | 3300028380 | Bacteria | 4138 |
| 610 | Ga0268265_10355986 | 3300028380 | Bacteria | 1338 |
| 611 | Ga0268264_10007034 | 3300028381 | Bacteria | 9436 |
| 612 | Ga0268264_10069792 | 3300028381 | Bacteria | 2973 |
| 613 | Ga0268264_10080774 | 3300028381 | Bacteria | 2777 |
| 614 | Ga0268264_10128605 | 3300028381 | Bacteria | 2242 |
| 615 | Ga0307517_10003551 | 3300028786 | Bacteria | 24219 |
| 616 | Ga0307515_10001481 | 3300028794 | Bacteria | 52778 |
| 617 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 618 | Ga0307515_10100898 | 3300028794 | Bacteria | 3490 |
| 619 | Ga0265338_10015871 | 3300028800 | Bacteria | 8244 |
| 620 | Ga0316177_1009900 | 3300030731 | Bacteria | 5129 |
| 621 | Ga0316176_1141979 | 3300030732 | Bacteria | 21893 |
| 622 | Ga0316183_1118483 | 3300030742 | Bacteria | 38677 |
| 623 | Ga0316181_1033622 | 3300030744 | Bacteria | 4944 |
| 624 | Ga0265339_10084041 | 3300031249 | Bacteria | 1678 |
| 625 | Ga0265331_10075889 | 3300031250 | Bacteria | 1567 |
| 626 | Ga0265316_10220112 | 3300031344 | Bacteria | 1401 |
| 627 | Ga0307408_100016223 | 3300031548 | Bacteria | 4967 |
| 628 | Ga0307408_100058015 | 3300031548 | Bacteria | 2813 |
| 629 | Ga0307408_100149571 | 3300031548 | Bacteria | 1842 |
| 630 | Ga0316579_10043400 | 3300031691 | Bacteria | 2092 |
| 631 | Ga0316576_10127932 | 3300031727 | Bacteria | 1910 |
| 632 | Ga0307405_10001983 | 3300031731 | Bacteria | 8851 |
| 633 | Ga0307405_10058440 | 3300031731 | Bacteria | 2427 |
| 634 | Ga0307413_10001627 | 3300031824 | Bacteria | 8700 |
| 635 | Ga0307413_10036294 | 3300031824 | Bacteria | 2836 |
| 636 | Ga0307410_10002169 | 3300031852 | Bacteria | 9326 |
| 637 | Ga0307410_10390195 | 3300031852 | Bacteria | 1122 |
| 638 | Ga0307410_10435734 | 3300031852 | Bacteria | 1066 |
| 639 | Ga0307406_10042010 | 3300031901 | Bacteria | 2853 |
| 640 | Ga0307406_10091712 | 3300031901 | Bacteria | 2047 |
| 641 | Ga0307406_10441028 | 3300031901 | Bacteria | 1042 |
| 642 | Ga0307407_10067696 | 3300031903 | Bacteria | 2112 |
| 643 | Ga0307412_10045347 | 3300031911 | Bacteria | 2873 |
| 644 | Ga0307412_10052264 | 3300031911 | Bacteria | 2705 |
| 645 | Ga0307412_10077908 | 3300031911 | Bacteria | 2281 |
| 646 | Ga0307412_10284247 | 3300031911 | Bacteria | 1300 |
| 647 | Ga0307412_10406460 | 3300031911 | Bacteria | 1110 |
| 648 | Ga0307409_100007363 | 3300031995 | Bacteria | 6576 |
| 649 | Ga0307409_100056497 | 3300031995 | Bacteria | 3036 |
| 650 | Ga0307409_100817175 | 3300031995 | Bacteria | 941 |
| 651 | Ga0307416_100001756 | 3300032002 | Bacteria | 12005 |
| 652 | Ga0307416_100013314 | 3300032002 | Bacteria | 5587 |
| 653 | Ga0307416_100042843 | 3300032002 | Bacteria | 3538 |
| 654 | Ga0307414_10041283 | 3300032004 | Bacteria | 3124 |
| 655 | Ga0307411_10000610 | 3300032005 | Bacteria | 12858 |
| 656 | Ga0307411_10121123 | 3300032005 | Bacteria | 1893 |
| 657 | Ga0307411_10256934 | 3300032005 | Bacteria | 1377 |
| 658 | Ga0307415_100051090 | 3300032126 | Bacteria | 2804 |
| 659 | Ga0307415_100117087 | 3300032126 | Bacteria | 1989 |
| 660 | Ga0307415_100151684 | 3300032126 | Bacteria | 1784 |
| 661 | Ga0307415_100405665 | 3300032126 | Bacteria | 1165 |
| 662 | Ga0316585_10039603 | 3300032137 | Bacteria | 1499 |
| 663 | Ga0316580_10007805 | 3300032139 | Bacteria | 3194 |
| 664 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 665 | Ga0373940_0085463 | 3300035088 | Bacteria | 939 |
| 666 | Ga0373951_0004432 | 3300035091 | Bacteria | 3336 |
| 667 | Ga0373941_0107012 | 3300035115 | Bacteria | 981 |
| 668 | Ga0373942_0019143 | 3300035207 | Bacteria | 1706 |
| 669 | Ga0373962_0030121 | 3300035242 | Bacteria | 1483 |
| 670 | Ga0373937_0110636 | 3300036401 | Bacteria | 2555 |
| 671 | Ga0373937_0273069 | 3300036401 | Bacteria | 1596 |
| 672 | Ga0373937_0498038 | 3300036401 | Bacteria | 1158 |
| 673 | Ga0316582_0022813 | 3300036647 | Bacteria | 3722 |
| 674 | Ga0316584_0052688 | 3300036712 | Bacteria | 3043 |
| 675 | Ga0316584_0057497 | 3300036712 | Bacteria | 2911 |
| 676 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 677 | Ga0395899_0000659 | 3300037312 | Bacteria | 35170 |
| 678 | Ga0395899_0001109 | 3300037312 | Bacteria | 24123 |
| 679 | Ga0395899_0021085 | 3300037312 | Bacteria | 4942 |
| 680 | Ga0395900_0000277 | 3300037418 | Bacteria | 77256 |
| 681 | Ga0395900_0001234 | 3300037418 | Bacteria | 31453 |
| 682 | Ga0395900_0019640 | 3300037418 | Bacteria | 6889 |
| 683 | Ga0395900_0127856 | 3300037418 | Bacteria | 2605 |
| 684 | Ga0395898_0001918 | 3300037466 | Bacteria | 26473 |
| 685 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 686 | Ga0395905_0000348 | 3300037471 | Bacteria | 65915 |
| 687 | Ga0395905_0004443 | 3300037471 | Bacteria | 14577 |
| 688 | Ga0395901_0000199 | 3300038443 | Bacteria | 76415 |
| 689 | Ga0395901_0005268 | 3300038443 | Bacteria | 13060 |
| 690 | Ga0395901_0140444 | 3300038443 | Bacteria | 2539 |
| 691 | Ga0395901_0173777 | 3300038443 | Bacteria | 2260 |
| 692 | Ga0242420_003202 | 3300038996 | Bacteria | 2411 |
| 693 | Ga0242420_011217 | 3300038996 | Bacteria | 1499 |
| 694 | Ga0436365_0065130 | 3300039437 | Bacteria | 167769 |
| 695 | Ga0436361_0742208 | 3300039447 | Bacteria | 6052 |
| 696 | Ga0439448_0020387 | 3300042005 | Bacteria | 2050 |
| 697 | Ga0439464_0003170 | 3300042439 | Bacteria | 4124 |
| 698 | Ga0439460_0036907 | 3300042461 | Bacteria | 1420 |
| 699 | Ga0451577_0000034 | 3300042876 | Bacteria | 376183 |
| 700 | Ga0451577_0003212 | 3300042876 | Bacteria | 18354 |
| 701 | Ga0451577_0025370 | 3300042876 | Bacteria | 5378 |
| 702 | Ga0451577_0132698 | 3300042876 | Bacteria | 2235 |
| 703 | Ga0466969_0032580 | 3300044656 | Bacteria | 2649 |
| 704 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 705 | Ga0453683_0000122 | 3300044673 | Bacteria | 116184 |
| 706 | Ga0453683_0004573 | 3300044673 | Bacteria | 9780 |
| 707 | Ga0453683_0127057 | 3300044673 | Bacteria | 1605 |
| 708 | Ga0453683_0156419 | 3300044673 | Bacteria | 1441 |
| 709 | Ga0466966_0016086 | 3300044684 | Bacteria | 4946 |
| 710 | Ga0466961_0102343 | 3300044693 | Bacteria | 1804 |
| 711 | Ga0453684_0000098 | 3300044712 | Bacteria | 376183 |
| 712 | Ga0453684_0000467 | 3300044712 | Bacteria | 161003 |
| 713 | Ga0453684_0000603 | 3300044712 | Bacteria | 132340 |
| 714 | Ga0453684_0001278 | 3300044712 | Bacteria | 75250 |
| 715 | Ga0453684_0065621 | 3300044712 | Bacteria | 4628 |
| 716 | Ga0453684_0268672 | 3300044712 | Bacteria | 1950 |
| 717 | Ga0466968_0072467 | 3300044735 | Bacteria | 1502 |
| 718 | Ga0451576_0000036 | 3300045051 | Bacteria | 376183 |
| 719 | Ga0451576_0000397 | 3300045051 | Bacteria | 101182 |
| 720 | Ga0451576_0005569 | 3300045051 | Bacteria | 15735 |
| 721 | Ga0451576_0023567 | 3300045051 | Bacteria | 6663 |
| 722 | Ga0451576_0046399 | 3300045051 | Bacteria | 4575 |
| 723 | Ga0451576_0114207 | 3300045051 | Bacteria | 2811 |
| 724 | Ga0466967_0097786 | 3300045976 | Bacteria | 2679 |
| 725 | Ga0495603_0042271 | 3300046455 | Bacteria | 2725 |
| 726 | Ga0495629_0126159 | 3300046459 | Bacteria | 1783 |
| 727 | Ga0495638_0102196 | 3300046460 | Bacteria | 1713 |
| 728 | Ga0495638_0235657 | 3300046460 | Bacteria | 1016 |
| 729 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 730 | Ga0495580_0378928 | 3300046472 | Bacteria | 956 |
| 731 | Ga0495582_0004387 | 3300046473 | Bacteria | 7935 |
| 732 | Ga0495664_0059927 | 3300046477 | Bacteria | 2266 |
| 733 | Ga0495584_0088190 | 3300046491 | Bacteria | 1564 |
| 734 | Ga0495585_0001521 | 3300046492 | Bacteria | 18009 |
| 735 | Ga0495585_0003658 | 3300046492 | Bacteria | 10277 |
| 736 | Ga0495596_0018700 | 3300046500 | Bacteria | 2854 |
| 737 | Ga0495606_0000528 | 3300046507 | Bacteria | 61795 |
| 738 | Ga0495606_0005674 | 3300046507 | Bacteria | 11821 |
| 739 | Ga0495606_0016540 | 3300046507 | Bacteria | 5616 |
| 740 | Ga0495610_0006009 | 3300046512 | Bacteria | 8481 |
| 741 | Ga0495616_0005759 | 3300046513 | Bacteria | 7578 |
| 742 | Ga0495616_0023741 | 3300046513 | Bacteria | 3296 |
| 743 | Ga0495631_0087772 | 3300046518 | Bacteria | 1339 |
| 744 | Ga0495631_0109135 | 3300046518 | Bacteria | 1190 |
| 745 | Ga0495632_0230054 | 3300046519 | Bacteria | 836 |
| 746 | Ga0495644_0051316 | 3300046523 | Bacteria | 1549 |
| 747 | Ga0495642_0034662 | 3300046528 | Bacteria | 2034 |
| 748 | Ga0495652_0157877 | 3300046529 | Bacteria | 1764 |
| 749 | Ga0495665_0052354 | 3300046531 | Bacteria | 2161 |
| 750 | Ga0495609_0005281 | 3300046538 | Bacteria | 6852 |
| 751 | Ga0495609_0052156 | 3300046538 | Bacteria | 1820 |
| 752 | Ga0495622_0041224 | 3300046557 | Bacteria | 2147 |
| 753 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 754 | Ga0495633_0011158 | 3300046558 | Bacteria | 4867 |
| 755 | Ga0495633_0015320 | 3300046558 | Bacteria | 3979 |
| 756 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 757 | Ga0495634_0237511 | 3300046642 | Bacteria | 1119 |
| 758 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 759 | Ga0495625_0000753 | 3300046660 | Bacteria | 45225 |
| 760 | Ga0495625_0001432 | 3300046660 | Bacteria | 29071 |
| 761 | Ga0495625_0082121 | 3300046660 | Bacteria | 2242 |
| 762 | Ga0495625_0099251 | 3300046660 | Bacteria | 2002 |
| 763 | Ga0495625_0301139 | 3300046660 | Bacteria | 1026 |
| 764 | Ga0495659_0016122 | 3300046664 | Bacteria | 2462 |
| 765 | Ga0495659_0068983 | 3300046664 | Bacteria | 1321 |
| 766 | Ga0495661_0000707 | 3300046665 | Bacteria | 33018 |
| 767 | Ga0495661_0004079 | 3300046665 | Bacteria | 10640 |
| 768 | Ga0495647_0005287 | 3300046681 | Bacteria | 4228 |
| 769 | Ga0495647_0023171 | 3300046681 | Bacteria | 2250 |
| 770 | Ga0495658_0000570 | 3300046683 | Bacteria | 20102 |
| 771 | Ga0495658_0075837 | 3300046683 | Bacteria | 1963 |
| 772 | Ga0495658_0136364 | 3300046683 | Bacteria | 1497 |
| 773 | Ga0495658_0163109 | 3300046683 | Bacteria | 1376 |
| 774 | Ga0495658_0191774 | 3300046683 | Bacteria | 1271 |
| 775 | Ga0495669_0010075 | 3300046684 | Bacteria | 3992 |
| 776 | Ga0495670_0061831 | 3300046691 | Bacteria | 1883 |
| 777 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 778 | Ga0495676_0248657 | 3300047321 | Bacteria | 1214 |
| 779 | Ga0495680_0339732 | 3300047322 | Bacteria | 1048 |
| 780 | Ga0495687_001120 | 3300047443 | Bacteria | 26041 |
| 781 | Ga0495687_006439 | 3300047443 | Bacteria | 7196 |
| 782 | Ga0495677_0037403 | 3300047445 | Bacteria | 1773 |
| 783 | Ga0495686_0001209 | 3300047472 | Bacteria | 29698 |
| 784 | Ga0495686_0001825 | 3300047472 | Bacteria | 21435 |
| 785 | Ga0495602_0001510 | 3300048088 | Bacteria | 23177 |
| 786 | Ga0495614_0083785 | 3300048089 | Bacteria | 1383 |
| 787 | Ga0495626_0009849 | 3300048091 | Bacteria | 5138 |
| 788 | Ga0496100_0167413 | 3300048903 | Bacteria | 1580 |
| 789 | Ga0496102_0030220 | 3300048905 | Bacteria | 4848 |
| 790 | Ga0496102_0042442 | 3300048905 | Bacteria | 4121 |
| 791 | Ga0496103_0061654 | 3300048906 | Bacteria | 2333 |
| 792 | Ga0496103_0120921 | 3300048906 | Bacteria | 1668 |
| 793 | Ga0496104_0020868 | 3300048907 | Bacteria | 6008 |
| 794 | Ga0496104_0098177 | 3300048907 | Bacteria | 2804 |
| 795 | Ga0496106_0000834 | 3300048909 | Bacteria | 22319 |
| 796 | Ga0496106_0032249 | 3300048909 | Bacteria | 3906 |
| 797 | Ga0496106_0045581 | 3300048909 | Bacteria | 3294 |
| 798 | Ga0496107_0046604 | 3300048910 | Bacteria | 3120 |
| 799 | Ga0496107_0156100 | 3300048910 | Bacteria | 1690 |
| 800 | Ga0496107_0204380 | 3300048910 | Bacteria | 1468 |
| 801 | Ga0496107_0314167 | 3300048910 | Bacteria | 1166 |
| 802 | Ga0496108_0031353 | 3300048911 | Bacteria | 4411 |
| 803 | Ga0496108_0595622 | 3300048911 | Bacteria | 963 |
| 804 | Ga0496109_0278429 | 3300048912 | Bacteria | 1577 |
| 805 | Ga0496109_0531654 | 3300048912 | Bacteria | 1109 |
| 806 | Ga0496110_0265779 | 3300048913 | Bacteria | 1562 |
| 807 | Ga0496111_0202197 | 3300048914 | Bacteria | 1477 |
| 808 | Ga0496112_0315805 | 3300048915 | Bacteria | 1507 |
| 809 | Ga0496112_0547925 | 3300048915 | Bacteria | 1091 |
| 810 | Ga0496112_0610918 | 3300048915 | Bacteria | 1022 |
| 811 | Ga0496112_0641627 | 3300048915 | Bacteria | 992 |
| 812 | Ga0496113_0131242 | 3300048916 | Bacteria | 1966 |
| 813 | Ga0496113_0194871 | 3300048916 | Bacteria | 1609 |
| 814 | Ga0496116_0002379 | 3300048919 | Bacteria | 19844 |
| 815 | Ga0496117_0002276 | 3300048920 | Bacteria | 24806 |
| 816 | Ga0496118_0026652 | 3300048921 | Bacteria | 4916 |
| 817 | Ga0496122_0015395 | 3300048925 | Bacteria | 7314 |
| 818 | Ga0496123_0018244 | 3300048926 | Bacteria | 5590 |
| 819 | Ga0496125_0038198 | 3300048928 | Bacteria | 4161 |
| 820 | Ga0495678_033997 | 3300049459 | Bacteria | 2101 |
| 821 | Ga0501298_018491 | 3300049521 | Bacteria | 1282 |
| 822 | Ga0501299_025167 | 3300049522 | Bacteria | 1116 |
| 823 | Ga0501033_0108285 | 3300049570 | Bacteria | 2024 |
| 824 | Ga0501036_0445463 | 3300049572 | Bacteria | 1079 |
| 825 | Ga0501038_0020497 | 3300049574 | Bacteria | 5940 |
| 826 | Ga0501041_0043753 | 3300049577 | Bacteria | 2722 |
| 827 | Ga0501041_0127761 | 3300049577 | Bacteria | 1583 |
| 828 | Ga0501042_0005696 | 3300049578 | Bacteria | 8040 |
| 829 | Ga0501042_0346235 | 3300049578 | Bacteria | 1075 |
| 830 | Ga0501046_0258124 | 3300049580 | Bacteria | 1281 |
| 831 | Ga0501047_0153441 | 3300049581 | Bacteria | 2178 |
| 832 | Ga0501048_0049392 | 3300049582 | Bacteria | 2998 |
| 833 | Ga0501068_0172402 | 3300049584 | Bacteria | 1366 |
| 834 | Ga0501069_0128203 | 3300049585 | Bacteria | 1452 |
| 835 | Ga0501071_0030335 | 3300049587 | Bacteria | 3824 |
| 836 | Ga0501071_0055109 | 3300049587 | Bacteria | 2870 |
| 837 | Ga0501071_0095316 | 3300049587 | Bacteria | 2190 |
| 838 | Ga0501071_0263414 | 3300049587 | Bacteria | 1302 |
| 839 | Ga0501072_0115331 | 3300049588 | Bacteria | 2139 |
| 840 | Ga0501074_0315803 | 3300049590 | Bacteria | 1110 |
| 841 | Ga0501075_0516219 | 3300049591 | Bacteria | 912 |
| 842 | Ga0501076_0054267 | 3300049592 | Bacteria | 3176 |
| 843 | Ga0501076_0120138 | 3300049592 | Bacteria | 2128 |
| 844 | Ga0501076_0558653 | 3300049592 | Bacteria | 944 |
| 845 | Ga0501201_008382 | 3300049651 | Bacteria | 997 |
| 846 | Ga0501202_010222 | 3300049652 | Bacteria | 1738 |
| 847 | Ga0501207_010580 | 3300049654 | Bacteria | 1363 |
| 848 | Ga0501216_009248 | 3300049660 | Bacteria | 1568 |
| 849 | Ga0501217_015028 | 3300049661 | Bacteria | 1757 |
| 850 | Ga0501223_012726 | 3300049663 | Bacteria | 1680 |
| 851 | Ga0501224_006106 | 3300049664 | Bacteria | 1743 |
| 852 | Ga0501233_040704 | 3300049668 | Bacteria | 1091 |
| 853 | Ga0501243_027846 | 3300049675 | Bacteria | 955 |
| 854 | Ga0501247_003827 | 3300049677 | Bacteria | 1628 |
| 855 | Ga0501261_023759 | 3300049690 | Bacteria | 894 |
| 856 | Ga0501221_037169 | 3300049704 | Bacteria | 1047 |
| 857 | Ga0501225_0040627 | 3300049705 | Bacteria | 1282 |
| 858 | Ga0501079_0030984 | 3300049741 | Bacteria | 4110 |
| 859 | Ga0501080_0140288 | 3300049742 | Bacteria | 2235 |
| 860 | Ga0501081_0445458 | 3300049743 | Bacteria | 962 |
| 861 | Ga0501263_000507 | 3300049760 | Bacteria | 2952 |
| 862 | Ga0501273_015469 | 3300049770 | Bacteria | 991 |
| 863 | Ga0501035_0283680 | 3300049822 | Bacteria | 1399 |
| 864 | Ga0501044_0778945 | 3300049823 | Bacteria | 837 |
| 865 | Ga0501045_0018713 | 3300049824 | Bacteria | 4931 |
| 866 | Ga0501045_0351132 | 3300049824 | Bacteria | 1098 |
| 867 | nmdc:mga0k408_23828_c1 | 3300050493 | Bacteria | 2298 |
| 868 | nmdc:mga0k408_260_c1 | 3300050493 | Bacteria | 28863 |
| 869 | nmdc:mga0k408_859_c1 | 3300050493 | Bacteria | 12690 |
| 870 | nmdc:mga05p37_10032_c1 | 3300050507 | Bacteria | 11242 |
| 871 | nmdc:mga05p37_197765_c1 | 3300050507 | Bacteria | 2437 |
| 872 | nmdc:mga05p37_21055_c1 | 3300050507 | Bacteria | 7893 |
| 873 | nmdc:mga05p37_271433_c1 | 3300050507 | Bacteria | 2026 |
| 874 | nmdc:mga05p37_346171_c1 | 3300050507 | Bacteria | 1751 |
| 875 | nmdc:mga05p37_39517_c1 | 3300050507 | Bacteria | 5793 |
| 876 | nmdc:mga09592_1094_c1 | 3300050508 | Bacteria | 21508 |
| 877 | nmdc:mga09592_11444_c1 | 3300050508 | Bacteria | 7216 |
| 878 | nmdc:mga09592_137492_c1 | 3300050508 | Bacteria | 2105 |
| 879 | nmdc:mga09592_207144_c1 | 3300050508 | Bacteria | 1698 |
| 880 | nmdc:mga09592_24524_c1 | 3300050508 | Bacteria | 4988 |
| 881 | nmdc:mga09592_24982_c1 | 3300050508 | Bacteria | 4942 |
| 882 | nmdc:mga09592_397145_c1 | 3300050508 | Bacteria | 1192 |
| 883 | nmdc:mga0qj67_15222_c1 | 3300050509 | Bacteria | 5821 |
| 884 | nmdc:mga0qj67_212774_c1 | 3300050509 | Bacteria | 1570 |
| 885 | nmdc:mga0qj67_45964_c1 | 3300050509 | Bacteria | 3445 |
| 886 | nmdc:mga06r32_2891_c1 | 3300050510 | Bacteria | 15411 |
| 887 | nmdc:mga06r32_78179_c1 | 3300050510 | Bacteria | 3215 |
| 888 | nmdc:mga08y16_178990_c1 | 3300050511 | Bacteria | 2202 |
| 889 | nmdc:mga08y16_28893_c1 | 3300050511 | Bacteria | 5845 |
| 890 | nmdc:mga08y16_296218_c1 | 3300050511 | Bacteria | 1668 |
| 891 | nmdc:mga08y16_487978_c1 | 3300050511 | Bacteria | 1253 |
| 892 | nmdc:mga08y16_58876_c1 | 3300050511 | Bacteria | 4014 |
| 893 | nmdc:mga08y16_76589_c1 | 3300050511 | Bacteria | 3487 |
| 894 | nmdc:mga08y16_821_c1 | 3300050511 | Bacteria | 29792 |
| 895 | nmdc:mga0n895_163892_c1 | 3300050512 | Bacteria | 2254 |
| 896 | nmdc:mga0n895_726655_c1 | 3300050512 | Bacteria | 987 |
| 897 | nmdc:mga0rr50_139_c1 | 3300050513 | Bacteria | 40055 |
| 898 | nmdc:mga0rr50_170349_c1 | 3300050513 | Bacteria | 1774 |
| 899 | nmdc:mga0rr50_4236_c1 | 3300050513 | Bacteria | 8392 |
| 900 | nmdc:mga08x19_3622_c1 | 3300050514 | Bacteria | 9201 |
| 901 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 902 | nmdc:mga0a205_174193_c1 | 3300050515 | Bacteria | 2047 |
| 903 | nmdc:mga0a205_273633_c1 | 3300050515 | Bacteria | 1565 |
| 904 | nmdc:mga0a205_302050_c1 | 3300050515 | Bacteria | 1474 |
| 905 | nmdc:mga0a205_63177_c1 | 3300050515 | Bacteria | 3577 |
| 906 | nmdc:mga0a205_7292_c1 | 3300050515 | Bacteria | 10004 |
| 907 | nmdc:mga0a205_88196_c1 | 3300050515 | Bacteria | 2998 |
| 908 | Ga0495601_0153090 | 3300053077 | Bacteria | 1506 |
| 909 | Ga0500635_0001015 | 3300053080 | Bacteria | 6718 |
| 910 | Ga0500555_000471 | 3300053103 | Bacteria | 16699 |
| 911 | Ga0500608_000203 | 3300053122 | Bacteria | 23751 |
| 912 | Ga0500608_007068 | 3300053122 | Bacteria | 4615 |
| 913 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 914 | Ga0500618_008815 | 3300053125 | Bacteria | 2788 |
| 915 | Ga0500622_0001600 | 3300053156 | Bacteria | 17790 |
| 916 | Ga0500624_000694 | 3300053157 | Bacteria | 8505 |
| 917 | Ga0590074_040918 | 3300059423 | Bacteria | 834 |
| 918 | Ga0587085_028233 | 3300059506 | Bacteria | 905 |
| 919 | Ga0501082_0623385 | 3300060353 | Bacteria | 944 |
| 920 | Ga0530510_0029172 | 3300061734 | Bacteria | 3959 |
| 921 | 2599477068 | 2599185184 | Bacteria | 6430550 |
| 922 | 2722726500 | 2721755487 | Bacteria | 6357185 |
| 923 | 2738762616 | 2738541284 | Bacteria | 5199923 |
| 924 | 2842906507 | 2842903701 | Bacteria | 6986368 |
| 925 | 2852626917 | 2852623160 | Bacteria | 4376875 |
| 926 | 2884938030 | 2884933994 | Bacteria | 4535041 |
| 927 | 2896319414 | 2896317667 | Bacteria | 4606601 |
| 928 | 2904783635 | 2904780799 | Bacteria | 5840761 |
| 929 | 2919182186 | 2919177583 | Bacteria | 5641607 |
| 930 | 2919442232 | 2919437846 | Bacteria | 6199444 |
| 931 | 2928078981 | 2928078545 | Bacteria | 6534839 |
| 932 | 2928148652 | 2928147474 | Bacteria | 6512076 |
| 933 | 2932085628 | 2932082852 | Bacteria | 6563563 |
| 934 | 3003233521 | 3003233435 | Bacteria | 4458031 |
| 935 | 8055590801 | 8055588893 | Bacteria | 3619545 |
| 936 | Ga0105237_10000485 | |||
| 937 | SwRhRL2b_contig_731410 | |||
| 938 | CNAas_1000829 | |||
| 939 | JGI24741J21665_1012612 | |||
| 940 | JGI24740J21852_10016887 | |||
| 941 | JGI24737J22298_10000143 | |||
| 942 | JGI24735J21928_10000006 | |||
| 943 | JGI24748J21848_1000051 | |||
| 944 | JGI24744J21845_10002026 | |||
| 945 | JGI24034J26672_10000030 | |||
| 946 | JGI24751J29686_10054973 | |||
| 947 | JGI25162J39368_1000089 | |||
| 948 | JGI25162J39368_1000498 | |||
| 949 | JGI25157J39369_1005927 | |||
| 950 | JGI25165J46597_1000618 | |||
| 951 | rootH1_10029777 | |||
| 952 | rootH2_10018591 | |||
| 953 | rootH2_10039562 | |||
| 954 | rootH2_10186211 | |||
| 955 | rootL2_10211276 | |||
| 956 | rootH1_10010194 | |||
| 957 | rootH1_10105642 | |||
| 958 | rootH1_10379396 | |||
| 959 | Ga0058863_11791471 | |||
| 960 | Ga0058861_11760232 | |||
| 961 | Ga0058862_12416007 | |||
| 962 | Ga0065714_10064422 | |||
| 963 | Ga0065714_10148595 | |||
| 964 | Ga0065704_10009526 | |||
| 965 | Ga0065704_10023815 | |||
| 966 | Ga0065704_10092483 | |||
| 967 | Ga0065704_10092834 | |||
| 968 | Ga0065712_10067728 | |||
| 969 | Ga0065712_10089641 | |||
| 970 | Ga0065712_10204759 | |||
| 971 | Ga0065715_10004474 | |||
| 972 | Ga0065715_10089181 | |||
| 973 | Ga0065715_10095696 | |||
| 974 | Ga0065715_10105987 | |||
| 975 | Ga0065715_10343798 | |||
| 976 | Ga0065715_10443342 | |||
| 977 | Ga0065707_10091424 | |||
| 978 | Ga0065707_10190589 | |||
| 979 | Ga0065707_10246444 | |||
| 980 | Ga0065707_10322946 | |||
| 981 | Ga0070658_10000018 | |||
| 982 | Ga0070658_10080753 | |||
| 983 | Ga0070658_10338790 | |||
| 984 | Ga0070658_10563895 | |||
| 985 | Ga0070676_10004488 | |||
| 986 | Ga0070676_10093607 | |||
| 987 | Ga0070676_10149873 | |||
| 988 | Ga0070676_10503680 | |||
| 989 | Ga0070683_100301639 | |||
| 990 | Ga0070690_100054471 | |||
| 991 | Ga0070690_100219957 | |||
| 992 | Ga0070690_100225321 | |||
| 993 | Ga0070670_100000165 | |||
| 994 | Ga0070670_100000767 | |||
| 995 | Ga0070670_100224439 | |||
| 996 | Ga0068869_100035202 | |||
| 997 | Ga0068869_100080076 | |||
| 998 | Ga0068869_100090184 | |||
| 999 | Ga0068869_100165587 | |||
| 1000 | Ga0068869_100184623 | |||
| 1001 | Ga0070680_100302537 | |||
| 1002 | Ga0070680_100458117 | |||
| 1003 | Ga0070682_100041994 | |||
| 1004 | Ga0068868_100013908 | |||
| 1005 | Ga0070660_100091736 | |||
| 1006 | Ga0070689_100000816 | |||
| 1007 | Ga0070689_100023397 | |||
| 1008 | Ga0070689_100779276 | |||
| 1009 | Ga0070691_10113953 | |||
| 1010 | Ga0070691_10313527 | |||
| 1011 | Ga0070687_100057385 | |||
| 1012 | Ga0070687_100226986 | |||
| 1013 | Ga0070661_100050498 | |||
| 1014 | Ga0070692_10016459 | |||
| 1015 | Ga0070692_10031317 | |||
| 1016 | Ga0070692_10060528 | |||
| 1017 | Ga0070692_10203511 | |||
| 1018 | Ga0070669_100011817 | |||
| 1019 | Ga0070669_100026199 | |||
| 1020 | Ga0070669_100324176 | |||
| 1021 | Ga0070675_100047495 | |||
| 1022 | Ga0070671_100027615 | |||
| 1023 | Ga0070671_100208803 | |||
| 1024 | Ga0070673_100008881 | |||
| 1025 | Ga0070673_100014675 | |||
| 1026 | Ga0070673_100028970 | |||
| 1027 | Ga0070688_100000427 | |||
| 1028 | Ga0070688_100009040 | |||
| 1029 | Ga0070659_100018374 | |||
| 1030 | Ga0070659_100026796 | |||
| 1031 | Ga0070667_100139335 | |||
| 1032 | Ga0070701_10026549 | |||
| 1033 | Ga0070701_10065272 | |||
| 1034 | Ga0070705_100022136 | |||
| 1035 | Ga0070705_100193364 | |||
| 1036 | Ga0070700_100004173 | |||
| 1037 | Ga0070700_100118473 | |||
| 1038 | Ga0070700_100138605 | |||
| 1039 | Ga0070700_100199413 | |||
| 1040 | Ga0070694_100005028 | |||
| 1041 | Ga0070694_100029319 | |||
| 1042 | Ga0070694_100067292 | |||
| 1043 | Ga0070694_100200135 | |||
| 1044 | Ga0070694_100210428 | |||
| 1045 | Ga0070694_100359661 | |||
| 1046 | Ga0070694_100696880 | |||
| 1047 | Ga0070708_100002619 | |||
| 1048 | Ga0070708_100259342 | |||
| 1049 | Ga0070708_100329329 | |||
| 1050 | Ga0070708_100369972 | |||
| 1051 | Ga0070678_100018207 | |||
| 1052 | Ga0070678_100110744 | |||
| 1053 | Ga0070662_100000626 | |||
| 1054 | Ga0070662_100173729 | |||
| 1055 | Ga0070681_10001768 | |||
| 1056 | Ga0070681_10022542 | |||
| 1057 | Ga0070681_10029377 | |||
| 1058 | Ga0068867_100016777 | |||
| 1059 | Ga0068867_100219256 | |||
| 1060 | Ga0068867_100512828 | |||
| 1061 | Ga0070706_100000128 | |||
| 1062 | Ga0070706_100005626 | |||
| 1063 | Ga0070706_100018438 | |||
| 1064 | Ga0070706_100037115 | |||
| 1065 | Ga0070706_100049046 | |||
| 1066 | Ga0070706_100093641 | |||
| 1067 | Ga0070706_100223588 | |||
| 1068 | Ga0070706_100539125 | |||
| 1069 | Ga0070707_100006408 | |||
| 1070 | Ga0070707_100029831 | |||
| 1071 | Ga0070707_100078663 | |||
| 1072 | Ga0070707_100180455 | |||
| 1073 | Ga0070707_100180813 | |||
| 1074 | Ga0070707_100768365 | |||
| 1075 | Ga0070698_100000663 | |||
| 1076 | Ga0070698_100004577 | |||
| 1077 | Ga0070698_100005014 | |||
| 1078 | Ga0070698_100051295 | |||
| 1079 | Ga0070698_100053534 | |||
| 1080 | Ga0070698_100185010 | |||
| 1081 | Ga0070698_100209354 | |||
| 1082 | Ga0070699_100001336 | |||
| 1083 | Ga0070699_100014592 | |||
| 1084 | Ga0070699_100049669 | |||
| 1085 | Ga0070699_100576079 | |||
| 1086 | Ga0070679_100008363 | |||
| 1087 | Ga0070679_100111586 | |||
| 1088 | Ga0070697_100003936 | |||
| 1089 | Ga0070697_100036822 | |||
| 1090 | Ga0070697_100063878 | |||
| 1091 | Ga0070697_100094122 | |||
| 1092 | Ga0070697_100101472 | |||
| 1093 | Ga0070697_100182476 | |||
| 1094 | Ga0070697_100213432 | |||
| 1095 | Ga0070697_100259760 | |||
| 1096 | Ga0068853_100014510 | |||
| 1097 | Ga0068853_100019819 | |||
| 1098 | Ga0068853_100167119 | |||
| 1099 | Ga0068853_100234649 | |||
| 1100 | Ga0068853_100695547 | |||
| 1101 | Ga0070672_100019003 | |||
| 1102 | Ga0070672_100104518 | |||
| 1103 | Ga0070672_100124054 | |||
| 1104 | Ga0070672_100235441 | |||
| 1105 | Ga0070686_100011130 | |||
| 1106 | Ga0070686_100014560 | |||
| 1107 | Ga0070695_100011147 | |||
| 1108 | Ga0070695_100035049 | |||
| 1109 | Ga0070695_100051867 | |||
| 1110 | Ga0070695_100172942 | |||
| 1111 | Ga0070695_100174986 | |||
| 1112 | Ga0070695_100356052 | |||
| 1113 | Ga0070696_100008944 | |||
| 1114 | Ga0070696_100123279 | |||
| 1115 | Ga0070693_100031294 | |||
| 1116 | Ga0070693_100303516 | |||
| 1117 | Ga0070665_100000072 | |||
| 1118 | Ga0070665_100149900 | |||
| 1119 | Ga0070704_100031410 | |||
| 1120 | Ga0070704_100098350 | |||
| 1121 | Ga0070704_100288435 | |||
| 1122 | Ga0068855_100000070 | |||
| 1123 | Ga0068855_100000268 | |||
| 1124 | Ga0068855_100012445 | |||
| 1125 | Ga0068855_100063242 | |||
| 1126 | Ga0068855_100152225 | |||
| 1127 | Ga0068855_100204197 | |||
| 1128 | Ga0068855_100416203 | |||
| 1129 | Ga0070664_100004294 | |||
| 1130 | Ga0070664_100025146 | |||
| 1131 | Ga0070664_100461099 | |||
| 1132 | Ga0070664_100549184 | |||
| 1133 | Ga0068857_100006559 | |||
| 1134 | Ga0068857_100127604 | |||
| 1135 | Ga0068857_100164685 | |||
| 1136 | Ga0068857_100578922 | |||
| 1137 | Ga0068854_100095077 | |||
| 1138 | Ga0068854_100271233 | |||
| 1139 | Ga0068856_100000897 | |||
| 1140 | Ga0068856_100003887 | |||
| 1141 | Ga0068856_100005676 | |||
| 1142 | Ga0068856_100009016 | |||
| 1143 | Ga0068856_100013111 | |||
| 1144 | Ga0068856_100194332 | |||
| 1145 | Ga0070702_100001061 | |||
| 1146 | Ga0070702_100184429 | |||
| 1147 | Ga0070702_100340747 | |||
| 1148 | Ga0068852_100017595 | |||
| 1149 | Ga0068852_100230360 | |||
| 1150 | Ga0068859_100054835 | |||
| 1151 | Ga0068859_100079747 | |||
| 1152 | Ga0068859_100112551 | |||
| 1153 | Ga0068859_100169538 | |||
| 1154 | Ga0068859_100287541 | |||
| 1155 | Ga0068859_100411653 | |||
| 1156 | Ga0068864_100002141 | |||
| 1157 | Ga0068864_100034796 | |||
| 1158 | Ga0068864_100106485 | |||
| 1159 | Ga0068864_100652402 | |||
| 1160 | Ga0068866_10012210 | |||
| 1161 | Ga0068866_10017052 | |||
| 1162 | Ga0068861_100002200 | |||
| 1163 | Ga0068861_100126572 | |||
| 1164 | Ga0068861_100512790 | |||
| 1165 | Ga0068870_10064483 | |||
| 1166 | Ga0068870_10203280 | |||
| 1167 | Ga0068863_100092530 | |||
| 1168 | Ga0068863_100210158 | |||
| 1169 | Ga0068863_100257220 | |||
| 1170 | Ga0068858_100000405 | |||
| 1171 | Ga0068858_100014535 | |||
| 1172 | Ga0068858_100058092 | |||
| 1173 | Ga0068858_100068571 | |||
| 1174 | Ga0068858_100089413 | |||
| 1175 | Ga0068858_100269722 | |||
| 1176 | Ga0068860_100002487 | |||
| 1177 | Ga0068860_100027839 | |||
| 1178 | Ga0068860_100096792 | |||
| 1179 | Ga0068860_100195015 | |||
| 1180 | Ga0068862_100033821 | |||
| 1181 | Ga0068862_100038785 | |||
| 1182 | Ga0068862_100102426 | |||
| 1183 | Ga0081455_10422222 | |||
| 1184 | Ga0081540_1097925 | |||
| 1185 | Ga0081539_10000858 | |||
| 1186 | Ga0070715_10000024 | |||
| 1187 | Ga0070716_100015207 | |||
| 1188 | Ga0075366_10001711 | |||
| 1189 | Ga0097621_100000028 | |||
| 1190 | Ga0097621_100003157 | |||
| 1191 | Ga0097621_100006010 | |||
| 1192 | Ga0068871_100006906 | |||
| 1193 | Ga0068871_100024567 | |||
| 1194 | Ga0068871_100037044 | |||
| 1195 | Ga0075430_100014761 | |||
| 1196 | Ga0075430_100017128 | |||
| 1197 | Ga0075430_100066766 | |||
| 1198 | Ga0075430_100088661 | |||
| 1199 | Ga0075431_100095920 | |||
| 1200 | Ga0075431_100166135 | |||
| 1201 | Ga0075433_10015116 | |||
| 1202 | Ga0075433_10021849 | |||
| 1203 | Ga0075433_10049863 | |||
| 1204 | Ga0075433_10282341 | |||
| 1205 | Ga0075433_10366468 | |||
| 1206 | Ga0075434_100000831 | |||
| 1207 | Ga0075434_100010744 | |||
| 1208 | Ga0075434_100147427 | |||
| 1209 | Ga0075434_100160548 | |||
| 1210 | Ga0075434_100706617 | |||
| 1211 | Ga0075429_100011725 | |||
| 1212 | Ga0075429_100018935 | |||
| 1213 | Ga0075429_100031368 | |||
| 1214 | Ga0075429_100092571 | |||
| 1215 | Ga0075429_100234498 | |||
| 1216 | Ga0068865_100000127 | |||
| 1217 | Ga0068865_100032927 | |||
| 1218 | Ga0068865_100071929 | |||
| 1219 | Ga0068865_100305617 | |||
| 1220 | Ga0075436_100000020 | |||
| 1221 | Ga0075436_100327712 | |||
| 1222 | Ga0075436_100389832 | |||
| 1223 | Ga0097620_100011064 | |||
| 1224 | Ga0097620_100054836 | |||
| 1225 | Ga0097620_100079748 | |||
| 1226 | Ga0097620_100112549 | |||
| 1227 | Ga0097620_100169531 | |||
| 1228 | Ga0097620_100287541 | |||
| 1229 | Ga0097620_100411662 | |||
| 1230 | Ga0075435_100000165 | |||
| 1231 | Ga0075435_100032986 | |||
| 1232 | Ga0075435_100095774 | |||
| 1233 | Ga0075435_100281110 | |||
| 1234 | Ga0099794_10001218 | |||
| 1235 | Ga0105251_10061955 | |||
| 1236 | Ga0105251_10116981 | |||
| 1237 | Ga0105240_10000237 | |||
| 1238 | Ga0105240_10014965 | |||
| 1239 | Ga0105240_10020594 | |||
| 1240 | Ga0105240_10048025 | |||
| 1241 | Ga0105240_10187598 | |||
| 1242 | Ga0105240_10227132 | |||
| 1243 | Ga0105240_10365364 | |||
| 1244 | Ga0105240_11082324 | |||
| 1245 | Ga0111539_10079406 | |||
| 1246 | Ga0111539_10211199 | |||
| 1247 | Ga0105245_10243938 | |||
| 1248 | Ga0105245_10607140 | |||
| 1249 | Ga0105247_10000153 | |||
| 1250 | Ga0105247_10005769 | |||
| 1251 | Ga0105247_10009777 | |||
| 1252 | Ga0114129_10007783 | |||
| 1253 | Ga0114129_10018669 | |||
| 1254 | Ga0114129_10213288 | |||
| 1255 | Ga0114129_10654159 | |||
| 1256 | Ga0114129_10843987 | |||
| 1257 | Ga0105243_10000785 | |||
| 1258 | Ga0105243_10080793 | |||
| 1259 | Ga0105243_10133231 | |||
| 1260 | Ga0105243_10189222 | |||
| 1261 | Ga0105243_10298058 | |||
| 1262 | Ga0105241_10535967 | |||
| 1263 | Ga0105242_10001383 | |||
| 1264 | Ga0105242_10029494 | |||
| 1265 | Ga0105242_10187229 | |||
| 1266 | Ga0105242_10256131 | |||
| 1267 | Ga0105248_10015522 | |||
| 1268 | Ga0105248_10015913 | |||
| 1269 | Ga0105248_10165246 | |||
| 1270 | Ga0105237_10000224 | |||
| 1271 | Ga0105237_10001308 | |||
| 1272 | Ga0105237_10037976 | |||
| 1273 | Ga0105237_10041051 | |||
| 1274 | Ga0105237_10065000 | |||
| 1275 | Ga0105237_10093882 | |||
| 1276 | Ga0105237_10279937 | |||
| 1277 | Ga0105237_10385476 | |||
| 1278 | Ga0105237_10411591 | |||
| 1279 | Ga0105237_10442625 | |||
| 1280 | Ga0105237_10553924 | |||
| 1281 | Ga0105238_10133400 | |||
| 1282 | Ga0105238_11076560 | |||
| 1283 | Ga0105249_10013986 | |||
| 1284 | Ga0105249_10063134 | |||
| 1285 | Ga0105249_10087773 | |||
| 1286 | Ga0105249_10237828 | |||
| 1287 | Ga0105239_10000039 | |||
| 1288 | Ga0105239_10000120 | |||
| 1289 | Ga0105239_10004436 | |||
| 1290 | Ga0105239_10005560 | |||
| 1291 | Ga0105239_10012917 | |||
| 1292 | Ga0105239_10013753 | |||
| 1293 | Ga0105239_10023687 | |||
| 1294 | Ga0105239_10025250 | |||
| 1295 | Ga0105239_10146195 | |||
| 1296 | Ga0105239_10826509 | |||
| 1297 | Ga0105246_10039466 | |||
| 1298 | Ga0105246_10172179 | |||
| 1299 | Ga0157373_10000208 | |||
| 1300 | Ga0157373_10076454 | |||
| 1301 | Ga0157373_10170348 | |||
| 1302 | Ga0157371_10000263 | |||
| 1303 | Ga0157370_10095584 | |||
| 1304 | Ga0157369_10617552 | |||
| 1305 | Ga0157374_10001845 | |||
| 1306 | Ga0157374_10044113 | |||
| 1307 | Ga0157374_10155428 | |||
| 1308 | Ga0157374_10357088 | |||
| 1309 | Ga0157378_10000002 | |||
| 1310 | Ga0157378_10009280 | |||
| 1311 | Ga0157378_10010199 | |||
| 1312 | Ga0157378_10039044 | |||
| 1313 | Ga0157378_10043262 | |||
| 1314 | Ga0157378_10046779 | |||
| 1315 | Ga0157378_10235654 | |||
| 1316 | Ga0157378_10322829 | |||
| 1317 | Ga0163162_10000010 | |||
| 1318 | Ga0163162_10003107 | |||
| 1319 | Ga0163162_10005005 | |||
| 1320 | Ga0163162_10010070 | |||
| 1321 | Ga0163162_10013931 | |||
| 1322 | Ga0163162_10016331 | |||
| 1323 | Ga0163162_10033657 | |||
| 1324 | Ga0163162_10064255 | |||
| 1325 | Ga0163162_10110885 | |||
| 1326 | Ga0163162_10610738 | |||
| 1327 | Ga0163162_10727211 | |||
| 1328 | Ga0157372_10000050 | |||
| 1329 | Ga0157372_10000635 | |||
| 1330 | Ga0157372_10001419 | |||
| 1331 | Ga0157372_10002231 | |||
| 1332 | Ga0157372_10189979 | |||
| 1333 | Ga0157372_10403929 | |||
| 1334 | Ga0157375_10007015 | |||
| 1335 | Ga0157375_10021385 | |||
| 1336 | Ga0157375_10055045 | |||
| 1337 | Ga0157375_11236598 | |||
| 1338 | Ga0163163_10002079 | |||
| 1339 | Ga0163163_10004729 | |||
| 1340 | Ga0163163_10014695 | |||
| 1341 | Ga0163163_10018317 | |||
| 1342 | Ga0163163_10215737 | |||
| 1343 | Ga0157380_10001101 | |||
| 1344 | Ga0157380_10012995 | |||
| 1345 | Ga0157380_10027529 | |||
| 1346 | Ga0157380_10093550 | |||
| 1347 | Ga0157380_10534322 | |||
| 1348 | Ga0157380_10925475 | |||
| 1349 | Ga0157380_11116714 | |||
| 1350 | Ga0157379_10047882 | |||
| 1351 | Ga0157379_10059280 | |||
| 1352 | Ga0157376_10027794 | |||
| 1353 | Ga0182006_1091847 | |||
| 1354 | Ga0163161_10027541 | |||
| 1355 | Ga0207672_1000067 | |||
| 1356 | Ga0207427_100172 | |||
| 1357 | Ga0209437_100034 | |||
| 1358 | Ga0209437_100221 | |||
| 1359 | Ga0209026_1000728 | |||
| 1360 | Ga0209026_1003634 | |||
| 1361 | Ga0209026_1015127 | |||
| 1362 | Ga0209148_1017175 | |||
| 1363 | Ga0209233_1000038 | |||
| 1364 | Ga0209233_1001428 | |||
| 1365 | Ga0209233_1013109 | |||
| 1366 | Ga0209233_1019675 | |||
| 1367 | Ga0209455_1000861 | |||
| 1368 | Ga0207710_10000001 | |||
| 1369 | Ga0207710_10000702 | |||
| 1370 | Ga0207710_10071792 | |||
| 1371 | Ga0207688_10102635 | |||
| 1372 | Ga0207647_10000076 | |||
| 1373 | Ga0207647_10002660 | |||
| 1374 | Ga0207647_10101115 | |||
| 1375 | Ga0207647_10150889 | |||
| 1376 | Ga0207685_10000018 | |||
| 1377 | Ga0207645_10017477 | |||
| 1378 | Ga0207645_10087794 | |||
| 1379 | Ga0207705_10000036 | |||
| 1380 | Ga0207684_10000150 | |||
| 1381 | Ga0207684_10004744 | |||
| 1382 | Ga0207684_10007514 | |||
| 1383 | Ga0207684_10017828 | |||
| 1384 | Ga0207684_10022905 | |||
| 1385 | Ga0207684_10121834 | |||
| 1386 | Ga0207684_10297695 | |||
| 1387 | Ga0207684_10361659 | |||
| 1388 | Ga0207654_10103132 | |||
| 1389 | Ga0207654_10118633 | |||
| 1390 | Ga0207654_10425683 | |||
| 1391 | Ga0207707_10000016 | |||
| 1392 | Ga0207707_10030350 | |||
| 1393 | Ga0207707_10268130 | |||
| 1394 | Ga0207695_10000013 | |||
| 1395 | Ga0207695_10004656 | |||
| 1396 | Ga0207695_10016549 | |||
| 1397 | Ga0207695_10033191 | |||
| 1398 | Ga0207695_10058909 | |||
| 1399 | Ga0207695_10318305 | |||
| 1400 | Ga0207671_10002707 | |||
| 1401 | Ga0207671_10011004 | |||
| 1402 | Ga0207671_10011316 | |||
| 1403 | Ga0207671_10024807 | |||
| 1404 | Ga0207671_10037577 | |||
| 1405 | Ga0207660_10000805 | |||
| 1406 | Ga0207660_10032391 | |||
| 1407 | Ga0207660_10119374 | |||
| 1408 | Ga0207662_10106779 | |||
| 1409 | Ga0207662_10253872 | |||
| 1410 | Ga0207662_10305117 | |||
| 1411 | Ga0207657_10020956 | |||
| 1412 | Ga0207649_10034440 | |||
| 1413 | Ga0207649_10177370 | |||
| 1414 | Ga0207652_10000693 | |||
| 1415 | Ga0207652_10298145 | |||
| 1416 | Ga0207646_10004823 | |||
| 1417 | Ga0207646_10026415 | |||
| 1418 | Ga0207646_10073942 | |||
| 1419 | Ga0207646_10298506 | |||
| 1420 | Ga0207681_10012288 | |||
| 1421 | Ga0207681_10264841 | |||
| 1422 | Ga0207694_10049255 | |||
| 1423 | Ga0207694_10146670 | |||
| 1424 | Ga0207650_10000011 | |||
| 1425 | Ga0207650_10002299 | |||
| 1426 | Ga0207659_10013295 | |||
| 1427 | Ga0207644_10000882 | |||
| 1428 | Ga0207644_10062324 | |||
| 1429 | Ga0207644_10073528 | |||
| 1430 | Ga0207644_10096507 | |||
| 1431 | Ga0207644_10263654 | |||
| 1432 | Ga0207644_10425065 | |||
| 1433 | Ga0207690_10011536 | |||
| 1434 | Ga0207690_10015769 | |||
| 1435 | Ga0207706_10006487 | |||
| 1436 | Ga0207706_10178930 | |||
| 1437 | Ga0207686_10000952 | |||
| 1438 | Ga0207709_10000524 | |||
| 1439 | Ga0207709_10002326 | |||
| 1440 | Ga0207709_10036889 | |||
| 1441 | Ga0207709_10264132 | |||
| 1442 | Ga0207670_10000065 | |||
| 1443 | Ga0207670_10035418 | |||
| 1444 | Ga0207704_10000044 | |||
| 1445 | Ga0207704_10013016 | |||
| 1446 | Ga0207704_10101785 | |||
| 1447 | Ga0207704_10211159 | |||
| 1448 | Ga0207691_10005500 | |||
| 1449 | Ga0207691_10056180 | |||
| 1450 | Ga0207691_10237566 | |||
| 1451 | Ga0207691_10265208 | |||
| 1452 | Ga0207711_10013164 | |||
| 1453 | Ga0207711_10018170 | |||
| 1454 | Ga0207689_10009519 | |||
| 1455 | Ga0207689_10024086 | |||
| 1456 | Ga0207689_10026884 | |||
| 1457 | Ga0207689_10041222 | |||
| 1458 | Ga0207689_10041530 | |||
| 1459 | Ga0207689_10064294 | |||
| 1460 | Ga0207689_10066062 | |||
| 1461 | Ga0207689_10270225 | |||
| 1462 | Ga0207689_10380763 | |||
| 1463 | Ga0207679_10001977 | |||
| 1464 | Ga0207679_10025207 | |||
| 1465 | Ga0207679_10414295 | |||
| 1466 | Ga0207679_10547559 | |||
| 1467 | Ga0207667_10000009 | |||
| 1468 | Ga0207667_10000971 | |||
| 1469 | Ga0207667_10051802 | |||
| 1470 | Ga0207667_10085702 | |||
| 1471 | Ga0207667_10205066 | |||
| 1472 | Ga0207667_10553159 | |||
| 1473 | Ga0207667_10758902 | |||
| 1474 | Ga0207651_10016587 | |||
| 1475 | Ga0207651_10018113 | |||
| 1476 | Ga0207651_10030254 | |||
| 1477 | Ga0207651_10042500 | |||
| 1478 | Ga0207651_10095736 | |||
| 1479 | Ga0207651_10104905 | |||
| 1480 | Ga0207651_10397315 | |||
| 1481 | Ga0207712_10027437 | |||
| 1482 | Ga0207712_10075328 | |||
| 1483 | Ga0207712_10142459 | |||
| 1484 | Ga0207712_10476213 | |||
| 1485 | Ga0207668_10338072 | |||
| 1486 | Ga0207640_10177008 | |||
| 1487 | Ga0207640_10267992 | |||
| 1488 | Ga0207658_10101237 | |||
| 1489 | Ga0207658_10234206 | |||
| 1490 | Ga0207677_10089034 | |||
| 1491 | Ga0207677_10104836 | |||
| 1492 | Ga0207703_10000045 | |||
| 1493 | Ga0207703_10097306 | |||
| 1494 | Ga0207703_10102201 | |||
| 1495 | Ga0207703_10424570 | |||
| 1496 | Ga0207639_10004531 | |||
| 1497 | Ga0207639_10015887 | |||
| 1498 | Ga0207639_10018588 | |||
| 1499 | Ga0207639_10547352 | |||
| 1500 | Ga0207678_10021588 | |||
| 1501 | Ga0207708_10003530 | |||
| 1502 | Ga0207708_10039998 | |||
| 1503 | Ga0207708_10184541 | |||
| 1504 | Ga0207708_10664032 | |||
| 1505 | Ga0207702_10000507 | |||
| 1506 | Ga0207702_10005892 | |||
| 1507 | Ga0207702_10011829 | |||
| 1508 | Ga0207702_10038199 | |||
| 1509 | Ga0207702_10056941 | |||
| 1510 | Ga0207702_10499778 | |||
| 1511 | Ga0207641_10073847 | |||
| 1512 | Ga0207641_10175600 | |||
| 1513 | Ga0207641_10669928 | |||
| 1514 | Ga0207648_10000529 | |||
| 1515 | Ga0207648_10228044 | |||
| 1516 | Ga0207648_10308551 | |||
| 1517 | Ga0207648_10317344 | |||
| 1518 | Ga0207676_10085282 | |||
| 1519 | Ga0207676_10090487 | |||
| 1520 | Ga0207676_10710559 | |||
| 1521 | Ga0207676_10833183 | |||
| 1522 | Ga0207674_10020588 | |||
| 1523 | Ga0207674_10123397 | |||
| 1524 | Ga0207674_10145605 | |||
| 1525 | Ga0207674_10483995 | |||
| 1526 | Ga0207675_100000849 | |||
| 1527 | Ga0207675_100004603 | |||
| 1528 | Ga0207675_100144676 | |||
| 1529 | Ga0207675_100184473 | |||
| 1530 | Ga0207675_100484499 | |||
| 1531 | Ga0207683_10031312 | |||
| 1532 | Ga0207683_10273793 | |||
| 1533 | Ga0207698_10005251 | |||
| 1534 | Ga0207698_10117485 | |||
| 1535 | Ga0209588_1010709 | |||
| 1536 | Ga0209974_10003508 | |||
| 1537 | Ga0207428_10001623 | |||
| 1538 | Ga0207428_10117762 | |||
| 1539 | Ga0207428_10135769 | |||
| 1540 | Ga0268266_10000089 | |||
| 1541 | Ga0268266_10088905 | |||
| 1542 | Ga0268265_10018602 | |||
| 1543 | Ga0268265_10026095 | |||
| 1544 | Ga0268265_10026318 | |||
| 1545 | Ga0268265_10355986 | |||
| 1546 | Ga0268264_10007034 | |||
| 1547 | Ga0268264_10069792 | |||
| 1548 | Ga0268264_10080774 | |||
| 1549 | Ga0268264_10128605 | |||
| 1550 | Ga0307517_10003551 | |||
| 1551 | Ga0307515_10001481 | |||
| 1552 | Ga0307515_10001997 | |||
| 1553 | Ga0307515_10100898 | |||
| 1554 | Ga0265338_10015871 | |||
| 1555 | Ga0316177_1009900 | |||
| 1556 | Ga0316176_1141979 | |||
| 1557 | Ga0316183_1118483 | |||
| 1558 | Ga0316181_1033622 | |||
| 1559 | Ga0265339_10084041 | |||
| 1560 | Ga0265331_10075889 | |||
| 1561 | Ga0265316_10220112 | |||
| 1562 | Ga0307408_100016223 | |||
| 1563 | Ga0307408_100058015 | |||
| 1564 | Ga0307408_100149571 | |||
| 1565 | Ga0316579_10043400 | |||
| 1566 | Ga0316576_10127932 | |||
| 1567 | Ga0307405_10001983 | |||
| 1568 | Ga0307405_10058440 | |||
| 1569 | Ga0307413_10001627 | |||
| 1570 | Ga0307413_10036294 | |||
| 1571 | Ga0307410_10002169 | |||
| 1572 | Ga0307410_10390195 | |||
| 1573 | Ga0307410_10435734 | |||
| 1574 | Ga0307406_10042010 | |||
| 1575 | Ga0307406_10091712 | |||
| 1576 | Ga0307406_10441028 | |||
| 1577 | Ga0307407_10067696 | |||
| 1578 | Ga0307412_10045347 | |||
| 1579 | Ga0307412_10052264 | |||
| 1580 | Ga0307412_10077908 | |||
| 1581 | Ga0307412_10284247 | |||
| 1582 | Ga0307412_10406460 | |||
| 1583 | Ga0307409_100007363 | |||
| 1584 | Ga0307409_100056497 | |||
| 1585 | Ga0307409_100817175 | |||
| 1586 | Ga0307416_100001756 | |||
| 1587 | Ga0307416_100013314 | |||
| 1588 | Ga0307416_100042843 | |||
| 1589 | Ga0307414_10041283 | |||
| 1590 | Ga0307411_10000610 | |||
| 1591 | Ga0307411_10121123 | |||
| 1592 | Ga0307411_10256934 | |||
| 1593 | Ga0307415_100051090 | |||
| 1594 | Ga0307415_100117087 | |||
| 1595 | Ga0307415_100151684 | |||
| 1596 | Ga0307415_100405665 | |||
| 1597 | Ga0316585_10039603 | |||
| 1598 | Ga0316580_10007805 | |||
| 1599 | Ga0307507_10000015 | |||
| 1600 | Ga0373940_0085463 | |||
| 1601 | Ga0373951_0004432 | |||
| 1602 | Ga0373941_0107012 | |||
| 1603 | Ga0373942_0019143 | |||
| 1604 | Ga0373962_0030121 | |||
| 1605 | Ga0373937_0110636 | |||
| 1606 | Ga0373937_0273069 | |||
| 1607 | Ga0373937_0498038 | |||
| 1608 | Ga0316582_0022813 | |||
| 1609 | Ga0316584_0052688 | |||
| 1610 | Ga0316584_0057497 | |||
| 1611 | Ga0395899_0000033 | |||
| 1612 | Ga0395899_0000659 | |||
| 1613 | Ga0395899_0001109 | |||
| 1614 | Ga0395899_0021085 | |||
| 1615 | Ga0395900_0000277 | |||
| 1616 | Ga0395900_0001234 | |||
| 1617 | Ga0395900_0019640 | |||
| 1618 | Ga0395900_0127856 | |||
| 1619 | Ga0395898_0001918 | |||
| 1620 | Ga0395905_0000068 | |||
| 1621 | Ga0395905_0000348 | |||
| 1622 | Ga0395905_0004443 | |||
| 1623 | Ga0395901_0000199 | |||
| 1624 | Ga0395901_0005268 | |||
| 1625 | Ga0395901_0140444 | |||
| 1626 | Ga0395901_0173777 | |||
| 1627 | Ga0242420_003202 | |||
| 1628 | Ga0242420_011217 | |||
| 1629 | Ga0436365_0065130 | |||
| 1630 | Ga0436361_0742208 | |||
| 1631 | Ga0439448_0020387 | |||
| 1632 | Ga0439464_0003170 | |||
| 1633 | Ga0439460_0036907 | |||
| 1634 | Ga0451577_0000034 | |||
| 1635 | Ga0451577_0003212 | |||
| 1636 | Ga0451577_0025370 | |||
| 1637 | Ga0451577_0132698 | |||
| 1638 | Ga0466969_0032580 | |||
| 1639 | Ga0453683_0000005 | |||
| 1640 | Ga0453683_0000122 | |||
| 1641 | Ga0453683_0004573 | |||
| 1642 | Ga0453683_0127057 | |||
| 1643 | Ga0453683_0156419 | |||
| 1644 | Ga0466966_0016086 | |||
| 1645 | Ga0466961_0102343 | |||
| 1646 | Ga0453684_0000098 | |||
| 1647 | Ga0453684_0000467 | |||
| 1648 | Ga0453684_0000603 | |||
| 1649 | Ga0453684_0001278 | |||
| 1650 | Ga0453684_0065621 | |||
| 1651 | Ga0453684_0268672 | |||
| 1652 | Ga0466968_0072467 | |||
| 1653 | Ga0451576_0000036 | |||
| 1654 | Ga0451576_0000397 | |||
| 1655 | Ga0451576_0005569 | |||
| 1656 | Ga0451576_0023567 | |||
| 1657 | Ga0451576_0046399 | |||
| 1658 | Ga0451576_0114207 | |||
| 1659 | Ga0466967_0097786 | |||
| 1660 | Ga0495603_0042271 | |||
| 1661 | Ga0495629_0126159 | |||
| 1662 | Ga0495638_0102196 | |||
| 1663 | Ga0495638_0235657 | |||
| 1664 | Ga0495650_0000014 | |||
| 1665 | Ga0495580_0378928 | |||
| 1666 | Ga0495582_0004387 | |||
| 1667 | Ga0495664_0059927 | |||
| 1668 | Ga0495584_0088190 | |||
| 1669 | Ga0495585_0001521 | |||
| 1670 | Ga0495585_0003658 | |||
| 1671 | Ga0495596_0018700 | |||
| 1672 | Ga0495606_0000528 | |||
| 1673 | Ga0495606_0005674 | |||
| 1674 | Ga0495606_0016540 | |||
| 1675 | Ga0495610_0006009 | |||
| 1676 | Ga0495616_0005759 | |||
| 1677 | Ga0495616_0023741 | |||
| 1678 | Ga0495631_0087772 | |||
| 1679 | Ga0495631_0109135 | |||
| 1680 | Ga0495632_0230054 | |||
| 1681 | Ga0495644_0051316 | |||
| 1682 | Ga0495642_0034662 | |||
| 1683 | Ga0495652_0157877 | |||
| 1684 | Ga0495665_0052354 | |||
| 1685 | Ga0495609_0005281 | |||
| 1686 | Ga0495609_0052156 | |||
| 1687 | Ga0495622_0041224 | |||
| 1688 | Ga0495633_0000035 | |||
| 1689 | Ga0495633_0011158 | |||
| 1690 | Ga0495633_0015320 | |||
| 1691 | Ga0495668_0000032 | |||
| 1692 | Ga0495634_0237511 | |||
| 1693 | Ga0495625_0000009 | |||
| 1694 | Ga0495625_0000753 | |||
| 1695 | Ga0495625_0001432 | |||
| 1696 | Ga0495625_0082121 | |||
| 1697 | Ga0495625_0099251 | |||
| 1698 | Ga0495625_0301139 | |||
| 1699 | Ga0495659_0016122 | |||
| 1700 | Ga0495659_0068983 | |||
| 1701 | Ga0495661_0000707 | |||
| 1702 | Ga0495661_0004079 | |||
| 1703 | Ga0495647_0005287 | |||
| 1704 | Ga0495647_0023171 | |||
| 1705 | Ga0495658_0000570 | |||
| 1706 | Ga0495658_0075837 | |||
| 1707 | Ga0495658_0136364 | |||
| 1708 | Ga0495658_0163109 | |||
| 1709 | Ga0495658_0191774 | |||
| 1710 | Ga0495669_0010075 | |||
| 1711 | Ga0495670_0061831 | |||
| 1712 | Ga0495649_0000002 | |||
| 1713 | Ga0495676_0248657 | |||
| 1714 | Ga0495680_0339732 | |||
| 1715 | Ga0495687_001120 | |||
| 1716 | Ga0495687_006439 | |||
| 1717 | Ga0495677_0037403 | |||
| 1718 | Ga0495686_0001209 | |||
| 1719 | Ga0495686_0001825 | |||
| 1720 | Ga0495602_0001510 | |||
| 1721 | Ga0495614_0083785 | |||
| 1722 | Ga0495626_0009849 | |||
| 1723 | Ga0496100_0167413 | |||
| 1724 | Ga0496102_0030220 | |||
| 1725 | Ga0496102_0042442 | |||
| 1726 | Ga0496103_0061654 | |||
| 1727 | Ga0496103_0120921 | |||
| 1728 | Ga0496104_0020868 | |||
| 1729 | Ga0496104_0098177 | |||
| 1730 | Ga0496106_0000834 | |||
| 1731 | Ga0496106_0032249 | |||
| 1732 | Ga0496106_0045581 | |||
| 1733 | Ga0496107_0046604 | |||
| 1734 | Ga0496107_0156100 | |||
| 1735 | Ga0496107_0204380 | |||
| 1736 | Ga0496107_0314167 | |||
| 1737 | Ga0496108_0031353 | |||
| 1738 | Ga0496108_0595622 | |||
| 1739 | Ga0496109_0278429 | |||
| 1740 | Ga0496109_0531654 | |||
| 1741 | Ga0496110_0265779 | |||
| 1742 | Ga0496111_0202197 | |||
| 1743 | Ga0496112_0315805 | |||
| 1744 | Ga0496112_0547925 | |||
| 1745 | Ga0496112_0610918 | |||
| 1746 | Ga0496112_0641627 | |||
| 1747 | Ga0496113_0131242 | |||
| 1748 | Ga0496113_0194871 | |||
| 1749 | Ga0496116_0002379 | |||
| 1750 | Ga0496117_0002276 | |||
| 1751 | Ga0496118_0026652 | |||
| 1752 | Ga0496122_0015395 | |||
| 1753 | Ga0496123_0018244 | |||
| 1754 | Ga0496125_0038198 | |||
| 1755 | Ga0495678_033997 | |||
| 1756 | Ga0501298_018491 | |||
| 1757 | Ga0501299_025167 | |||
| 1758 | Ga0501033_0108285 | |||
| 1759 | Ga0501036_0445463 | |||
| 1760 | Ga0501038_0020497 | |||
| 1761 | Ga0501041_0043753 | |||
| 1762 | Ga0501041_0127761 | |||
| 1763 | Ga0501042_0005696 | |||
| 1764 | Ga0501042_0346235 | |||
| 1765 | Ga0501046_0258124 | |||
| 1766 | Ga0501047_0153441 | |||
| 1767 | Ga0501048_0049392 | |||
| 1768 | Ga0501068_0172402 | |||
| 1769 | Ga0501069_0128203 | |||
| 1770 | Ga0501071_0030335 | |||
| 1771 | Ga0501071_0055109 | |||
| 1772 | Ga0501071_0095316 | |||
| 1773 | Ga0501071_0263414 | |||
| 1774 | Ga0501072_0115331 | |||
| 1775 | Ga0501074_0315803 | |||
| 1776 | Ga0501075_0516219 | |||
| 1777 | Ga0501076_0054267 | |||
| 1778 | Ga0501076_0120138 | |||
| 1779 | Ga0501076_0558653 | |||
| 1780 | Ga0501201_008382 | |||
| 1781 | Ga0501202_010222 | |||
| 1782 | Ga0501207_010580 | |||
| 1783 | Ga0501216_009248 | |||
| 1784 | Ga0501217_015028 | |||
| 1785 | Ga0501223_012726 | |||
| 1786 | Ga0501224_006106 | |||
| 1787 | Ga0501233_040704 | |||
| 1788 | Ga0501243_027846 | |||
| 1789 | Ga0501247_003827 | |||
| 1790 | Ga0501261_023759 | |||
| 1791 | Ga0501221_037169 | |||
| 1792 | Ga0501225_0040627 | |||
| 1793 | Ga0501079_0030984 | |||
| 1794 | Ga0501080_0140288 | |||
| 1795 | Ga0501081_0445458 | |||
| 1796 | Ga0501263_000507 | |||
| 1797 | Ga0501273_015469 | |||
| 1798 | Ga0501035_0283680 | |||
| 1799 | Ga0501044_0778945 | |||
| 1800 | Ga0501045_0018713 | |||
| 1801 | Ga0501045_0351132 | |||
| 1802 | nmdc:mga0k408_23828_c1 | |||
| 1803 | nmdc:mga0k408_260_c1 | |||
| 1804 | nmdc:mga0k408_859_c1 | |||
| 1805 | nmdc:mga05p37_10032_c1 | |||
| 1806 | nmdc:mga05p37_197765_c1 | |||
| 1807 | nmdc:mga05p37_21055_c1 | |||
| 1808 | nmdc:mga05p37_271433_c1 | |||
| 1809 | nmdc:mga05p37_346171_c1 | |||
| 1810 | nmdc:mga05p37_39517_c1 | |||
| 1811 | nmdc:mga09592_1094_c1 | |||
| 1812 | nmdc:mga09592_11444_c1 | |||
| 1813 | nmdc:mga09592_137492_c1 | |||
| 1814 | nmdc:mga09592_207144_c1 | |||
| 1815 | nmdc:mga09592_24524_c1 | |||
| 1816 | nmdc:mga09592_24982_c1 | |||
| 1817 | nmdc:mga09592_397145_c1 | |||
| 1818 | nmdc:mga0qj67_15222_c1 | |||
| 1819 | nmdc:mga0qj67_212774_c1 | |||
| 1820 | nmdc:mga0qj67_45964_c1 | |||
| 1821 | nmdc:mga06r32_2891_c1 | |||
| 1822 | nmdc:mga06r32_78179_c1 | |||
| 1823 | nmdc:mga08y16_178990_c1 | |||
| 1824 | nmdc:mga08y16_28893_c1 | |||
| 1825 | nmdc:mga08y16_296218_c1 | |||
| 1826 | nmdc:mga08y16_487978_c1 | |||
| 1827 | nmdc:mga08y16_58876_c1 | |||
| 1828 | nmdc:mga08y16_76589_c1 | |||
| 1829 | nmdc:mga08y16_821_c1 | |||
| 1830 | nmdc:mga0n895_163892_c1 | |||
| 1831 | nmdc:mga0n895_726655_c1 | |||
| 1832 | nmdc:mga0rr50_139_c1 | |||
| 1833 | nmdc:mga0rr50_170349_c1 | |||
| 1834 | nmdc:mga0rr50_4236_c1 | |||
| 1835 | nmdc:mga08x19_3622_c1 | |||
| 1836 | nmdc:mga08x19_3_c1 | |||
| 1837 | nmdc:mga0a205_174193_c1 | |||
| 1838 | nmdc:mga0a205_273633_c1 | |||
| 1839 | nmdc:mga0a205_302050_c1 | |||
| 1840 | nmdc:mga0a205_63177_c1 | |||
| 1841 | nmdc:mga0a205_7292_c1 | |||
| 1842 | nmdc:mga0a205_88196_c1 | |||
| 1843 | Ga0495601_0153090 | |||
| 1844 | Ga0500635_0001015 | |||
| 1845 | Ga0500555_000471 | |||
| 1846 | Ga0500608_000203 | |||
| 1847 | Ga0500608_007068 | |||
| 1848 | Ga0500618_000037 | |||
| 1849 | Ga0500618_008815 | |||
| 1850 | Ga0500622_0001600 | |||
| 1851 | Ga0500624_000694 | |||
| 1852 | Ga0590074_040918 | |||
| 1853 | Ga0587085_028233 | |||
| 1854 | Ga0501082_0623385 | |||
| 1855 | Ga0530510_0029172 | |||
| 1856 | 2599477068 | |||
| 1857 | 2722726500 | |||
| 1858 | 2738762616 | |||
| 1859 | 2842906507 | |||
| 1860 | 2852626917 | |||
| 1861 | 2884938030 | |||
| 1862 | 2896319414 | |||
| 1863 | 2904783635 | |||
| 1864 | 2919182186 | |||
| 1865 | 2919442232 | |||
| 1866 | 2928078981 | |||
| 1867 | 2928148652 | |||
| 1868 | 2932085628 | |||
| 1869 | 3003233521 | |||
| 1870 | 8055590801 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.989 | 27 | 249 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9869 | 27 | 249 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9776 | 25 | 250 |
| 5lj9-assembly3.cif.gz_C | structure of the e. coli macb abc domain (c2221) | 0.9749 | 26 | 252 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9713 | 27 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.989 | 27 | 249 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9736 | 55 | 251 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9729 | 28 | 250 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9723 | 27 | 252 | 3.40.50.300 |
| af_Q8T664_36_360_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9722 | 27 | 252 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5S202-F1-model_v4 | deleted | 0.9979 | 28 | 250 |
|
| AF-A0A1Q6ERV0-F1-model_v4 | deleted | 0.9961 | 31 | 250 |
|
| AF-A0A1V4HEF9-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9906 | 28 | 251 |
GO:0005524
GO:0016887 |
| AF-A0A7V4MYJ4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9881 | 25 | 250 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A428XK65-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9869 | 26 | 251 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |