F486156

General Info

Members Datasets Scaffolds Average Seq Length
935 386 1870 246

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000485|Ga0105237_1000048540
Length 288
Sequence MLRDDADDADYCLLSASSAQSIEISASLFLLLTVTKPTSPQSNSKKYMQPLITLKDIGRKYVIGTEIIHALKSVSLTINKGEFVALMGPSGSGKSTLMNILGCLDTPTKGEYILNGINVSHMTDNQLAEVRNEEIGFVFQTFNLLPRNTALDNVALPLVYAGVGKEKRQARAKTSLENVGLGNRVDHKPNELSGGQRQRVAVARALINDPSIILADEPTGNLDTKTSIEIMGLMEDIHKKGNTIILVTHEEDIAMHAHRIVRMRDGLVENDYANTNIITVDRSKATTE

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
203 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
204 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
205 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
331 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
332 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
333 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
334 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
335 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
336 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
337 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
338 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
339 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
340 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
341 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
342 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
347 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
368 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
372 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
373 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
374 2738541284 Pedobacter sp. YR016 Isolate Unclassified
375 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
376 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
377 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
378 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
379 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
380 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
381 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
382 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
383 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
384 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
385 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
386 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.43
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 2.89
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10000485 3300009545 Bacteria 56664
2 SwRhRL2b_contig_731410 2162886007 Bacteria 1251
3 CNAas_1000829 3300000532 Bacteria 2940
4 JGI24741J21665_1012612 3300001915 Bacteria 1448
5 JGI24740J21852_10016887 3300001979 Bacteria 2625
6 JGI24737J22298_10000143 3300001990 Bacteria 22223
7 JGI24735J21928_10000006 3300002067 Bacteria 339303
8 JGI24748J21848_1000051 3300002074 Bacteria 52353
9 JGI24744J21845_10002026 3300002077 Bacteria 4104
10 JGI24034J26672_10000030 3300002239 Bacteria 97515
11 JGI24751J29686_10054973 3300002459 Bacteria 820
12 JGI25162J39368_1000089 3300002737 Bacteria 104054
13 JGI25162J39368_1000498 3300002737 Bacteria 29793
14 JGI25157J39369_1005927 3300002741 Bacteria 1921
15 JGI25165J46597_1000618 3300003214 Bacteria 30063
16 rootH1_10029777 3300003316 Bacteria 8945
17 rootH2_10018591 3300003320 Bacteria 30571
18 rootH2_10039562 3300003320 Bacteria 6649
19 rootH2_10186211 3300003320 Bacteria 1640
20 rootL2_10211276 3300003322 Bacteria 2534
21 rootH1_10010194 3300003323 Bacteria 43591
22 rootH1_10105642 3300003323 Bacteria 3000
23 rootH1_10379396 3300003323 Bacteria 1393
24 Ga0058863_11791471 3300004799 Bacteria 1797
25 Ga0058861_11760232 3300004800 Bacteria 1356
26 Ga0058862_12416007 3300004803 Bacteria 1780
27 Ga0065714_10064422 3300005288 Bacteria 270668
28 Ga0065714_10148595 3300005288 Bacteria 1121
29 Ga0065704_10009526 3300005289 Bacteria 3117
30 Ga0065704_10023815 3300005289 Bacteria 1152
31 Ga0065704_10092483 3300005289 Bacteria 2647
32 Ga0065704_10092834 3300005289 Bacteria 2578
33 Ga0065712_10067728 3300005290 Bacteria 178215
34 Ga0065712_10089641 3300005290 Bacteria 2461
35 Ga0065712_10204759 3300005290 Bacteria 1095
36 Ga0065715_10004474 3300005293 Bacteria 3796
37 Ga0065715_10089181 3300005293 Bacteria 13047
38 Ga0065715_10095696 3300005293 Bacteria 4020
39 Ga0065715_10105987 3300005293 Bacteria 2858
40 Ga0065715_10343798 3300005293 Bacteria 963
41 Ga0065715_10443342 3300005293 Bacteria 833
42 Ga0065707_10091424 3300005295 Bacteria 3950
43 Ga0065707_10190589 3300005295 Bacteria 1363
44 Ga0065707_10246444 3300005295 Bacteria 1139
45 Ga0065707_10322946 3300005295 Bacteria 963
46 Ga0070658_10000018 3300005327 Bacteria 200558
47 Ga0070658_10080753 3300005327 Bacteria 2671
48 Ga0070658_10338790 3300005327 Bacteria 1286
49 Ga0070658_10563895 3300005327 Bacteria 986
50 Ga0070676_10004488 3300005328 Bacteria 7345
51 Ga0070676_10093607 3300005328 Bacteria 1845
52 Ga0070676_10149873 3300005328 Bacteria 1492
53 Ga0070676_10503680 3300005328 Bacteria 860
54 Ga0070683_100301639 3300005329 Bacteria 1524
55 Ga0070690_100054471 3300005330 Bacteria 2561
56 Ga0070690_100219957 3300005330 Bacteria 1330
57 Ga0070690_100225321 3300005330 Bacteria 1315
58 Ga0070670_100000165 3300005331 Bacteria 59984
59 Ga0070670_100000767 3300005331 Bacteria 24964
60 Ga0070670_100224439 3300005331 Bacteria 1635
61 Ga0068869_100035202 3300005334 Bacteria 3548
62 Ga0068869_100080076 3300005334 Bacteria 2436
63 Ga0068869_100090184 3300005334 Bacteria 2303
64 Ga0068869_100165587 3300005334 Bacteria 1724
65 Ga0068869_100184623 3300005334 Bacteria 1636
66 Ga0070680_100302537 3300005336 Bacteria 1356
67 Ga0070680_100458117 3300005336 Bacteria 1089
68 Ga0070682_100041994 3300005337 Bacteria 2821
69 Ga0068868_100013908 3300005338 Bacteria 5917
70 Ga0070660_100091736 3300005339 Bacteria 2396
71 Ga0070689_100000816 3300005340 Bacteria 19247
72 Ga0070689_100023397 3300005340 Bacteria 4624
73 Ga0070689_100779276 3300005340 Bacteria 840
74 Ga0070691_10113953 3300005341 Bacteria 1355
75 Ga0070691_10313527 3300005341 Bacteria 860
76 Ga0070687_100057385 3300005343 Bacteria 2041
77 Ga0070687_100226986 3300005343 Bacteria 1147
78 Ga0070661_100050498 3300005344 Bacteria 3043
79 Ga0070692_10016459 3300005345 Bacteria 3517
80 Ga0070692_10031317 3300005345 Bacteria 2666
81 Ga0070692_10060528 3300005345 Bacteria 1993
82 Ga0070692_10203511 3300005345 Bacteria 1161
83 Ga0070669_100011817 3300005353 Bacteria 6193
84 Ga0070669_100026199 3300005353 Bacteria 4195
85 Ga0070669_100324176 3300005353 Bacteria 1245
86 Ga0070675_100047495 3300005354 Bacteria 3517
87 Ga0070671_100027615 3300005355 Bacteria 4673
88 Ga0070671_100208803 3300005355 Bacteria 1656
89 Ga0070673_100008881 3300005364 Bacteria 6715
90 Ga0070673_100014675 3300005364 Bacteria 5470
91 Ga0070673_100028970 3300005364 Bacteria 4125
92 Ga0070688_100000427 3300005365 Bacteria 21283
93 Ga0070688_100009040 3300005365 Bacteria 5432
94 Ga0070659_100018374 3300005366 Bacteria 5277
95 Ga0070659_100026796 3300005366 Bacteria 4437
96 Ga0070667_100139335 3300005367 Bacteria 2123
97 Ga0070701_10026549 3300005438 Bacteria 2825
98 Ga0070701_10065272 3300005438 Bacteria 1931
99 Ga0070705_100022136 3300005440 Unclassified 3392
100 Ga0070705_100193364 3300005440 Bacteria 1389
101 Ga0070700_100004173 3300005441 Bacteria 7533
102 Ga0070700_100118473 3300005441 Bacteria 1770
103 Ga0070700_100138605 3300005441 Bacteria 1650
104 Ga0070700_100199413 3300005441 Bacteria 1405
105 Ga0070694_100005028 3300005444 Bacteria 7979
106 Ga0070694_100029319 3300005444 Bacteria 3590
107 Ga0070694_100067292 3300005444 Bacteria 2459
108 Ga0070694_100200135 3300005444 Bacteria 1488
109 Ga0070694_100210428 3300005444 Bacteria 1454
110 Ga0070694_100359661 3300005444 Bacteria 1130
111 Ga0070694_100696880 3300005444 Bacteria 826
112 Ga0070708_100002619 3300005445 Bacteria 13932
113 Ga0070708_100259342 3300005445 Bacteria 1634
114 Ga0070708_100329329 3300005445 Bacteria 1439
115 Ga0070708_100369972 3300005445 Bacteria 1351
116 Ga0070678_100018207 3300005456 Bacteria 4549
117 Ga0070678_100110744 3300005456 Bacteria 2147
118 Ga0070662_100000626 3300005457 Bacteria 21383
119 Ga0070662_100173729 3300005457 Bacteria 1694
120 Ga0070681_10001768 3300005458 Bacteria 19378
121 Ga0070681_10022542 3300005458 Bacteria 6324
122 Ga0070681_10029377 3300005458 Bacteria 5520
123 Ga0068867_100016777 3300005459 Bacteria 5203
124 Ga0068867_100219256 3300005459 Bacteria 1532
125 Ga0068867_100512828 3300005459 Bacteria 1033
126 Ga0070706_100000128 3300005467 Bacteria 92969
127 Ga0070706_100005626 3300005467 Bacteria 11923
128 Ga0070706_100018438 3300005467 Bacteria 6437
129 Ga0070706_100037115 3300005467 Bacteria 4502
130 Ga0070706_100049046 3300005467 Bacteria 3897
131 Ga0070706_100093641 3300005467 Bacteria 2788
132 Ga0070706_100223588 3300005467 Bacteria 1757
133 Ga0070706_100539125 3300005467 Bacteria 1085
134 Ga0070707_100006408 3300005468 Bacteria 10942
135 Ga0070707_100029831 3300005468 Bacteria 5191
136 Ga0070707_100078663 3300005468 Bacteria 3182
137 Ga0070707_100180455 3300005468 Bacteria 2058
138 Ga0070707_100180813 3300005468 Bacteria 2056
139 Ga0070707_100768365 3300005468 Bacteria 927
140 Ga0070698_100000663 3300005471 Bacteria 36731
141 Ga0070698_100004577 3300005471 Bacteria 15185
142 Ga0070698_100005014 3300005471 Bacteria 14509
143 Ga0070698_100051295 3300005471 Bacteria 4202
144 Ga0070698_100053534 3300005471 Bacteria 4101
145 Ga0070698_100185010 3300005471 Bacteria 2021
146 Ga0070698_100209354 3300005471 Bacteria 1885
147 Ga0070699_100001336 3300005518 Bacteria 22693
148 Ga0070699_100014592 3300005518 Bacteria 6757
149 Ga0070699_100049669 3300005518 Bacteria 3631
150 Ga0070699_100576079 3300005518 Bacteria 1025
151 Ga0070679_100008363 3300005530 Bacteria 9736
152 Ga0070679_100111586 3300005530 Bacteria 2721
153 Ga0070697_100003936 3300005536 Bacteria 11413
154 Ga0070697_100036822 3300005536 Bacteria 3952
155 Ga0070697_100063878 3300005536 Bacteria 3007
156 Ga0070697_100094122 3300005536 Bacteria 2482
157 Ga0070697_100101472 3300005536 Bacteria 2391
158 Ga0070697_100182476 3300005536 Bacteria 1779
159 Ga0070697_100213432 3300005536 Bacteria 1643
160 Ga0070697_100259760 3300005536 Bacteria 1487
161 Ga0068853_100014510 3300005539 Bacteria 6455
162 Ga0068853_100019819 3300005539 Bacteria 5586
163 Ga0068853_100167119 3300005539 Bacteria 1988
164 Ga0068853_100234649 3300005539 Bacteria 1679
165 Ga0068853_100695547 3300005539 Bacteria 969
166 Ga0070672_100019003 3300005543 Bacteria 4980
167 Ga0070672_100104518 3300005543 Bacteria 2301
168 Ga0070672_100124054 3300005543 Bacteria 2117
169 Ga0070672_100235441 3300005543 Bacteria 1539
170 Ga0070686_100011130 3300005544 Bacteria 5096
171 Ga0070686_100014560 3300005544 Bacteria 4538
172 Ga0070695_100011147 3300005545 Bacteria 5374
173 Ga0070695_100035049 3300005545 Bacteria 3151
174 Ga0070695_100051867 3300005545 Bacteria 2634
175 Ga0070695_100172942 3300005545 Bacteria 1525
176 Ga0070695_100174986 3300005545 Bacteria 1517
177 Ga0070695_100356052 3300005545 Bacteria 1098
178 Ga0070696_100008944 3300005546 Bacteria 6701
179 Ga0070696_100123279 3300005546 Bacteria 1878
180 Ga0070693_100031294 3300005547 Bacteria 2914
181 Ga0070693_100303516 3300005547 Bacteria 1077
182 Ga0070665_100000072 3300005548 Bacteria 198575
183 Ga0070665_100149900 3300005548 Bacteria 2335
184 Ga0070704_100031410 3300005549 Bacteria 3572
185 Ga0070704_100098350 3300005549 Bacteria 2198
186 Ga0070704_100288435 3300005549 Bacteria 1363
187 Ga0068855_100000070 3300005563 Bacteria 123584
188 Ga0068855_100000268 3300005563 Bacteria 64693
189 Ga0068855_100012445 3300005563 Bacteria 10276
190 Ga0068855_100063242 3300005563 Bacteria 4319
191 Ga0068855_100152225 3300005563 Bacteria 2630
192 Ga0068855_100204197 3300005563 Bacteria 2224
193 Ga0068855_100416203 3300005563 Bacteria 1471
194 Ga0070664_100004294 3300005564 Bacteria 11459
195 Ga0070664_100025146 3300005564 Bacteria 4933
196 Ga0070664_100461099 3300005564 Bacteria 1168
197 Ga0070664_100549184 3300005564 Bacteria 1068
198 Ga0068857_100006559 3300005577 Bacteria 9988
199 Ga0068857_100127604 3300005577 Bacteria 2292
200 Ga0068857_100164685 3300005577 Bacteria 2013
201 Ga0068857_100578922 3300005577 Bacteria 1059
202 Ga0068854_100095077 3300005578 Bacteria 2224
203 Ga0068854_100271233 3300005578 Bacteria 1362
204 Ga0068856_100000897 3300005614 Bacteria 31872
205 Ga0068856_100003887 3300005614 Bacteria 14987
206 Ga0068856_100005676 3300005614 Bacteria 12288
207 Ga0068856_100009016 3300005614 Bacteria 9706
208 Ga0068856_100013111 3300005614 Bacteria 8029
209 Ga0068856_100194332 3300005614 Bacteria 2043
210 Ga0070702_100001061 3300005615 Bacteria 10965
211 Ga0070702_100184429 3300005615 Bacteria 1368
212 Ga0070702_100340747 3300005615 Bacteria 1052
213 Ga0068852_100017595 3300005616 Bacteria 5613
214 Ga0068852_100230360 3300005616 Bacteria 1766
215 Ga0068859_100054835 3300005617 Bacteria 4010
216 Ga0068859_100079747 3300005617 Bacteria 3314
217 Ga0068859_100112551 3300005617 Bacteria 2785
218 Ga0068859_100169538 3300005617 Bacteria 2264
219 Ga0068859_100287541 3300005617 Bacteria 1737
220 Ga0068859_100411653 3300005617 Bacteria 1448
221 Ga0068864_100002141 3300005618 Bacteria 16331
222 Ga0068864_100034796 3300005618 Bacteria 4286
223 Ga0068864_100106485 3300005618 Bacteria 2493
224 Ga0068864_100652402 3300005618 Bacteria 1025
225 Ga0068866_10012210 3300005718 Bacteria 3741
226 Ga0068866_10017052 3300005718 Bacteria 3260
227 Ga0068861_100002200 3300005719 Bacteria 12657
228 Ga0068861_100126572 3300005719 Bacteria 2068
229 Ga0068861_100512790 3300005719 Bacteria 1086
230 Ga0068870_10064483 3300005840 Unclassified 1979
231 Ga0068870_10203280 3300005840 Bacteria 1202
232 Ga0068863_100092530 3300005841 Bacteria 2868
233 Ga0068863_100210158 3300005841 Bacteria 1874
234 Ga0068863_100257220 3300005841 Bacteria 1687
235 Ga0068858_100000405 3300005842 Bacteria 44934
236 Ga0068858_100014535 3300005842 Bacteria 7417
237 Ga0068858_100058092 3300005842 Bacteria 3576
238 Ga0068858_100068571 3300005842 Bacteria 3287
239 Ga0068858_100089413 3300005842 Bacteria 2866
240 Ga0068858_100269722 3300005842 Bacteria 1619
241 Ga0068860_100002487 3300005843 Bacteria 19327
242 Ga0068860_100027839 3300005843 Bacteria 5443
243 Ga0068860_100096792 3300005843 Bacteria 2813
244 Ga0068860_100195015 3300005843 Bacteria 1961
245 Ga0068862_100033821 3300005844 Bacteria 4323
246 Ga0068862_100038785 3300005844 Bacteria 4042
247 Ga0068862_100102426 3300005844 Bacteria 2506
248 Ga0081455_10422222 3300005937 Bacteria 919
249 Ga0081540_1097925 3300005983 Bacteria 1271
250 Ga0081539_10000858 3300005985 Bacteria 58194
251 Ga0070715_10000024 3300006163 Bacteria 110647
252 Ga0070716_100015207 3300006173 Bacteria 3950
253 Ga0075366_10001711 3300006195 Bacteria 11028
254 Ga0097621_100000028 3300006237 Bacteria 71678
255 Ga0097621_100003157 3300006237 Bacteria 11316
256 Ga0097621_100006010 3300006237 Bacteria 8579
257 Ga0068871_100006906 3300006358 Bacteria 8084
258 Ga0068871_100024567 3300006358 Bacteria 4674
259 Ga0068871_100037044 3300006358 Bacteria 3888
260 Ga0075430_100014761 3300006846 Bacteria 6651
261 Ga0075430_100017128 3300006846 Bacteria 6171
262 Ga0075430_100066766 3300006846 Bacteria 3021
263 Ga0075430_100088661 3300006846 Bacteria 2589
264 Ga0075431_100095920 3300006847 Bacteria 3062
265 Ga0075431_100166135 3300006847 Bacteria 2268
266 Ga0075433_10015116 3300006852 Bacteria 6323
267 Ga0075433_10021849 3300006852 Bacteria 5368
268 Ga0075433_10049863 3300006852 Bacteria 3642
269 Ga0075433_10282341 3300006852 Bacteria 1471
270 Ga0075433_10366468 3300006852 Bacteria 1272
271 Ga0075434_100000831 3300006871 Bacteria 24539
272 Ga0075434_100010744 3300006871 Bacteria 8599
273 Ga0075434_100147427 3300006871 Bacteria 2373
274 Ga0075434_100160548 3300006871 Bacteria 2267
275 Ga0075434_100706617 3300006871 Bacteria 1025
276 Ga0075429_100011725 3300006880 Bacteria 7604
277 Ga0075429_100018935 3300006880 Bacteria 5963
278 Ga0075429_100031368 3300006880 Bacteria 4619
279 Ga0075429_100092571 3300006880 Bacteria 2637
280 Ga0075429_100234498 3300006880 Bacteria 1607
281 Ga0068865_100000127 3300006881 Bacteria 39327
282 Ga0068865_100032927 3300006881 Bacteria 3468
283 Ga0068865_100071929 3300006881 Bacteria 2455
284 Ga0068865_100305617 3300006881 Bacteria 1274
285 Ga0075436_100000020 3300006914 Bacteria 124822
286 Ga0075436_100327712 3300006914 Bacteria 1101
287 Ga0075436_100389832 3300006914 Bacteria 1008
288 Ga0097620_100011064 3300006931 Bacteria 9075
289 Ga0097620_100054836 3300006931 Bacteria 4010
290 Ga0097620_100079748 3300006931 Bacteria 3314
291 Ga0097620_100112549 3300006931 Bacteria 2785
292 Ga0097620_100169531 3300006931 Bacteria 2264
293 Ga0097620_100287541 3300006931 Bacteria 1737
294 Ga0097620_100411662 3300006931 Bacteria 1448
295 Ga0075435_100000165 3300007076 Bacteria 38337
296 Ga0075435_100032986 3300007076 Bacteria 4092
297 Ga0075435_100095774 3300007076 Bacteria 2455
298 Ga0075435_100281110 3300007076 Bacteria 1421
299 Ga0099794_10001218 3300007265 Bacteria 8883
300 Ga0105251_10061955 3300009011 Bacteria 1758
301 Ga0105251_10116981 3300009011 Bacteria 1212
302 Ga0105240_10000237 3300009093 Bacteria 109895
303 Ga0105240_10014965 3300009093 Bacteria 10571
304 Ga0105240_10020594 3300009093 Bacteria 8792
305 Ga0105240_10048025 3300009093 Bacteria 5397
306 Ga0105240_10187598 3300009093 Bacteria 2434
307 Ga0105240_10227132 3300009093 Bacteria 2171
308 Ga0105240_10365364 3300009093 Bacteria 1633
309 Ga0105240_11082324 3300009093 Bacteria 854
310 Ga0111539_10079406 3300009094 Bacteria 3860
311 Ga0111539_10211199 3300009094 Bacteria 2261
312 Ga0105245_10243938 3300009098 Bacteria 1743
313 Ga0105245_10607140 3300009098 Bacteria 1121
314 Ga0105247_10000153 3300009101 Bacteria 67393
315 Ga0105247_10005769 3300009101 Bacteria 7752
316 Ga0105247_10009777 3300009101 Bacteria 5813
317 Ga0114129_10007783 3300009147 Bacteria 15246
318 Ga0114129_10018669 3300009147 Bacteria 9874
319 Ga0114129_10213288 3300009147 Bacteria 2609
320 Ga0114129_10654159 3300009147 Bacteria 1356
321 Ga0114129_10843987 3300009147 Bacteria 1165
322 Ga0105243_10000785 3300009148 Bacteria 30459
323 Ga0105243_10080793 3300009148 Bacteria 2652
324 Ga0105243_10133231 3300009148 Bacteria 2111
325 Ga0105243_10189222 3300009148 Bacteria 1796
326 Ga0105243_10298058 3300009148 Bacteria 1460
327 Ga0105241_10535967 3300009174 Bacteria 1049
328 Ga0105242_10001383 3300009176 Bacteria 19124
329 Ga0105242_10029494 3300009176 Bacteria 4376
330 Ga0105242_10187229 3300009176 Bacteria 1830
331 Ga0105242_10256131 3300009176 Bacteria 1579
332 Ga0105248_10015522 3300009177 Bacteria 8397
333 Ga0105248_10015913 3300009177 Bacteria 8284
334 Ga0105248_10165246 3300009177 Bacteria 2495
335 Ga0105237_10000224 3300009545 Bacteria 79854
336 Ga0105237_10001308 3300009545 Bacteria 33108
337 Ga0105237_10037976 3300009545 Bacteria 4865
338 Ga0105237_10041051 3300009545 Bacteria 4667
339 Ga0105237_10065000 3300009545 Bacteria 3644
340 Ga0105237_10093882 3300009545 Bacteria 2989
341 Ga0105237_10279937 3300009545 Bacteria 1671
342 Ga0105237_10385476 3300009545 Bacteria 1406
343 Ga0105237_10411591 3300009545 Bacteria 1357
344 Ga0105237_10442625 3300009545 Bacteria 1305
345 Ga0105237_10553924 3300009545 Bacteria 1156
346 Ga0105238_10133400 3300009551 Bacteria 2461
347 Ga0105238_11076560 3300009551 Bacteria 826
348 Ga0105249_10013986 3300009553 Bacteria 7094
349 Ga0105249_10063134 3300009553 Bacteria 3402
350 Ga0105249_10087773 3300009553 Bacteria 2903
351 Ga0105249_10237828 3300009553 Bacteria 1799
352 Ga0105239_10000039 3300010375 Bacteria 203537
353 Ga0105239_10000120 3300010375 Bacteria 110003
354 Ga0105239_10004436 3300010375 Bacteria 16776
355 Ga0105239_10005560 3300010375 Bacteria 14739
356 Ga0105239_10012917 3300010375 Bacteria 9289
357 Ga0105239_10013753 3300010375 Bacteria 8983
358 Ga0105239_10023687 3300010375 Bacteria 6759
359 Ga0105239_10025250 3300010375 Bacteria 6543
360 Ga0105239_10146195 3300010375 Bacteria 2636
361 Ga0105239_10826509 3300010375 Bacteria 1062
362 Ga0105246_10039466 3300011119 Bacteria 3181
363 Ga0105246_10172179 3300011119 Bacteria 1659
364 Ga0157373_10000208 3300013100 Bacteria 48082
365 Ga0157373_10076454 3300013100 Bacteria 2362
366 Ga0157373_10170348 3300013100 Bacteria 1532
367 Ga0157371_10000263 3300013102 Bacteria 71557
368 Ga0157370_10095584 3300013104 Bacteria 2788
369 Ga0157369_10617552 3300013105 Bacteria 1119
370 Ga0157374_10001845 3300013296 Bacteria 17834
371 Ga0157374_10044113 3300013296 Bacteria 4121
372 Ga0157374_10155428 3300013296 Bacteria 2226
373 Ga0157374_10357088 3300013296 Bacteria 1453
374 Ga0157378_10000002 3300013297 Bacteria 222652
375 Ga0157378_10009280 3300013297 Bacteria 8570
376 Ga0157378_10010199 3300013297 Bacteria 8198
377 Ga0157378_10039044 3300013297 Bacteria 4210
378 Ga0157378_10043262 3300013297 Bacteria 3999
379 Ga0157378_10046779 3300013297 Bacteria 3845
380 Ga0157378_10235654 3300013297 Bacteria 1746
381 Ga0157378_10322829 3300013297 Bacteria 1500
382 Ga0163162_10000010 3300013306 Bacteria 302032
383 Ga0163162_10003107 3300013306 Bacteria 15857
384 Ga0163162_10005005 3300013306 Bacteria 12766
385 Ga0163162_10010070 3300013306 Bacteria 9190
386 Ga0163162_10013931 3300013306 Bacteria 7855
387 Ga0163162_10016331 3300013306 Bacteria 7257
388 Ga0163162_10033657 3300013306 Bacteria 5093
389 Ga0163162_10064255 3300013306 Bacteria 3715
390 Ga0163162_10110885 3300013306 Bacteria 2841
391 Ga0163162_10610738 3300013306 Bacteria 1216
392 Ga0163162_10727211 3300013306 Bacteria 1113
393 Ga0157372_10000050 3300013307 Bacteria 140381
394 Ga0157372_10000635 3300013307 Bacteria 38523
395 Ga0157372_10001419 3300013307 Bacteria 25842
396 Ga0157372_10002231 3300013307 Bacteria 21022
397 Ga0157372_10189979 3300013307 Bacteria 2379
398 Ga0157372_10403929 3300013307 Bacteria 1592
399 Ga0157375_10007015 3300013308 Bacteria 9838
400 Ga0157375_10021385 3300013308 Bacteria 5930
401 Ga0157375_10055045 3300013308 Bacteria 3921
402 Ga0157375_11236598 3300013308 Bacteria 877
403 Ga0163163_10002079 3300014325 Bacteria 16899
404 Ga0163163_10004729 3300014325 Bacteria 11666
405 Ga0163163_10014695 3300014325 Bacteria 7200
406 Ga0163163_10018317 3300014325 Bacteria 6552
407 Ga0163163_10215737 3300014325 Bacteria 1968
408 Ga0157380_10001101 3300014326 Bacteria 17410
409 Ga0157380_10012995 3300014326 Bacteria 6054
410 Ga0157380_10027529 3300014326 Bacteria 4324
411 Ga0157380_10093550 3300014326 Bacteria 2486
412 Ga0157380_10534322 3300014326 Bacteria 1147
413 Ga0157380_10925475 3300014326 Bacteria 900
414 Ga0157380_11116714 3300014326 Bacteria 828
415 Ga0157379_10047882 3300014968 Bacteria 3815
416 Ga0157379_10059280 3300014968 Bacteria 3422
417 Ga0157376_10027794 3300014969 Bacteria 4489
418 Ga0182006_1091847 3300015261 Bacteria 1091
419 Ga0163161_10027541 3300017792 Bacteria 4032
420 Ga0207672_1000067 3300025223 Bacteria 14045
421 Ga0207427_100172 3300025231 Bacteria 71550
422 Ga0209437_100034 3300025233 Bacteria 494007
423 Ga0209437_100221 3300025233 Bacteria 104135
424 Ga0209026_1000728 3300025250 Bacteria 19168
425 Ga0209026_1003634 3300025250 Bacteria 4952
426 Ga0209026_1015127 3300025250 Bacteria 1272
427 Ga0209148_1017175 3300025254 Bacteria 1232
428 Ga0209233_1000038 3300025261 Bacteria 548972
429 Ga0209233_1001428 3300025261 Bacteria 9422
430 Ga0209233_1013109 3300025261 Bacteria 2377
431 Ga0209233_1019675 3300025261 Bacteria 1789
432 Ga0209455_1000861 3300025272 Bacteria 16150
433 Ga0207710_10000001 3300025900 Bacteria 1797433
434 Ga0207710_10000702 3300025900 Bacteria 18777
435 Ga0207710_10071792 3300025900 Bacteria 1589
436 Ga0207688_10102635 3300025901 Bacteria 1653
437 Ga0207647_10000076 3300025904 Bacteria 75824
438 Ga0207647_10002660 3300025904 Bacteria 13488
439 Ga0207647_10101115 3300025904 Bacteria 1710
440 Ga0207647_10150889 3300025904 Bacteria 1358
441 Ga0207685_10000018 3300025905 Bacteria 145715
442 Ga0207645_10017477 3300025907 Bacteria 4734
443 Ga0207645_10087794 3300025907 Bacteria 1998
444 Ga0207705_10000036 3300025909 Bacteria 200787
445 Ga0207684_10000150 3300025910 Bacteria 121849
446 Ga0207684_10004744 3300025910 Bacteria 12740
447 Ga0207684_10007514 3300025910 Bacteria 9807
448 Ga0207684_10017828 3300025910 Bacteria 6088
449 Ga0207684_10022905 3300025910 Bacteria 5334
450 Ga0207684_10121834 3300025910 Bacteria 2236
451 Ga0207684_10297695 3300025910 Bacteria 1391
452 Ga0207684_10361659 3300025910 Bacteria 1249
453 Ga0207654_10103132 3300025911 Bacteria 1761
454 Ga0207654_10118633 3300025911 Bacteria 1657
455 Ga0207654_10425683 3300025911 Bacteria 927
456 Ga0207707_10000016 3300025912 Bacteria 256002
457 Ga0207707_10030350 3300025912 Bacteria 4729
458 Ga0207707_10268130 3300025912 Bacteria 1480
459 Ga0207695_10000013 3300025913 Bacteria 821265
460 Ga0207695_10004656 3300025913 Bacteria 18589
461 Ga0207695_10016549 3300025913 Bacteria 8620
462 Ga0207695_10033191 3300025913 Bacteria 5637
463 Ga0207695_10058909 3300025913 Bacteria 3985
464 Ga0207695_10318305 3300025913 Bacteria 1445
465 Ga0207671_10002707 3300025914 Bacteria 18581
466 Ga0207671_10011004 3300025914 Bacteria 7407
467 Ga0207671_10011316 3300025914 Bacteria 7272
468 Ga0207671_10024807 3300025914 Bacteria 4506
469 Ga0207671_10037577 3300025914 Bacteria 3590
470 Ga0207660_10000805 3300025917 Bacteria 20711
471 Ga0207660_10032391 3300025917 Bacteria 3608
472 Ga0207660_10119374 3300025917 Bacteria 1995
473 Ga0207662_10106779 3300025918 Bacteria 1742
474 Ga0207662_10253872 3300025918 Bacteria 1155
475 Ga0207662_10305117 3300025918 Bacteria 1059
476 Ga0207657_10020956 3300025919 Bacteria 6166
477 Ga0207649_10034440 3300025920 Bacteria 3034
478 Ga0207649_10177370 3300025920 Bacteria 1489
479 Ga0207652_10000693 3300025921 Bacteria 32703
480 Ga0207652_10298145 3300025921 Bacteria 1455
481 Ga0207646_10004823 3300025922 Bacteria 14455
482 Ga0207646_10026415 3300025922 Bacteria 5298
483 Ga0207646_10073942 3300025922 Bacteria 3045
484 Ga0207646_10298506 3300025922 Bacteria 1455
485 Ga0207681_10012288 3300025923 Bacteria 5281
486 Ga0207681_10264841 3300025923 Bacteria 1347
487 Ga0207694_10049255 3300025924 Bacteria 3261
488 Ga0207694_10146670 3300025924 Bacteria 1900
489 Ga0207650_10000011 3300025925 Bacteria 450115
490 Ga0207650_10002299 3300025925 Bacteria 13320
491 Ga0207659_10013295 3300025926 Bacteria 5266
492 Ga0207644_10000882 3300025931 Bacteria 18926
493 Ga0207644_10062324 3300025931 Bacteria 2704
494 Ga0207644_10073528 3300025931 Bacteria 2507
495 Ga0207644_10096507 3300025931 Bacteria 2213
496 Ga0207644_10263654 3300025931 Bacteria 1378
497 Ga0207644_10425065 3300025931 Bacteria 1089
498 Ga0207690_10011536 3300025932 Bacteria 5278
499 Ga0207690_10015769 3300025932 Bacteria 4586
500 Ga0207706_10006487 3300025933 Bacteria 10861
501 Ga0207706_10178930 3300025933 Bacteria 1863
502 Ga0207686_10000952 3300025934 Bacteria 17283
503 Ga0207709_10000524 3300025935 Bacteria 33443
504 Ga0207709_10002326 3300025935 Bacteria 12000
505 Ga0207709_10036889 3300025935 Bacteria 2900
506 Ga0207709_10264132 3300025935 Bacteria 1264
507 Ga0207670_10000065 3300025936 Bacteria 75480
508 Ga0207670_10035418 3300025936 Bacteria 3236
509 Ga0207704_10000044 3300025938 Bacteria 86753
510 Ga0207704_10013016 3300025938 Bacteria 4148
511 Ga0207704_10101785 3300025938 Bacteria 1917
512 Ga0207704_10211159 3300025938 Bacteria 1429
513 Ga0207691_10005500 3300025940 Bacteria 12241
514 Ga0207691_10056180 3300025940 Bacteria 3587
515 Ga0207691_10237566 3300025940 Bacteria 1576
516 Ga0207691_10265208 3300025940 Bacteria 1480
517 Ga0207711_10013164 3300025941 Bacteria 6870
518 Ga0207711_10018170 3300025941 Bacteria 5845
519 Ga0207689_10009519 3300025942 Bacteria 8385
520 Ga0207689_10024086 3300025942 Bacteria 5106
521 Ga0207689_10026884 3300025942 Bacteria 4816
522 Ga0207689_10041222 3300025942 Bacteria 3820
523 Ga0207689_10041530 3300025942 Bacteria 3806
524 Ga0207689_10064294 3300025942 Bacteria 3019
525 Ga0207689_10066062 3300025942 Bacteria 2975
526 Ga0207689_10270225 3300025942 Bacteria 1407
527 Ga0207689_10380763 3300025942 Bacteria 1175
528 Ga0207679_10001977 3300025945 Bacteria 12712
529 Ga0207679_10025207 3300025945 Bacteria 4087
530 Ga0207679_10414295 3300025945 Bacteria 1188
531 Ga0207679_10547559 3300025945 Bacteria 1038
532 Ga0207667_10000009 3300025949 Bacteria 603135
533 Ga0207667_10000971 3300025949 Bacteria 36600
534 Ga0207667_10051802 3300025949 Bacteria 4326
535 Ga0207667_10085702 3300025949 Bacteria 3261
536 Ga0207667_10205066 3300025949 Bacteria 2022
537 Ga0207667_10553159 3300025949 Bacteria 1164
538 Ga0207667_10758902 3300025949 Bacteria 969
539 Ga0207651_10016587 3300025960 Bacteria 4321
540 Ga0207651_10018113 3300025960 Bacteria 4182
541 Ga0207651_10030254 3300025960 Bacteria 3445
542 Ga0207651_10042500 3300025960 Bacteria 3026
543 Ga0207651_10095736 3300025960 Bacteria 2187
544 Ga0207651_10104905 3300025960 Bacteria 2107
545 Ga0207651_10397315 3300025960 Bacteria 1172
546 Ga0207712_10027437 3300025961 Bacteria 3802
547 Ga0207712_10075328 3300025961 Bacteria 2439
548 Ga0207712_10142459 3300025961 Bacteria 1841
549 Ga0207712_10476213 3300025961 Bacteria 1063
550 Ga0207668_10338072 3300025972 Bacteria 1255
551 Ga0207640_10177008 3300025981 Bacteria 1596
552 Ga0207640_10267992 3300025981 Bacteria 1334
553 Ga0207658_10101237 3300025986 Bacteria 2257
554 Ga0207658_10234206 3300025986 Bacteria 1552
555 Ga0207677_10089034 3300026023 Bacteria 2240
556 Ga0207677_10104836 3300026023 Bacteria 2091
557 Ga0207703_10000045 3300026035 Bacteria 156669
558 Ga0207703_10097306 3300026035 Bacteria 2486
559 Ga0207703_10102201 3300026035 Bacteria 2432
560 Ga0207703_10424570 3300026035 Bacteria 1238
561 Ga0207639_10004531 3300026041 Bacteria 9364
562 Ga0207639_10015887 3300026041 Bacteria 5316
563 Ga0207639_10018588 3300026041 Bacteria 4943
564 Ga0207639_10547352 3300026041 Bacteria 1062
565 Ga0207678_10021588 3300026067 Bacteria 5646
566 Ga0207708_10003530 3300026075 Bacteria 11518
567 Ga0207708_10039998 3300026075 Bacteria 3574
568 Ga0207708_10184541 3300026075 Bacteria 1657
569 Ga0207708_10664032 3300026075 Bacteria 888
570 Ga0207702_10000507 3300026078 Bacteria 43964
571 Ga0207702_10005892 3300026078 Bacteria 10658
572 Ga0207702_10011829 3300026078 Bacteria 7263
573 Ga0207702_10038199 3300026078 Bacteria 4021
574 Ga0207702_10056941 3300026078 Bacteria 3320
575 Ga0207702_10499778 3300026078 Bacteria 1185
576 Ga0207641_10073847 3300026088 Bacteria 2940
577 Ga0207641_10175600 3300026088 Bacteria 1959
578 Ga0207641_10669928 3300026088 Bacteria 1020
579 Ga0207648_10000529 3300026089 Bacteria 42805
580 Ga0207648_10228044 3300026089 Bacteria 1656
581 Ga0207648_10308551 3300026089 Bacteria 1420
582 Ga0207648_10317344 3300026089 Bacteria 1400
583 Ga0207676_10085282 3300026095 Bacteria 2577
584 Ga0207676_10090487 3300026095 Bacteria 2511
585 Ga0207676_10710559 3300026095 Bacteria 974
586 Ga0207676_10833183 3300026095 Bacteria 901
587 Ga0207674_10020588 3300026116 Bacteria 7123
588 Ga0207674_10123397 3300026116 Bacteria 2556
589 Ga0207674_10145605 3300026116 Bacteria 2328
590 Ga0207674_10483995 3300026116 Bacteria 1196
591 Ga0207675_100000849 3300026118 Bacteria 30412
592 Ga0207675_100004603 3300026118 Bacteria 13293
593 Ga0207675_100144676 3300026118 Bacteria 2260
594 Ga0207675_100184473 3300026118 Bacteria 1999
595 Ga0207675_100484499 3300026118 Bacteria 1230
596 Ga0207683_10031312 3300026121 Bacteria 4616
597 Ga0207683_10273793 3300026121 Bacteria 1542
598 Ga0207698_10005251 3300026142 Bacteria 7971
599 Ga0207698_10117485 3300026142 Bacteria 2244
600 Ga0209588_1010709 3300027671 Bacteria 2761
601 Ga0209974_10003508 3300027876 Bacteria 5647
602 Ga0207428_10001623 3300027907 Bacteria 23347
603 Ga0207428_10117762 3300027907 Bacteria 2039
604 Ga0207428_10135769 3300027907 Bacteria 1880
605 Ga0268266_10000089 3300028379 Bacteria 198566
606 Ga0268266_10088905 3300028379 Bacteria 2704
607 Ga0268265_10018602 3300028380 Bacteria 4818
608 Ga0268265_10026095 3300028380 Bacteria 4153
609 Ga0268265_10026318 3300028380 Bacteria 4138
610 Ga0268265_10355986 3300028380 Bacteria 1338
611 Ga0268264_10007034 3300028381 Bacteria 9436
612 Ga0268264_10069792 3300028381 Bacteria 2973
613 Ga0268264_10080774 3300028381 Bacteria 2777
614 Ga0268264_10128605 3300028381 Bacteria 2242
615 Ga0307517_10003551 3300028786 Bacteria 24219
616 Ga0307515_10001481 3300028794 Bacteria 52778
617 Ga0307515_10001997 3300028794 Bacteria 45190
618 Ga0307515_10100898 3300028794 Bacteria 3490
619 Ga0265338_10015871 3300028800 Bacteria 8244
620 Ga0316177_1009900 3300030731 Bacteria 5129
621 Ga0316176_1141979 3300030732 Bacteria 21893
622 Ga0316183_1118483 3300030742 Bacteria 38677
623 Ga0316181_1033622 3300030744 Bacteria 4944
624 Ga0265339_10084041 3300031249 Bacteria 1678
625 Ga0265331_10075889 3300031250 Bacteria 1567
626 Ga0265316_10220112 3300031344 Bacteria 1401
627 Ga0307408_100016223 3300031548 Bacteria 4967
628 Ga0307408_100058015 3300031548 Bacteria 2813
629 Ga0307408_100149571 3300031548 Bacteria 1842
630 Ga0316579_10043400 3300031691 Bacteria 2092
631 Ga0316576_10127932 3300031727 Bacteria 1910
632 Ga0307405_10001983 3300031731 Bacteria 8851
633 Ga0307405_10058440 3300031731 Bacteria 2427
634 Ga0307413_10001627 3300031824 Bacteria 8700
635 Ga0307413_10036294 3300031824 Bacteria 2836
636 Ga0307410_10002169 3300031852 Bacteria 9326
637 Ga0307410_10390195 3300031852 Bacteria 1122
638 Ga0307410_10435734 3300031852 Bacteria 1066
639 Ga0307406_10042010 3300031901 Bacteria 2853
640 Ga0307406_10091712 3300031901 Bacteria 2047
641 Ga0307406_10441028 3300031901 Bacteria 1042
642 Ga0307407_10067696 3300031903 Bacteria 2112
643 Ga0307412_10045347 3300031911 Bacteria 2873
644 Ga0307412_10052264 3300031911 Bacteria 2705
645 Ga0307412_10077908 3300031911 Bacteria 2281
646 Ga0307412_10284247 3300031911 Bacteria 1300
647 Ga0307412_10406460 3300031911 Bacteria 1110
648 Ga0307409_100007363 3300031995 Bacteria 6576
649 Ga0307409_100056497 3300031995 Bacteria 3036
650 Ga0307409_100817175 3300031995 Bacteria 941
651 Ga0307416_100001756 3300032002 Bacteria 12005
652 Ga0307416_100013314 3300032002 Bacteria 5587
653 Ga0307416_100042843 3300032002 Bacteria 3538
654 Ga0307414_10041283 3300032004 Bacteria 3124
655 Ga0307411_10000610 3300032005 Bacteria 12858
656 Ga0307411_10121123 3300032005 Bacteria 1893
657 Ga0307411_10256934 3300032005 Bacteria 1377
658 Ga0307415_100051090 3300032126 Bacteria 2804
659 Ga0307415_100117087 3300032126 Bacteria 1989
660 Ga0307415_100151684 3300032126 Bacteria 1784
661 Ga0307415_100405665 3300032126 Bacteria 1165
662 Ga0316585_10039603 3300032137 Bacteria 1499
663 Ga0316580_10007805 3300032139 Bacteria 3194
664 Ga0307507_10000015 3300033179 Bacteria 237419
665 Ga0373940_0085463 3300035088 Bacteria 939
666 Ga0373951_0004432 3300035091 Bacteria 3336
667 Ga0373941_0107012 3300035115 Bacteria 981
668 Ga0373942_0019143 3300035207 Bacteria 1706
669 Ga0373962_0030121 3300035242 Bacteria 1483
670 Ga0373937_0110636 3300036401 Bacteria 2555
671 Ga0373937_0273069 3300036401 Bacteria 1596
672 Ga0373937_0498038 3300036401 Bacteria 1158
673 Ga0316582_0022813 3300036647 Bacteria 3722
674 Ga0316584_0052688 3300036712 Bacteria 3043
675 Ga0316584_0057497 3300036712 Bacteria 2911
676 Ga0395899_0000033 3300037312 Bacteria 306589
677 Ga0395899_0000659 3300037312 Bacteria 35170
678 Ga0395899_0001109 3300037312 Bacteria 24123
679 Ga0395899_0021085 3300037312 Bacteria 4942
680 Ga0395900_0000277 3300037418 Bacteria 77256
681 Ga0395900_0001234 3300037418 Bacteria 31453
682 Ga0395900_0019640 3300037418 Bacteria 6889
683 Ga0395900_0127856 3300037418 Bacteria 2605
684 Ga0395898_0001918 3300037466 Bacteria 26473
685 Ga0395905_0000068 3300037471 Bacteria 177163
686 Ga0395905_0000348 3300037471 Bacteria 65915
687 Ga0395905_0004443 3300037471 Bacteria 14577
688 Ga0395901_0000199 3300038443 Bacteria 76415
689 Ga0395901_0005268 3300038443 Bacteria 13060
690 Ga0395901_0140444 3300038443 Bacteria 2539
691 Ga0395901_0173777 3300038443 Bacteria 2260
692 Ga0242420_003202 3300038996 Bacteria 2411
693 Ga0242420_011217 3300038996 Bacteria 1499
694 Ga0436365_0065130 3300039437 Bacteria 167769
695 Ga0436361_0742208 3300039447 Bacteria 6052
696 Ga0439448_0020387 3300042005 Bacteria 2050
697 Ga0439464_0003170 3300042439 Bacteria 4124
698 Ga0439460_0036907 3300042461 Bacteria 1420
699 Ga0451577_0000034 3300042876 Bacteria 376183
700 Ga0451577_0003212 3300042876 Bacteria 18354
701 Ga0451577_0025370 3300042876 Bacteria 5378
702 Ga0451577_0132698 3300042876 Bacteria 2235
703 Ga0466969_0032580 3300044656 Bacteria 2649
704 Ga0453683_0000005 3300044673 Bacteria 741657
705 Ga0453683_0000122 3300044673 Bacteria 116184
706 Ga0453683_0004573 3300044673 Bacteria 9780
707 Ga0453683_0127057 3300044673 Bacteria 1605
708 Ga0453683_0156419 3300044673 Bacteria 1441
709 Ga0466966_0016086 3300044684 Bacteria 4946
710 Ga0466961_0102343 3300044693 Bacteria 1804
711 Ga0453684_0000098 3300044712 Bacteria 376183
712 Ga0453684_0000467 3300044712 Bacteria 161003
713 Ga0453684_0000603 3300044712 Bacteria 132340
714 Ga0453684_0001278 3300044712 Bacteria 75250
715 Ga0453684_0065621 3300044712 Bacteria 4628
716 Ga0453684_0268672 3300044712 Bacteria 1950
717 Ga0466968_0072467 3300044735 Bacteria 1502
718 Ga0451576_0000036 3300045051 Bacteria 376183
719 Ga0451576_0000397 3300045051 Bacteria 101182
720 Ga0451576_0005569 3300045051 Bacteria 15735
721 Ga0451576_0023567 3300045051 Bacteria 6663
722 Ga0451576_0046399 3300045051 Bacteria 4575
723 Ga0451576_0114207 3300045051 Bacteria 2811
724 Ga0466967_0097786 3300045976 Bacteria 2679
725 Ga0495603_0042271 3300046455 Bacteria 2725
726 Ga0495629_0126159 3300046459 Bacteria 1783
727 Ga0495638_0102196 3300046460 Bacteria 1713
728 Ga0495638_0235657 3300046460 Bacteria 1016
729 Ga0495650_0000014 3300046471 Bacteria 581606
730 Ga0495580_0378928 3300046472 Bacteria 956
731 Ga0495582_0004387 3300046473 Bacteria 7935
732 Ga0495664_0059927 3300046477 Bacteria 2266
733 Ga0495584_0088190 3300046491 Bacteria 1564
734 Ga0495585_0001521 3300046492 Bacteria 18009
735 Ga0495585_0003658 3300046492 Bacteria 10277
736 Ga0495596_0018700 3300046500 Bacteria 2854
737 Ga0495606_0000528 3300046507 Bacteria 61795
738 Ga0495606_0005674 3300046507 Bacteria 11821
739 Ga0495606_0016540 3300046507 Bacteria 5616
740 Ga0495610_0006009 3300046512 Bacteria 8481
741 Ga0495616_0005759 3300046513 Bacteria 7578
742 Ga0495616_0023741 3300046513 Bacteria 3296
743 Ga0495631_0087772 3300046518 Bacteria 1339
744 Ga0495631_0109135 3300046518 Bacteria 1190
745 Ga0495632_0230054 3300046519 Bacteria 836
746 Ga0495644_0051316 3300046523 Bacteria 1549
747 Ga0495642_0034662 3300046528 Bacteria 2034
748 Ga0495652_0157877 3300046529 Bacteria 1764
749 Ga0495665_0052354 3300046531 Bacteria 2161
750 Ga0495609_0005281 3300046538 Bacteria 6852
751 Ga0495609_0052156 3300046538 Bacteria 1820
752 Ga0495622_0041224 3300046557 Bacteria 2147
753 Ga0495633_0000035 3300046558 Bacteria 185403
754 Ga0495633_0011158 3300046558 Bacteria 4867
755 Ga0495633_0015320 3300046558 Bacteria 3979
756 Ga0495668_0000032 3300046616 Bacteria 254951
757 Ga0495634_0237511 3300046642 Bacteria 1119
758 Ga0495625_0000009 3300046660 Bacteria 404954
759 Ga0495625_0000753 3300046660 Bacteria 45225
760 Ga0495625_0001432 3300046660 Bacteria 29071
761 Ga0495625_0082121 3300046660 Bacteria 2242
762 Ga0495625_0099251 3300046660 Bacteria 2002
763 Ga0495625_0301139 3300046660 Bacteria 1026
764 Ga0495659_0016122 3300046664 Bacteria 2462
765 Ga0495659_0068983 3300046664 Bacteria 1321
766 Ga0495661_0000707 3300046665 Bacteria 33018
767 Ga0495661_0004079 3300046665 Bacteria 10640
768 Ga0495647_0005287 3300046681 Bacteria 4228
769 Ga0495647_0023171 3300046681 Bacteria 2250
770 Ga0495658_0000570 3300046683 Bacteria 20102
771 Ga0495658_0075837 3300046683 Bacteria 1963
772 Ga0495658_0136364 3300046683 Bacteria 1497
773 Ga0495658_0163109 3300046683 Bacteria 1376
774 Ga0495658_0191774 3300046683 Bacteria 1271
775 Ga0495669_0010075 3300046684 Bacteria 3992
776 Ga0495670_0061831 3300046691 Bacteria 1883
777 Ga0495649_0000002 3300046694 Bacteria 1093458
778 Ga0495676_0248657 3300047321 Bacteria 1214
779 Ga0495680_0339732 3300047322 Bacteria 1048
780 Ga0495687_001120 3300047443 Bacteria 26041
781 Ga0495687_006439 3300047443 Bacteria 7196
782 Ga0495677_0037403 3300047445 Bacteria 1773
783 Ga0495686_0001209 3300047472 Bacteria 29698
784 Ga0495686_0001825 3300047472 Bacteria 21435
785 Ga0495602_0001510 3300048088 Bacteria 23177
786 Ga0495614_0083785 3300048089 Bacteria 1383
787 Ga0495626_0009849 3300048091 Bacteria 5138
788 Ga0496100_0167413 3300048903 Bacteria 1580
789 Ga0496102_0030220 3300048905 Bacteria 4848
790 Ga0496102_0042442 3300048905 Bacteria 4121
791 Ga0496103_0061654 3300048906 Bacteria 2333
792 Ga0496103_0120921 3300048906 Bacteria 1668
793 Ga0496104_0020868 3300048907 Bacteria 6008
794 Ga0496104_0098177 3300048907 Bacteria 2804
795 Ga0496106_0000834 3300048909 Bacteria 22319
796 Ga0496106_0032249 3300048909 Bacteria 3906
797 Ga0496106_0045581 3300048909 Bacteria 3294
798 Ga0496107_0046604 3300048910 Bacteria 3120
799 Ga0496107_0156100 3300048910 Bacteria 1690
800 Ga0496107_0204380 3300048910 Bacteria 1468
801 Ga0496107_0314167 3300048910 Bacteria 1166
802 Ga0496108_0031353 3300048911 Bacteria 4411
803 Ga0496108_0595622 3300048911 Bacteria 963
804 Ga0496109_0278429 3300048912 Bacteria 1577
805 Ga0496109_0531654 3300048912 Bacteria 1109
806 Ga0496110_0265779 3300048913 Bacteria 1562
807 Ga0496111_0202197 3300048914 Bacteria 1477
808 Ga0496112_0315805 3300048915 Bacteria 1507
809 Ga0496112_0547925 3300048915 Bacteria 1091
810 Ga0496112_0610918 3300048915 Bacteria 1022
811 Ga0496112_0641627 3300048915 Bacteria 992
812 Ga0496113_0131242 3300048916 Bacteria 1966
813 Ga0496113_0194871 3300048916 Bacteria 1609
814 Ga0496116_0002379 3300048919 Bacteria 19844
815 Ga0496117_0002276 3300048920 Bacteria 24806
816 Ga0496118_0026652 3300048921 Bacteria 4916
817 Ga0496122_0015395 3300048925 Bacteria 7314
818 Ga0496123_0018244 3300048926 Bacteria 5590
819 Ga0496125_0038198 3300048928 Bacteria 4161
820 Ga0495678_033997 3300049459 Bacteria 2101
821 Ga0501298_018491 3300049521 Bacteria 1282
822 Ga0501299_025167 3300049522 Bacteria 1116
823 Ga0501033_0108285 3300049570 Bacteria 2024
824 Ga0501036_0445463 3300049572 Bacteria 1079
825 Ga0501038_0020497 3300049574 Bacteria 5940
826 Ga0501041_0043753 3300049577 Bacteria 2722
827 Ga0501041_0127761 3300049577 Bacteria 1583
828 Ga0501042_0005696 3300049578 Bacteria 8040
829 Ga0501042_0346235 3300049578 Bacteria 1075
830 Ga0501046_0258124 3300049580 Bacteria 1281
831 Ga0501047_0153441 3300049581 Bacteria 2178
832 Ga0501048_0049392 3300049582 Bacteria 2998
833 Ga0501068_0172402 3300049584 Bacteria 1366
834 Ga0501069_0128203 3300049585 Bacteria 1452
835 Ga0501071_0030335 3300049587 Bacteria 3824
836 Ga0501071_0055109 3300049587 Bacteria 2870
837 Ga0501071_0095316 3300049587 Bacteria 2190
838 Ga0501071_0263414 3300049587 Bacteria 1302
839 Ga0501072_0115331 3300049588 Bacteria 2139
840 Ga0501074_0315803 3300049590 Bacteria 1110
841 Ga0501075_0516219 3300049591 Bacteria 912
842 Ga0501076_0054267 3300049592 Bacteria 3176
843 Ga0501076_0120138 3300049592 Bacteria 2128
844 Ga0501076_0558653 3300049592 Bacteria 944
845 Ga0501201_008382 3300049651 Bacteria 997
846 Ga0501202_010222 3300049652 Bacteria 1738
847 Ga0501207_010580 3300049654 Bacteria 1363
848 Ga0501216_009248 3300049660 Bacteria 1568
849 Ga0501217_015028 3300049661 Bacteria 1757
850 Ga0501223_012726 3300049663 Bacteria 1680
851 Ga0501224_006106 3300049664 Bacteria 1743
852 Ga0501233_040704 3300049668 Bacteria 1091
853 Ga0501243_027846 3300049675 Bacteria 955
854 Ga0501247_003827 3300049677 Bacteria 1628
855 Ga0501261_023759 3300049690 Bacteria 894
856 Ga0501221_037169 3300049704 Bacteria 1047
857 Ga0501225_0040627 3300049705 Bacteria 1282
858 Ga0501079_0030984 3300049741 Bacteria 4110
859 Ga0501080_0140288 3300049742 Bacteria 2235
860 Ga0501081_0445458 3300049743 Bacteria 962
861 Ga0501263_000507 3300049760 Bacteria 2952
862 Ga0501273_015469 3300049770 Bacteria 991
863 Ga0501035_0283680 3300049822 Bacteria 1399
864 Ga0501044_0778945 3300049823 Bacteria 837
865 Ga0501045_0018713 3300049824 Bacteria 4931
866 Ga0501045_0351132 3300049824 Bacteria 1098
867 nmdc:mga0k408_23828_c1 3300050493 Bacteria 2298
868 nmdc:mga0k408_260_c1 3300050493 Bacteria 28863
869 nmdc:mga0k408_859_c1 3300050493 Bacteria 12690
870 nmdc:mga05p37_10032_c1 3300050507 Bacteria 11242
871 nmdc:mga05p37_197765_c1 3300050507 Bacteria 2437
872 nmdc:mga05p37_21055_c1 3300050507 Bacteria 7893
873 nmdc:mga05p37_271433_c1 3300050507 Bacteria 2026
874 nmdc:mga05p37_346171_c1 3300050507 Bacteria 1751
875 nmdc:mga05p37_39517_c1 3300050507 Bacteria 5793
876 nmdc:mga09592_1094_c1 3300050508 Bacteria 21508
877 nmdc:mga09592_11444_c1 3300050508 Bacteria 7216
878 nmdc:mga09592_137492_c1 3300050508 Bacteria 2105
879 nmdc:mga09592_207144_c1 3300050508 Bacteria 1698
880 nmdc:mga09592_24524_c1 3300050508 Bacteria 4988
881 nmdc:mga09592_24982_c1 3300050508 Bacteria 4942
882 nmdc:mga09592_397145_c1 3300050508 Bacteria 1192
883 nmdc:mga0qj67_15222_c1 3300050509 Bacteria 5821
884 nmdc:mga0qj67_212774_c1 3300050509 Bacteria 1570
885 nmdc:mga0qj67_45964_c1 3300050509 Bacteria 3445
886 nmdc:mga06r32_2891_c1 3300050510 Bacteria 15411
887 nmdc:mga06r32_78179_c1 3300050510 Bacteria 3215
888 nmdc:mga08y16_178990_c1 3300050511 Bacteria 2202
889 nmdc:mga08y16_28893_c1 3300050511 Bacteria 5845
890 nmdc:mga08y16_296218_c1 3300050511 Bacteria 1668
891 nmdc:mga08y16_487978_c1 3300050511 Bacteria 1253
892 nmdc:mga08y16_58876_c1 3300050511 Bacteria 4014
893 nmdc:mga08y16_76589_c1 3300050511 Bacteria 3487
894 nmdc:mga08y16_821_c1 3300050511 Bacteria 29792
895 nmdc:mga0n895_163892_c1 3300050512 Bacteria 2254
896 nmdc:mga0n895_726655_c1 3300050512 Bacteria 987
897 nmdc:mga0rr50_139_c1 3300050513 Bacteria 40055
898 nmdc:mga0rr50_170349_c1 3300050513 Bacteria 1774
899 nmdc:mga0rr50_4236_c1 3300050513 Bacteria 8392
900 nmdc:mga08x19_3622_c1 3300050514 Bacteria 9201
901 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
902 nmdc:mga0a205_174193_c1 3300050515 Bacteria 2047
903 nmdc:mga0a205_273633_c1 3300050515 Bacteria 1565
904 nmdc:mga0a205_302050_c1 3300050515 Bacteria 1474
905 nmdc:mga0a205_63177_c1 3300050515 Bacteria 3577
906 nmdc:mga0a205_7292_c1 3300050515 Bacteria 10004
907 nmdc:mga0a205_88196_c1 3300050515 Bacteria 2998
908 Ga0495601_0153090 3300053077 Bacteria 1506
909 Ga0500635_0001015 3300053080 Bacteria 6718
910 Ga0500555_000471 3300053103 Bacteria 16699
911 Ga0500608_000203 3300053122 Bacteria 23751
912 Ga0500608_007068 3300053122 Bacteria 4615
913 Ga0500618_000037 3300053125 Bacteria 117320
914 Ga0500618_008815 3300053125 Bacteria 2788
915 Ga0500622_0001600 3300053156 Bacteria 17790
916 Ga0500624_000694 3300053157 Bacteria 8505
917 Ga0590074_040918 3300059423 Bacteria 834
918 Ga0587085_028233 3300059506 Bacteria 905
919 Ga0501082_0623385 3300060353 Bacteria 944
920 Ga0530510_0029172 3300061734 Bacteria 3959
921 2599477068 2599185184 Bacteria 6430550
922 2722726500 2721755487 Bacteria 6357185
923 2738762616 2738541284 Bacteria 5199923
924 2842906507 2842903701 Bacteria 6986368
925 2852626917 2852623160 Bacteria 4376875
926 2884938030 2884933994 Bacteria 4535041
927 2896319414 2896317667 Bacteria 4606601
928 2904783635 2904780799 Bacteria 5840761
929 2919182186 2919177583 Bacteria 5641607
930 2919442232 2919437846 Bacteria 6199444
931 2928078981 2928078545 Bacteria 6534839
932 2928148652 2928147474 Bacteria 6512076
933 2932085628 2932082852 Bacteria 6563563
934 3003233521 3003233435 Bacteria 4458031
935 8055590801 8055588893 Bacteria 3619545
936 Ga0105237_10000485
937 SwRhRL2b_contig_731410
938 CNAas_1000829
939 JGI24741J21665_1012612
940 JGI24740J21852_10016887
941 JGI24737J22298_10000143
942 JGI24735J21928_10000006
943 JGI24748J21848_1000051
944 JGI24744J21845_10002026
945 JGI24034J26672_10000030
946 JGI24751J29686_10054973
947 JGI25162J39368_1000089
948 JGI25162J39368_1000498
949 JGI25157J39369_1005927
950 JGI25165J46597_1000618
951 rootH1_10029777
952 rootH2_10018591
953 rootH2_10039562
954 rootH2_10186211
955 rootL2_10211276
956 rootH1_10010194
957 rootH1_10105642
958 rootH1_10379396
959 Ga0058863_11791471
960 Ga0058861_11760232
961 Ga0058862_12416007
962 Ga0065714_10064422
963 Ga0065714_10148595
964 Ga0065704_10009526
965 Ga0065704_10023815
966 Ga0065704_10092483
967 Ga0065704_10092834
968 Ga0065712_10067728
969 Ga0065712_10089641
970 Ga0065712_10204759
971 Ga0065715_10004474
972 Ga0065715_10089181
973 Ga0065715_10095696
974 Ga0065715_10105987
975 Ga0065715_10343798
976 Ga0065715_10443342
977 Ga0065707_10091424
978 Ga0065707_10190589
979 Ga0065707_10246444
980 Ga0065707_10322946
981 Ga0070658_10000018
982 Ga0070658_10080753
983 Ga0070658_10338790
984 Ga0070658_10563895
985 Ga0070676_10004488
986 Ga0070676_10093607
987 Ga0070676_10149873
988 Ga0070676_10503680
989 Ga0070683_100301639
990 Ga0070690_100054471
991 Ga0070690_100219957
992 Ga0070690_100225321
993 Ga0070670_100000165
994 Ga0070670_100000767
995 Ga0070670_100224439
996 Ga0068869_100035202
997 Ga0068869_100080076
998 Ga0068869_100090184
999 Ga0068869_100165587
1000 Ga0068869_100184623
1001 Ga0070680_100302537
1002 Ga0070680_100458117
1003 Ga0070682_100041994
1004 Ga0068868_100013908
1005 Ga0070660_100091736
1006 Ga0070689_100000816
1007 Ga0070689_100023397
1008 Ga0070689_100779276
1009 Ga0070691_10113953
1010 Ga0070691_10313527
1011 Ga0070687_100057385
1012 Ga0070687_100226986
1013 Ga0070661_100050498
1014 Ga0070692_10016459
1015 Ga0070692_10031317
1016 Ga0070692_10060528
1017 Ga0070692_10203511
1018 Ga0070669_100011817
1019 Ga0070669_100026199
1020 Ga0070669_100324176
1021 Ga0070675_100047495
1022 Ga0070671_100027615
1023 Ga0070671_100208803
1024 Ga0070673_100008881
1025 Ga0070673_100014675
1026 Ga0070673_100028970
1027 Ga0070688_100000427
1028 Ga0070688_100009040
1029 Ga0070659_100018374
1030 Ga0070659_100026796
1031 Ga0070667_100139335
1032 Ga0070701_10026549
1033 Ga0070701_10065272
1034 Ga0070705_100022136
1035 Ga0070705_100193364
1036 Ga0070700_100004173
1037 Ga0070700_100118473
1038 Ga0070700_100138605
1039 Ga0070700_100199413
1040 Ga0070694_100005028
1041 Ga0070694_100029319
1042 Ga0070694_100067292
1043 Ga0070694_100200135
1044 Ga0070694_100210428
1045 Ga0070694_100359661
1046 Ga0070694_100696880
1047 Ga0070708_100002619
1048 Ga0070708_100259342
1049 Ga0070708_100329329
1050 Ga0070708_100369972
1051 Ga0070678_100018207
1052 Ga0070678_100110744
1053 Ga0070662_100000626
1054 Ga0070662_100173729
1055 Ga0070681_10001768
1056 Ga0070681_10022542
1057 Ga0070681_10029377
1058 Ga0068867_100016777
1059 Ga0068867_100219256
1060 Ga0068867_100512828
1061 Ga0070706_100000128
1062 Ga0070706_100005626
1063 Ga0070706_100018438
1064 Ga0070706_100037115
1065 Ga0070706_100049046
1066 Ga0070706_100093641
1067 Ga0070706_100223588
1068 Ga0070706_100539125
1069 Ga0070707_100006408
1070 Ga0070707_100029831
1071 Ga0070707_100078663
1072 Ga0070707_100180455
1073 Ga0070707_100180813
1074 Ga0070707_100768365
1075 Ga0070698_100000663
1076 Ga0070698_100004577
1077 Ga0070698_100005014
1078 Ga0070698_100051295
1079 Ga0070698_100053534
1080 Ga0070698_100185010
1081 Ga0070698_100209354
1082 Ga0070699_100001336
1083 Ga0070699_100014592
1084 Ga0070699_100049669
1085 Ga0070699_100576079
1086 Ga0070679_100008363
1087 Ga0070679_100111586
1088 Ga0070697_100003936
1089 Ga0070697_100036822
1090 Ga0070697_100063878
1091 Ga0070697_100094122
1092 Ga0070697_100101472
1093 Ga0070697_100182476
1094 Ga0070697_100213432
1095 Ga0070697_100259760
1096 Ga0068853_100014510
1097 Ga0068853_100019819
1098 Ga0068853_100167119
1099 Ga0068853_100234649
1100 Ga0068853_100695547
1101 Ga0070672_100019003
1102 Ga0070672_100104518
1103 Ga0070672_100124054
1104 Ga0070672_100235441
1105 Ga0070686_100011130
1106 Ga0070686_100014560
1107 Ga0070695_100011147
1108 Ga0070695_100035049
1109 Ga0070695_100051867
1110 Ga0070695_100172942
1111 Ga0070695_100174986
1112 Ga0070695_100356052
1113 Ga0070696_100008944
1114 Ga0070696_100123279
1115 Ga0070693_100031294
1116 Ga0070693_100303516
1117 Ga0070665_100000072
1118 Ga0070665_100149900
1119 Ga0070704_100031410
1120 Ga0070704_100098350
1121 Ga0070704_100288435
1122 Ga0068855_100000070
1123 Ga0068855_100000268
1124 Ga0068855_100012445
1125 Ga0068855_100063242
1126 Ga0068855_100152225
1127 Ga0068855_100204197
1128 Ga0068855_100416203
1129 Ga0070664_100004294
1130 Ga0070664_100025146
1131 Ga0070664_100461099
1132 Ga0070664_100549184
1133 Ga0068857_100006559
1134 Ga0068857_100127604
1135 Ga0068857_100164685
1136 Ga0068857_100578922
1137 Ga0068854_100095077
1138 Ga0068854_100271233
1139 Ga0068856_100000897
1140 Ga0068856_100003887
1141 Ga0068856_100005676
1142 Ga0068856_100009016
1143 Ga0068856_100013111
1144 Ga0068856_100194332
1145 Ga0070702_100001061
1146 Ga0070702_100184429
1147 Ga0070702_100340747
1148 Ga0068852_100017595
1149 Ga0068852_100230360
1150 Ga0068859_100054835
1151 Ga0068859_100079747
1152 Ga0068859_100112551
1153 Ga0068859_100169538
1154 Ga0068859_100287541
1155 Ga0068859_100411653
1156 Ga0068864_100002141
1157 Ga0068864_100034796
1158 Ga0068864_100106485
1159 Ga0068864_100652402
1160 Ga0068866_10012210
1161 Ga0068866_10017052
1162 Ga0068861_100002200
1163 Ga0068861_100126572
1164 Ga0068861_100512790
1165 Ga0068870_10064483
1166 Ga0068870_10203280
1167 Ga0068863_100092530
1168 Ga0068863_100210158
1169 Ga0068863_100257220
1170 Ga0068858_100000405
1171 Ga0068858_100014535
1172 Ga0068858_100058092
1173 Ga0068858_100068571
1174 Ga0068858_100089413
1175 Ga0068858_100269722
1176 Ga0068860_100002487
1177 Ga0068860_100027839
1178 Ga0068860_100096792
1179 Ga0068860_100195015
1180 Ga0068862_100033821
1181 Ga0068862_100038785
1182 Ga0068862_100102426
1183 Ga0081455_10422222
1184 Ga0081540_1097925
1185 Ga0081539_10000858
1186 Ga0070715_10000024
1187 Ga0070716_100015207
1188 Ga0075366_10001711
1189 Ga0097621_100000028
1190 Ga0097621_100003157
1191 Ga0097621_100006010
1192 Ga0068871_100006906
1193 Ga0068871_100024567
1194 Ga0068871_100037044
1195 Ga0075430_100014761
1196 Ga0075430_100017128
1197 Ga0075430_100066766
1198 Ga0075430_100088661
1199 Ga0075431_100095920
1200 Ga0075431_100166135
1201 Ga0075433_10015116
1202 Ga0075433_10021849
1203 Ga0075433_10049863
1204 Ga0075433_10282341
1205 Ga0075433_10366468
1206 Ga0075434_100000831
1207 Ga0075434_100010744
1208 Ga0075434_100147427
1209 Ga0075434_100160548
1210 Ga0075434_100706617
1211 Ga0075429_100011725
1212 Ga0075429_100018935
1213 Ga0075429_100031368
1214 Ga0075429_100092571
1215 Ga0075429_100234498
1216 Ga0068865_100000127
1217 Ga0068865_100032927
1218 Ga0068865_100071929
1219 Ga0068865_100305617
1220 Ga0075436_100000020
1221 Ga0075436_100327712
1222 Ga0075436_100389832
1223 Ga0097620_100011064
1224 Ga0097620_100054836
1225 Ga0097620_100079748
1226 Ga0097620_100112549
1227 Ga0097620_100169531
1228 Ga0097620_100287541
1229 Ga0097620_100411662
1230 Ga0075435_100000165
1231 Ga0075435_100032986
1232 Ga0075435_100095774
1233 Ga0075435_100281110
1234 Ga0099794_10001218
1235 Ga0105251_10061955
1236 Ga0105251_10116981
1237 Ga0105240_10000237
1238 Ga0105240_10014965
1239 Ga0105240_10020594
1240 Ga0105240_10048025
1241 Ga0105240_10187598
1242 Ga0105240_10227132
1243 Ga0105240_10365364
1244 Ga0105240_11082324
1245 Ga0111539_10079406
1246 Ga0111539_10211199
1247 Ga0105245_10243938
1248 Ga0105245_10607140
1249 Ga0105247_10000153
1250 Ga0105247_10005769
1251 Ga0105247_10009777
1252 Ga0114129_10007783
1253 Ga0114129_10018669
1254 Ga0114129_10213288
1255 Ga0114129_10654159
1256 Ga0114129_10843987
1257 Ga0105243_10000785
1258 Ga0105243_10080793
1259 Ga0105243_10133231
1260 Ga0105243_10189222
1261 Ga0105243_10298058
1262 Ga0105241_10535967
1263 Ga0105242_10001383
1264 Ga0105242_10029494
1265 Ga0105242_10187229
1266 Ga0105242_10256131
1267 Ga0105248_10015522
1268 Ga0105248_10015913
1269 Ga0105248_10165246
1270 Ga0105237_10000224
1271 Ga0105237_10001308
1272 Ga0105237_10037976
1273 Ga0105237_10041051
1274 Ga0105237_10065000
1275 Ga0105237_10093882
1276 Ga0105237_10279937
1277 Ga0105237_10385476
1278 Ga0105237_10411591
1279 Ga0105237_10442625
1280 Ga0105237_10553924
1281 Ga0105238_10133400
1282 Ga0105238_11076560
1283 Ga0105249_10013986
1284 Ga0105249_10063134
1285 Ga0105249_10087773
1286 Ga0105249_10237828
1287 Ga0105239_10000039
1288 Ga0105239_10000120
1289 Ga0105239_10004436
1290 Ga0105239_10005560
1291 Ga0105239_10012917
1292 Ga0105239_10013753
1293 Ga0105239_10023687
1294 Ga0105239_10025250
1295 Ga0105239_10146195
1296 Ga0105239_10826509
1297 Ga0105246_10039466
1298 Ga0105246_10172179
1299 Ga0157373_10000208
1300 Ga0157373_10076454
1301 Ga0157373_10170348
1302 Ga0157371_10000263
1303 Ga0157370_10095584
1304 Ga0157369_10617552
1305 Ga0157374_10001845
1306 Ga0157374_10044113
1307 Ga0157374_10155428
1308 Ga0157374_10357088
1309 Ga0157378_10000002
1310 Ga0157378_10009280
1311 Ga0157378_10010199
1312 Ga0157378_10039044
1313 Ga0157378_10043262
1314 Ga0157378_10046779
1315 Ga0157378_10235654
1316 Ga0157378_10322829
1317 Ga0163162_10000010
1318 Ga0163162_10003107
1319 Ga0163162_10005005
1320 Ga0163162_10010070
1321 Ga0163162_10013931
1322 Ga0163162_10016331
1323 Ga0163162_10033657
1324 Ga0163162_10064255
1325 Ga0163162_10110885
1326 Ga0163162_10610738
1327 Ga0163162_10727211
1328 Ga0157372_10000050
1329 Ga0157372_10000635
1330 Ga0157372_10001419
1331 Ga0157372_10002231
1332 Ga0157372_10189979
1333 Ga0157372_10403929
1334 Ga0157375_10007015
1335 Ga0157375_10021385
1336 Ga0157375_10055045
1337 Ga0157375_11236598
1338 Ga0163163_10002079
1339 Ga0163163_10004729
1340 Ga0163163_10014695
1341 Ga0163163_10018317
1342 Ga0163163_10215737
1343 Ga0157380_10001101
1344 Ga0157380_10012995
1345 Ga0157380_10027529
1346 Ga0157380_10093550
1347 Ga0157380_10534322
1348 Ga0157380_10925475
1349 Ga0157380_11116714
1350 Ga0157379_10047882
1351 Ga0157379_10059280
1352 Ga0157376_10027794
1353 Ga0182006_1091847
1354 Ga0163161_10027541
1355 Ga0207672_1000067
1356 Ga0207427_100172
1357 Ga0209437_100034
1358 Ga0209437_100221
1359 Ga0209026_1000728
1360 Ga0209026_1003634
1361 Ga0209026_1015127
1362 Ga0209148_1017175
1363 Ga0209233_1000038
1364 Ga0209233_1001428
1365 Ga0209233_1013109
1366 Ga0209233_1019675
1367 Ga0209455_1000861
1368 Ga0207710_10000001
1369 Ga0207710_10000702
1370 Ga0207710_10071792
1371 Ga0207688_10102635
1372 Ga0207647_10000076
1373 Ga0207647_10002660
1374 Ga0207647_10101115
1375 Ga0207647_10150889
1376 Ga0207685_10000018
1377 Ga0207645_10017477
1378 Ga0207645_10087794
1379 Ga0207705_10000036
1380 Ga0207684_10000150
1381 Ga0207684_10004744
1382 Ga0207684_10007514
1383 Ga0207684_10017828
1384 Ga0207684_10022905
1385 Ga0207684_10121834
1386 Ga0207684_10297695
1387 Ga0207684_10361659
1388 Ga0207654_10103132
1389 Ga0207654_10118633
1390 Ga0207654_10425683
1391 Ga0207707_10000016
1392 Ga0207707_10030350
1393 Ga0207707_10268130
1394 Ga0207695_10000013
1395 Ga0207695_10004656
1396 Ga0207695_10016549
1397 Ga0207695_10033191
1398 Ga0207695_10058909
1399 Ga0207695_10318305
1400 Ga0207671_10002707
1401 Ga0207671_10011004
1402 Ga0207671_10011316
1403 Ga0207671_10024807
1404 Ga0207671_10037577
1405 Ga0207660_10000805
1406 Ga0207660_10032391
1407 Ga0207660_10119374
1408 Ga0207662_10106779
1409 Ga0207662_10253872
1410 Ga0207662_10305117
1411 Ga0207657_10020956
1412 Ga0207649_10034440
1413 Ga0207649_10177370
1414 Ga0207652_10000693
1415 Ga0207652_10298145
1416 Ga0207646_10004823
1417 Ga0207646_10026415
1418 Ga0207646_10073942
1419 Ga0207646_10298506
1420 Ga0207681_10012288
1421 Ga0207681_10264841
1422 Ga0207694_10049255
1423 Ga0207694_10146670
1424 Ga0207650_10000011
1425 Ga0207650_10002299
1426 Ga0207659_10013295
1427 Ga0207644_10000882
1428 Ga0207644_10062324
1429 Ga0207644_10073528
1430 Ga0207644_10096507
1431 Ga0207644_10263654
1432 Ga0207644_10425065
1433 Ga0207690_10011536
1434 Ga0207690_10015769
1435 Ga0207706_10006487
1436 Ga0207706_10178930
1437 Ga0207686_10000952
1438 Ga0207709_10000524
1439 Ga0207709_10002326
1440 Ga0207709_10036889
1441 Ga0207709_10264132
1442 Ga0207670_10000065
1443 Ga0207670_10035418
1444 Ga0207704_10000044
1445 Ga0207704_10013016
1446 Ga0207704_10101785
1447 Ga0207704_10211159
1448 Ga0207691_10005500
1449 Ga0207691_10056180
1450 Ga0207691_10237566
1451 Ga0207691_10265208
1452 Ga0207711_10013164
1453 Ga0207711_10018170
1454 Ga0207689_10009519
1455 Ga0207689_10024086
1456 Ga0207689_10026884
1457 Ga0207689_10041222
1458 Ga0207689_10041530
1459 Ga0207689_10064294
1460 Ga0207689_10066062
1461 Ga0207689_10270225
1462 Ga0207689_10380763
1463 Ga0207679_10001977
1464 Ga0207679_10025207
1465 Ga0207679_10414295
1466 Ga0207679_10547559
1467 Ga0207667_10000009
1468 Ga0207667_10000971
1469 Ga0207667_10051802
1470 Ga0207667_10085702
1471 Ga0207667_10205066
1472 Ga0207667_10553159
1473 Ga0207667_10758902
1474 Ga0207651_10016587
1475 Ga0207651_10018113
1476 Ga0207651_10030254
1477 Ga0207651_10042500
1478 Ga0207651_10095736
1479 Ga0207651_10104905
1480 Ga0207651_10397315
1481 Ga0207712_10027437
1482 Ga0207712_10075328
1483 Ga0207712_10142459
1484 Ga0207712_10476213
1485 Ga0207668_10338072
1486 Ga0207640_10177008
1487 Ga0207640_10267992
1488 Ga0207658_10101237
1489 Ga0207658_10234206
1490 Ga0207677_10089034
1491 Ga0207677_10104836
1492 Ga0207703_10000045
1493 Ga0207703_10097306
1494 Ga0207703_10102201
1495 Ga0207703_10424570
1496 Ga0207639_10004531
1497 Ga0207639_10015887
1498 Ga0207639_10018588
1499 Ga0207639_10547352
1500 Ga0207678_10021588
1501 Ga0207708_10003530
1502 Ga0207708_10039998
1503 Ga0207708_10184541
1504 Ga0207708_10664032
1505 Ga0207702_10000507
1506 Ga0207702_10005892
1507 Ga0207702_10011829
1508 Ga0207702_10038199
1509 Ga0207702_10056941
1510 Ga0207702_10499778
1511 Ga0207641_10073847
1512 Ga0207641_10175600
1513 Ga0207641_10669928
1514 Ga0207648_10000529
1515 Ga0207648_10228044
1516 Ga0207648_10308551
1517 Ga0207648_10317344
1518 Ga0207676_10085282
1519 Ga0207676_10090487
1520 Ga0207676_10710559
1521 Ga0207676_10833183
1522 Ga0207674_10020588
1523 Ga0207674_10123397
1524 Ga0207674_10145605
1525 Ga0207674_10483995
1526 Ga0207675_100000849
1527 Ga0207675_100004603
1528 Ga0207675_100144676
1529 Ga0207675_100184473
1530 Ga0207675_100484499
1531 Ga0207683_10031312
1532 Ga0207683_10273793
1533 Ga0207698_10005251
1534 Ga0207698_10117485
1535 Ga0209588_1010709
1536 Ga0209974_10003508
1537 Ga0207428_10001623
1538 Ga0207428_10117762
1539 Ga0207428_10135769
1540 Ga0268266_10000089
1541 Ga0268266_10088905
1542 Ga0268265_10018602
1543 Ga0268265_10026095
1544 Ga0268265_10026318
1545 Ga0268265_10355986
1546 Ga0268264_10007034
1547 Ga0268264_10069792
1548 Ga0268264_10080774
1549 Ga0268264_10128605
1550 Ga0307517_10003551
1551 Ga0307515_10001481
1552 Ga0307515_10001997
1553 Ga0307515_10100898
1554 Ga0265338_10015871
1555 Ga0316177_1009900
1556 Ga0316176_1141979
1557 Ga0316183_1118483
1558 Ga0316181_1033622
1559 Ga0265339_10084041
1560 Ga0265331_10075889
1561 Ga0265316_10220112
1562 Ga0307408_100016223
1563 Ga0307408_100058015
1564 Ga0307408_100149571
1565 Ga0316579_10043400
1566 Ga0316576_10127932
1567 Ga0307405_10001983
1568 Ga0307405_10058440
1569 Ga0307413_10001627
1570 Ga0307413_10036294
1571 Ga0307410_10002169
1572 Ga0307410_10390195
1573 Ga0307410_10435734
1574 Ga0307406_10042010
1575 Ga0307406_10091712
1576 Ga0307406_10441028
1577 Ga0307407_10067696
1578 Ga0307412_10045347
1579 Ga0307412_10052264
1580 Ga0307412_10077908
1581 Ga0307412_10284247
1582 Ga0307412_10406460
1583 Ga0307409_100007363
1584 Ga0307409_100056497
1585 Ga0307409_100817175
1586 Ga0307416_100001756
1587 Ga0307416_100013314
1588 Ga0307416_100042843
1589 Ga0307414_10041283
1590 Ga0307411_10000610
1591 Ga0307411_10121123
1592 Ga0307411_10256934
1593 Ga0307415_100051090
1594 Ga0307415_100117087
1595 Ga0307415_100151684
1596 Ga0307415_100405665
1597 Ga0316585_10039603
1598 Ga0316580_10007805
1599 Ga0307507_10000015
1600 Ga0373940_0085463
1601 Ga0373951_0004432
1602 Ga0373941_0107012
1603 Ga0373942_0019143
1604 Ga0373962_0030121
1605 Ga0373937_0110636
1606 Ga0373937_0273069
1607 Ga0373937_0498038
1608 Ga0316582_0022813
1609 Ga0316584_0052688
1610 Ga0316584_0057497
1611 Ga0395899_0000033
1612 Ga0395899_0000659
1613 Ga0395899_0001109
1614 Ga0395899_0021085
1615 Ga0395900_0000277
1616 Ga0395900_0001234
1617 Ga0395900_0019640
1618 Ga0395900_0127856
1619 Ga0395898_0001918
1620 Ga0395905_0000068
1621 Ga0395905_0000348
1622 Ga0395905_0004443
1623 Ga0395901_0000199
1624 Ga0395901_0005268
1625 Ga0395901_0140444
1626 Ga0395901_0173777
1627 Ga0242420_003202
1628 Ga0242420_011217
1629 Ga0436365_0065130
1630 Ga0436361_0742208
1631 Ga0439448_0020387
1632 Ga0439464_0003170
1633 Ga0439460_0036907
1634 Ga0451577_0000034
1635 Ga0451577_0003212
1636 Ga0451577_0025370
1637 Ga0451577_0132698
1638 Ga0466969_0032580
1639 Ga0453683_0000005
1640 Ga0453683_0000122
1641 Ga0453683_0004573
1642 Ga0453683_0127057
1643 Ga0453683_0156419
1644 Ga0466966_0016086
1645 Ga0466961_0102343
1646 Ga0453684_0000098
1647 Ga0453684_0000467
1648 Ga0453684_0000603
1649 Ga0453684_0001278
1650 Ga0453684_0065621
1651 Ga0453684_0268672
1652 Ga0466968_0072467
1653 Ga0451576_0000036
1654 Ga0451576_0000397
1655 Ga0451576_0005569
1656 Ga0451576_0023567
1657 Ga0451576_0046399
1658 Ga0451576_0114207
1659 Ga0466967_0097786
1660 Ga0495603_0042271
1661 Ga0495629_0126159
1662 Ga0495638_0102196
1663 Ga0495638_0235657
1664 Ga0495650_0000014
1665 Ga0495580_0378928
1666 Ga0495582_0004387
1667 Ga0495664_0059927
1668 Ga0495584_0088190
1669 Ga0495585_0001521
1670 Ga0495585_0003658
1671 Ga0495596_0018700
1672 Ga0495606_0000528
1673 Ga0495606_0005674
1674 Ga0495606_0016540
1675 Ga0495610_0006009
1676 Ga0495616_0005759
1677 Ga0495616_0023741
1678 Ga0495631_0087772
1679 Ga0495631_0109135
1680 Ga0495632_0230054
1681 Ga0495644_0051316
1682 Ga0495642_0034662
1683 Ga0495652_0157877
1684 Ga0495665_0052354
1685 Ga0495609_0005281
1686 Ga0495609_0052156
1687 Ga0495622_0041224
1688 Ga0495633_0000035
1689 Ga0495633_0011158
1690 Ga0495633_0015320
1691 Ga0495668_0000032
1692 Ga0495634_0237511
1693 Ga0495625_0000009
1694 Ga0495625_0000753
1695 Ga0495625_0001432
1696 Ga0495625_0082121
1697 Ga0495625_0099251
1698 Ga0495625_0301139
1699 Ga0495659_0016122
1700 Ga0495659_0068983
1701 Ga0495661_0000707
1702 Ga0495661_0004079
1703 Ga0495647_0005287
1704 Ga0495647_0023171
1705 Ga0495658_0000570
1706 Ga0495658_0075837
1707 Ga0495658_0136364
1708 Ga0495658_0163109
1709 Ga0495658_0191774
1710 Ga0495669_0010075
1711 Ga0495670_0061831
1712 Ga0495649_0000002
1713 Ga0495676_0248657
1714 Ga0495680_0339732
1715 Ga0495687_001120
1716 Ga0495687_006439
1717 Ga0495677_0037403
1718 Ga0495686_0001209
1719 Ga0495686_0001825
1720 Ga0495602_0001510
1721 Ga0495614_0083785
1722 Ga0495626_0009849
1723 Ga0496100_0167413
1724 Ga0496102_0030220
1725 Ga0496102_0042442
1726 Ga0496103_0061654
1727 Ga0496103_0120921
1728 Ga0496104_0020868
1729 Ga0496104_0098177
1730 Ga0496106_0000834
1731 Ga0496106_0032249
1732 Ga0496106_0045581
1733 Ga0496107_0046604
1734 Ga0496107_0156100
1735 Ga0496107_0204380
1736 Ga0496107_0314167
1737 Ga0496108_0031353
1738 Ga0496108_0595622
1739 Ga0496109_0278429
1740 Ga0496109_0531654
1741 Ga0496110_0265779
1742 Ga0496111_0202197
1743 Ga0496112_0315805
1744 Ga0496112_0547925
1745 Ga0496112_0610918
1746 Ga0496112_0641627
1747 Ga0496113_0131242
1748 Ga0496113_0194871
1749 Ga0496116_0002379
1750 Ga0496117_0002276
1751 Ga0496118_0026652
1752 Ga0496122_0015395
1753 Ga0496123_0018244
1754 Ga0496125_0038198
1755 Ga0495678_033997
1756 Ga0501298_018491
1757 Ga0501299_025167
1758 Ga0501033_0108285
1759 Ga0501036_0445463
1760 Ga0501038_0020497
1761 Ga0501041_0043753
1762 Ga0501041_0127761
1763 Ga0501042_0005696
1764 Ga0501042_0346235
1765 Ga0501046_0258124
1766 Ga0501047_0153441
1767 Ga0501048_0049392
1768 Ga0501068_0172402
1769 Ga0501069_0128203
1770 Ga0501071_0030335
1771 Ga0501071_0055109
1772 Ga0501071_0095316
1773 Ga0501071_0263414
1774 Ga0501072_0115331
1775 Ga0501074_0315803
1776 Ga0501075_0516219
1777 Ga0501076_0054267
1778 Ga0501076_0120138
1779 Ga0501076_0558653
1780 Ga0501201_008382
1781 Ga0501202_010222
1782 Ga0501207_010580
1783 Ga0501216_009248
1784 Ga0501217_015028
1785 Ga0501223_012726
1786 Ga0501224_006106
1787 Ga0501233_040704
1788 Ga0501243_027846
1789 Ga0501247_003827
1790 Ga0501261_023759
1791 Ga0501221_037169
1792 Ga0501225_0040627
1793 Ga0501079_0030984
1794 Ga0501080_0140288
1795 Ga0501081_0445458
1796 Ga0501263_000507
1797 Ga0501273_015469
1798 Ga0501035_0283680
1799 Ga0501044_0778945
1800 Ga0501045_0018713
1801 Ga0501045_0351132
1802 nmdc:mga0k408_23828_c1
1803 nmdc:mga0k408_260_c1
1804 nmdc:mga0k408_859_c1
1805 nmdc:mga05p37_10032_c1
1806 nmdc:mga05p37_197765_c1
1807 nmdc:mga05p37_21055_c1
1808 nmdc:mga05p37_271433_c1
1809 nmdc:mga05p37_346171_c1
1810 nmdc:mga05p37_39517_c1
1811 nmdc:mga09592_1094_c1
1812 nmdc:mga09592_11444_c1
1813 nmdc:mga09592_137492_c1
1814 nmdc:mga09592_207144_c1
1815 nmdc:mga09592_24524_c1
1816 nmdc:mga09592_24982_c1
1817 nmdc:mga09592_397145_c1
1818 nmdc:mga0qj67_15222_c1
1819 nmdc:mga0qj67_212774_c1
1820 nmdc:mga0qj67_45964_c1
1821 nmdc:mga06r32_2891_c1
1822 nmdc:mga06r32_78179_c1
1823 nmdc:mga08y16_178990_c1
1824 nmdc:mga08y16_28893_c1
1825 nmdc:mga08y16_296218_c1
1826 nmdc:mga08y16_487978_c1
1827 nmdc:mga08y16_58876_c1
1828 nmdc:mga08y16_76589_c1
1829 nmdc:mga08y16_821_c1
1830 nmdc:mga0n895_163892_c1
1831 nmdc:mga0n895_726655_c1
1832 nmdc:mga0rr50_139_c1
1833 nmdc:mga0rr50_170349_c1
1834 nmdc:mga0rr50_4236_c1
1835 nmdc:mga08x19_3622_c1
1836 nmdc:mga08x19_3_c1
1837 nmdc:mga0a205_174193_c1
1838 nmdc:mga0a205_273633_c1
1839 nmdc:mga0a205_302050_c1
1840 nmdc:mga0a205_63177_c1
1841 nmdc:mga0a205_7292_c1
1842 nmdc:mga0a205_88196_c1
1843 Ga0495601_0153090
1844 Ga0500635_0001015
1845 Ga0500555_000471
1846 Ga0500608_000203
1847 Ga0500608_007068
1848 Ga0500618_000037
1849 Ga0500618_008815
1850 Ga0500622_0001600
1851 Ga0500624_000694
1852 Ga0590074_040918
1853 Ga0587085_028233
1854 Ga0501082_0623385
1855 Ga0530510_0029172
1856 2599477068
1857 2722726500
1858 2738762616
1859 2842906507
1860 2852626917
1861 2884938030
1862 2896319414
1863 2904783635
1864 2919182186
1865 2919442232
1866 2928078981
1867 2928148652
1868 2932085628
1869 3003233521
1870 8055590801

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.989 27 249
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9869 27 249
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9776 25 250
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9749 26 252
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9713 27 249
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.989 27 249 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 55 251 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9729 28 250 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9723 27 252 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 27 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H5S202-F1-model_v4 deleted 0.9979 28 250
AF-A0A1Q6ERV0-F1-model_v4 deleted 0.9961 31 250
AF-A0A1V4HEF9-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9906 28 251 GO:0005524
GO:0016887
AF-A0A7V4MYJ4-F1-model_v4 ABC transporter ATP-binding protein 0.9881 25 250 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A428XK65-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9869 26 251 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map