F486158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 362 | 1870 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10006019|Ga0182007_100060194 |
| Length | 295 |
| Sequence | MLLKTHFRGTDYDTYCDAYCYTGGKAFDPTLPTAVFIHGGQNDHSVWILQTRYFAHHGFGVLAVDLPGHGRSQGPALATIEELSDWLNSLLDAAGVTKAILVGHSMGSLIALETAGRAASSARIAGIALVGTAYPMKVADALLDAANNAQQSAIDMVNIWSHSTISPKPSAPGPGFYVQGASQRLMQRIARQSESKPTVFYTDFAACNSYANGEQASQAVTCPTLFLLGQRDVMTPAKAAAGLITAIKHAKVVQVEASGHALMAEQPDAVLDHLFKFATAALRSPSAVAAAIKGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 213 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 341 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 343 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 344 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 345 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 346 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 347 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 348 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 349 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 350 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 351 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 352 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 353 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 354 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 355 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 356 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 357 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 358 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 359 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 360 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 361 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 362 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 0 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.13 |
| Nodule | 0 |
| Rhizoplane | 2.78 |
| Rhizosphere | 85.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182007_10006019 | 3300015262 | Bacteria | 5253 |
| 2 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 3 | JGI25154J39366_1001019 | 3300002738 | Bacteria | 11278 |
| 4 | JGI25163J39215_1003650 | 3300002771 | Bacteria | 1199 |
| 5 | JGI25152J39213_1000065 | 3300002773 | Bacteria | 70114 |
| 6 | JGI25152J39213_1015922 | 3300002773 | Bacteria | 1468 |
| 7 | JGI25150J39212_1000346 | 3300002774 | Bacteria | 22735 |
| 8 | JGI25159J45721_1001368 | 3300002987 | Bacteria | 10158 |
| 9 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 10 | JGI25153J46596_10007935 | 3300003215 | Bacteria | 5147 |
| 11 | rootH1_10102612 | 3300003316 | Bacteria | 2224 |
| 12 | rootL2_10211091 | 3300003322 | Bacteria | 1084 |
| 13 | JGI25160J50197_1004125 | 3300003354 | Bacteria | 6335 |
| 14 | JGI25161J50226_1002833 | 3300003374 | Bacteria | 4249 |
| 15 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 16 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 17 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 18 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 19 | Ga0055526_1000023 | 3300003771 | Bacteria | 163444 |
| 20 | Ga0055526_1001736 | 3300003771 | Bacteria | 15136 |
| 21 | Ga0055537_1000063 | 3300003773 | Bacteria | 77468 |
| 22 | Ga0055537_1002797 | 3300003773 | Bacteria | 5615 |
| 23 | Ga0055524_1001987 | 3300003775 | Bacteria | 10946 |
| 24 | Ga0055524_1008914 | 3300003775 | Bacteria | 4128 |
| 25 | Ga0055534_1000208 | 3300003784 | Bacteria | 43225 |
| 26 | Ga0055528_1000013 | 3300003790 | Bacteria | 176239 |
| 27 | Ga0055530_10000461 | 3300003791 | Bacteria | 35997 |
| 28 | Ga0055530_10003093 | 3300003791 | Bacteria | 9880 |
| 29 | Ga0055530_10006707 | 3300003791 | Bacteria | 5055 |
| 30 | Ga0055531_10013515 | 3300003794 | Bacteria | 3755 |
| 31 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 32 | Ga0055543_1000422 | 3300004625 | Bacteria | 26656 |
| 33 | Ga0065165_1001381 | 3300005262 | Bacteria | 26656 |
| 34 | Ga0065165_1006361 | 3300005262 | Bacteria | 6227 |
| 35 | Ga0065714_10170089 | 3300005288 | Bacteria | 1007 |
| 36 | Ga0065715_10003962 | 3300005293 | Bacteria | 5049 |
| 37 | Ga0065715_10230288 | 3300005293 | Bacteria | 1234 |
| 38 | Ga0070676_10005143 | 3300005328 | Bacteria | 6943 |
| 39 | Ga0070676_10012878 | 3300005328 | Bacteria | 4579 |
| 40 | Ga0070676_10318258 | 3300005328 | Bacteria | 1060 |
| 41 | Ga0070690_100047413 | 3300005330 | Bacteria | 2734 |
| 42 | Ga0070690_100053410 | 3300005330 | Bacteria | 2585 |
| 43 | Ga0070670_100001112 | 3300005331 | Bacteria | 21385 |
| 44 | Ga0070670_100049502 | 3300005331 | Bacteria | 3613 |
| 45 | Ga0070670_100116793 | 3300005331 | Bacteria | 2301 |
| 46 | Ga0070670_100286196 | 3300005331 | Bacteria | 1439 |
| 47 | Ga0070670_100392460 | 3300005331 | Bacteria | 1224 |
| 48 | Ga0068869_100000291 | 3300005334 | Bacteria | 26709 |
| 49 | Ga0068869_100002348 | 3300005334 | Bacteria | 11388 |
| 50 | Ga0068869_100005568 | 3300005334 | Bacteria | 7926 |
| 51 | Ga0068869_100022000 | 3300005334 | Bacteria | 4389 |
| 52 | Ga0068869_100496261 | 3300005334 | Bacteria | 1018 |
| 53 | Ga0070666_10003040 | 3300005335 | Bacteria | 10181 |
| 54 | Ga0070666_10013730 | 3300005335 | Bacteria | 5143 |
| 55 | Ga0070666_10071851 | 3300005335 | Bacteria | 2356 |
| 56 | Ga0070682_100002234 | 3300005337 | Bacteria | 10738 |
| 57 | Ga0070660_100192344 | 3300005339 | Bacteria | 1653 |
| 58 | Ga0070689_100001992 | 3300005340 | Bacteria | 13236 |
| 59 | Ga0070691_10041187 | 3300005341 | Bacteria | 2183 |
| 60 | Ga0070687_100008539 | 3300005343 | Bacteria | 4346 |
| 61 | Ga0070661_100052320 | 3300005344 | Bacteria | 2989 |
| 62 | Ga0070692_10002809 | 3300005345 | Bacteria | 6875 |
| 63 | Ga0070692_10023681 | 3300005345 | Bacteria | 3011 |
| 64 | Ga0070668_100000278 | 3300005347 | Bacteria | 33870 |
| 65 | Ga0070668_100009945 | 3300005347 | Bacteria | 7047 |
| 66 | Ga0070668_100014523 | 3300005347 | Bacteria | 5886 |
| 67 | Ga0070668_100349400 | 3300005347 | Unclassified | 1251 |
| 68 | Ga0070669_100003607 | 3300005353 | Bacteria | 11170 |
| 69 | Ga0070669_100003853 | 3300005353 | Bacteria | 10837 |
| 70 | Ga0070669_100039052 | 3300005353 | Bacteria | 3448 |
| 71 | Ga0070669_100099933 | 3300005353 | Bacteria | 2187 |
| 72 | Ga0070675_100000728 | 3300005354 | Bacteria | 22905 |
| 73 | Ga0070675_100095212 | 3300005354 | Bacteria | 2500 |
| 74 | Ga0070675_100255197 | 3300005354 | Bacteria | 1535 |
| 75 | Ga0070675_100542306 | 3300005354 | Bacteria | 1051 |
| 76 | Ga0070671_100020282 | 3300005355 | Bacteria | 5419 |
| 77 | Ga0070674_100006874 | 3300005356 | Bacteria | 6667 |
| 78 | Ga0070673_100000973 | 3300005364 | Bacteria | 16260 |
| 79 | Ga0070673_100016641 | 3300005364 | Bacteria | 5207 |
| 80 | Ga0070688_100028467 | 3300005365 | Bacteria | 3336 |
| 81 | Ga0070667_100014030 | 3300005367 | Bacteria | 6623 |
| 82 | Ga0070667_100130097 | 3300005367 | Bacteria | 2196 |
| 83 | Ga0070701_10014527 | 3300005438 | Bacteria | 3614 |
| 84 | Ga0070705_100076881 | 3300005440 | Bacteria | 2037 |
| 85 | Ga0070700_100011183 | 3300005441 | Bacteria | 4967 |
| 86 | Ga0070663_100050102 | 3300005455 | Bacteria | 2968 |
| 87 | Ga0070663_100204787 | 3300005455 | Bacteria | 1542 |
| 88 | Ga0070678_100003218 | 3300005456 | Bacteria | 9064 |
| 89 | Ga0070678_100015793 | 3300005456 | Bacteria | 4809 |
| 90 | Ga0070678_100576932 | 3300005456 | Bacteria | 1001 |
| 91 | Ga0070681_10006107 | 3300005458 | Bacteria | 11688 |
| 92 | Ga0070681_10087514 | 3300005458 | Bacteria | 3068 |
| 93 | Ga0070681_10349502 | 3300005458 | Bacteria | 1389 |
| 94 | Ga0068867_100021693 | 3300005459 | Bacteria | 4583 |
| 95 | Ga0068867_100039158 | 3300005459 | Bacteria | 3455 |
| 96 | Ga0070707_100090234 | 3300005468 | Bacteria | 2966 |
| 97 | Ga0070698_100041150 | 3300005471 | Bacteria | 4745 |
| 98 | Ga0070698_100082890 | 3300005471 | Bacteria | 3198 |
| 99 | Ga0070699_100083368 | 3300005518 | Bacteria | 2788 |
| 100 | Ga0070699_100548129 | 3300005518 | Bacteria | 1052 |
| 101 | Ga0070679_100138478 | 3300005530 | Bacteria | 2415 |
| 102 | Ga0068853_100001406 | 3300005539 | Bacteria | 17367 |
| 103 | Ga0070672_100001592 | 3300005543 | Bacteria | 14080 |
| 104 | Ga0070672_100003716 | 3300005543 | Bacteria | 9929 |
| 105 | Ga0070686_100019140 | 3300005544 | Bacteria | 4029 |
| 106 | Ga0070695_100174311 | 3300005545 | Bacteria | 1519 |
| 107 | Ga0070696_100133093 | 3300005546 | Bacteria | 1811 |
| 108 | Ga0070665_100070093 | 3300005548 | Bacteria | 3512 |
| 109 | Ga0070665_100206326 | 3300005548 | Bacteria | 1966 |
| 110 | Ga0070665_100331401 | 3300005548 | Bacteria | 1527 |
| 111 | Ga0070704_100276094 | 3300005549 | Bacteria | 1390 |
| 112 | Ga0068855_100018998 | 3300005563 | Bacteria | 8264 |
| 113 | Ga0068855_100361479 | 3300005563 | Bacteria | 1597 |
| 114 | Ga0068855_100446376 | 3300005563 | Bacteria | 1412 |
| 115 | Ga0070664_100094498 | 3300005564 | Bacteria | 2592 |
| 116 | Ga0068857_100007996 | 3300005577 | Bacteria | 9125 |
| 117 | Ga0068857_100013001 | 3300005577 | Bacteria | 7252 |
| 118 | Ga0068854_100143918 | 3300005578 | Bacteria | 1832 |
| 119 | Ga0068856_100826701 | 3300005614 | Bacteria | 946 |
| 120 | Ga0070702_100001644 | 3300005615 | Bacteria | 9261 |
| 121 | Ga0070702_100047302 | 3300005615 | Bacteria | 2443 |
| 122 | Ga0068859_100010193 | 3300005617 | Bacteria | 9459 |
| 123 | Ga0068859_100088188 | 3300005617 | Bacteria | 3151 |
| 124 | Ga0068859_100096071 | 3300005617 | Bacteria | 3016 |
| 125 | Ga0068859_100164744 | 3300005617 | Unclassified | 2296 |
| 126 | Ga0068859_100219727 | 3300005617 | Bacteria | 1988 |
| 127 | Ga0068859_100540275 | 3300005617 | Bacteria | 1260 |
| 128 | Ga0068864_100022171 | 3300005618 | Bacteria | 5325 |
| 129 | Ga0068866_10001046 | 3300005718 | Bacteria | 12179 |
| 130 | Ga0068861_100010393 | 3300005719 | Bacteria | 6457 |
| 131 | Ga0068861_100512711 | 3300005719 | Bacteria | 1086 |
| 132 | Ga0068870_10117575 | 3300005840 | Bacteria | 1527 |
| 133 | Ga0068863_100000706 | 3300005841 | Bacteria | 33628 |
| 134 | Ga0068863_100092019 | 3300005841 | Bacteria | 2877 |
| 135 | Ga0068858_100028351 | 3300005842 | Bacteria | 5202 |
| 136 | Ga0068858_100174331 | 3300005842 | Bacteria | 2029 |
| 137 | Ga0068860_100001246 | 3300005843 | Bacteria | 27761 |
| 138 | Ga0068860_100012972 | 3300005843 | Bacteria | 8185 |
| 139 | Ga0068860_100033588 | 3300005843 | Bacteria | 4922 |
| 140 | Ga0068860_100074636 | 3300005843 | Bacteria | 3225 |
| 141 | Ga0068860_100109058 | 3300005843 | Bacteria | 2646 |
| 142 | Ga0068862_100005052 | 3300005844 | Bacteria | 11098 |
| 143 | Ga0068862_100104997 | 3300005844 | Unclassified | 2476 |
| 144 | Ga0068862_100197409 | 3300005844 | Bacteria | 1813 |
| 145 | Ga0068862_100318643 | 3300005844 | Bacteria | 1434 |
| 146 | Ga0070716_100118245 | 3300006173 | Bacteria | 1654 |
| 147 | Ga0097621_100003745 | 3300006237 | Bacteria | 10534 |
| 148 | Ga0097621_100003861 | 3300006237 | Bacteria | 10381 |
| 149 | Ga0097621_100081772 | 3300006237 | Bacteria | 2689 |
| 150 | Ga0097621_100778738 | 3300006237 | Bacteria | 885 |
| 151 | Ga0068871_100001583 | 3300006358 | Bacteria | 15308 |
| 152 | Ga0068871_100008576 | 3300006358 | Bacteria | 7349 |
| 153 | Ga0068871_100036330 | 3300006358 | Bacteria | 3922 |
| 154 | Ga0068871_100395444 | 3300006358 | Bacteria | 1230 |
| 155 | Ga0075433_10017285 | 3300006852 | Bacteria | 5970 |
| 156 | Ga0075434_100002459 | 3300006871 | Bacteria | 16305 |
| 157 | Ga0075434_100208310 | 3300006871 | Bacteria | 1976 |
| 158 | Ga0068865_100001318 | 3300006881 | Bacteria | 14471 |
| 159 | Ga0068865_100008961 | 3300006881 | Bacteria | 6193 |
| 160 | Ga0068865_100086428 | 3300006881 | Bacteria | 2264 |
| 161 | Ga0075436_100028068 | 3300006914 | Bacteria | 3874 |
| 162 | Ga0097620_100010193 | 3300006931 | Bacteria | 9459 |
| 163 | Ga0097620_100088193 | 3300006931 | Bacteria | 3151 |
| 164 | Ga0097620_100096079 | 3300006931 | Bacteria | 3016 |
| 165 | Ga0097620_100164738 | 3300006931 | Unclassified | 2296 |
| 166 | Ga0097620_100219725 | 3300006931 | Bacteria | 1988 |
| 167 | Ga0097620_100540345 | 3300006931 | Bacteria | 1260 |
| 168 | Ga0075435_100383230 | 3300007076 | Bacteria | 1208 |
| 169 | Ga0105245_10001874 | 3300009098 | Bacteria | 19095 |
| 170 | Ga0105245_10068769 | 3300009098 | Bacteria | 3210 |
| 171 | Ga0105247_10023982 | 3300009101 | Bacteria | 3675 |
| 172 | Ga0114129_10720569 | 3300009147 | Bacteria | 1280 |
| 173 | Ga0105243_10015224 | 3300009148 | Bacteria | 5820 |
| 174 | Ga0105243_10375329 | 3300009148 | Bacteria | 1313 |
| 175 | Ga0105241_10011098 | 3300009174 | Bacteria | 6610 |
| 176 | Ga0105242_10028096 | 3300009176 | Bacteria | 4474 |
| 177 | Ga0105242_10061461 | 3300009176 | Bacteria | 3090 |
| 178 | Ga0105248_10017738 | 3300009177 | Bacteria | 7851 |
| 179 | Ga0105248_10032456 | 3300009177 | Bacteria | 5837 |
| 180 | Ga0105248_10039352 | 3300009177 | Bacteria | 5294 |
| 181 | Ga0105248_11109063 | 3300009177 | Unclassified | 894 |
| 182 | Ga0105237_10679688 | 3300009545 | Bacteria | 1036 |
| 183 | Ga0105249_10024362 | 3300009553 | Bacteria | 5439 |
| 184 | Ga0105249_10071331 | 3300009553 | Unclassified | 3209 |
| 185 | Ga0105249_10180532 | 3300009553 | Bacteria | 2053 |
| 186 | Ga0105239_10005320 | 3300010375 | Bacteria | 15107 |
| 187 | Ga0105239_10206263 | 3300010375 | Bacteria | 2202 |
| 188 | Ga0105239_10221443 | 3300010375 | Bacteria | 2122 |
| 189 | Ga0105239_10233541 | 3300010375 | Bacteria | 2064 |
| 190 | Ga0105246_10247582 | 3300011119 | Bacteria | 1413 |
| 191 | Ga0105246_10249593 | 3300011119 | Bacteria | 1407 |
| 192 | Ga0157374_10001776 | 3300013296 | Bacteria | 18141 |
| 193 | Ga0157378_10035232 | 3300013297 | Bacteria | 4427 |
| 194 | Ga0157378_10062343 | 3300013297 | Bacteria | 3329 |
| 195 | Ga0157378_10187039 | 3300013297 | Bacteria | 1951 |
| 196 | Ga0163162_10019047 | 3300013306 | Bacteria | 6731 |
| 197 | Ga0163162_10055366 | 3300013306 | Bacteria | 3992 |
| 198 | Ga0163162_10503507 | 3300013306 | Bacteria | 1341 |
| 199 | Ga0157375_10066464 | 3300013308 | Unclassified | 3600 |
| 200 | Ga0157375_10068729 | 3300013308 | Bacteria | 3546 |
| 201 | Ga0157375_10082118 | 3300013308 | Bacteria | 3264 |
| 202 | Ga0157375_10337929 | 3300013308 | Bacteria | 1671 |
| 203 | Ga0157375_10437743 | 3300013308 | Bacteria | 1473 |
| 204 | Ga0163163_10000704 | 3300014325 | Bacteria | 28383 |
| 205 | Ga0157380_10018746 | 3300014326 | Bacteria | 5144 |
| 206 | Ga0157380_10448278 | 3300014326 | Bacteria | 1239 |
| 207 | Ga0182008_10000119 | 3300014497 | Bacteria | 59427 |
| 208 | Ga0182008_10067880 | 3300014497 | Bacteria | 1755 |
| 209 | Ga0157379_10000063 | 3300014968 | Bacteria | 68139 |
| 210 | Ga0157379_10005248 | 3300014968 | Bacteria | 11126 |
| 211 | Ga0157379_10078545 | 3300014968 | Bacteria | 2956 |
| 212 | Ga0157379_10916230 | 3300014968 | Unclassified | 832 |
| 213 | Ga0157376_10007237 | 3300014969 | Bacteria | 7899 |
| 214 | Ga0157376_10015494 | 3300014969 | Bacteria | 5759 |
| 215 | Ga0182006_1000067 | 3300015261 | Bacteria | 147932 |
| 216 | Ga0182006_1006797 | 3300015261 | Bacteria | 5277 |
| 217 | Ga0182007_10000372 | 3300015262 | Bacteria | 28197 |
| 218 | Ga0182007_10012853 | 3300015262 | Bacteria | 3210 |
| 219 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 220 | Ga0182005_1012480 | 3300015265 | Bacteria | 2398 |
| 221 | Ga0163161_10005333 | 3300017792 | Bacteria | 8941 |
| 222 | Ga0163161_10034189 | 3300017792 | Bacteria | 3635 |
| 223 | Ga0213872_10000148 | 3300021361 | Bacteria | 64199 |
| 224 | Ga0213872_10008640 | 3300021361 | Bacteria | 4920 |
| 225 | Ga0213872_10026310 | 3300021361 | Bacteria | 2672 |
| 226 | Ga0213872_10034502 | 3300021361 | Bacteria | 2315 |
| 227 | Ga0209436_100212 | 3300025208 | Bacteria | 26888 |
| 228 | Ga0209436_104879 | 3300025208 | Bacteria | 3212 |
| 229 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 230 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 231 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 232 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 233 | Ga0207427_101091 | 3300025231 | Bacteria | 11062 |
| 234 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 235 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 236 | Ga0207425_1000048 | 3300025245 | Bacteria | 188748 |
| 237 | Ga0207425_1032299 | 3300025245 | Bacteria | 1037 |
| 238 | Ga0209646_1000252 | 3300025246 | Bacteria | 53546 |
| 239 | Ga0209026_1006209 | 3300025250 | Bacteria | 2989 |
| 240 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 241 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 242 | Ga0209129_1001011 | 3300025258 | Bacteria | 16764 |
| 243 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 244 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 245 | Ga0209565_1000369 | 3300025263 | Bacteria | 38452 |
| 246 | Ga0209565_1000940 | 3300025263 | Bacteria | 15334 |
| 247 | Ga0209565_1006948 | 3300025263 | Bacteria | 3109 |
| 248 | Ga0209565_1017460 | 3300025263 | Bacteria | 1573 |
| 249 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 250 | Ga0209130_1000352 | 3300025284 | Bacteria | 52650 |
| 251 | Ga0209130_1016931 | 3300025284 | Bacteria | 1749 |
| 252 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 253 | Ga0209675_1002174 | 3300025291 | Bacteria | 10320 |
| 254 | Ga0209675_1002350 | 3300025291 | Bacteria | 9764 |
| 255 | Ga0209675_1002512 | 3300025291 | Bacteria | 9376 |
| 256 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 257 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 258 | Ga0209564_1000199 | 3300025295 | Bacteria | 138027 |
| 259 | Ga0209564_1006244 | 3300025295 | Bacteria | 6498 |
| 260 | Ga0209564_1010716 | 3300025295 | Bacteria | 4186 |
| 261 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 262 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 263 | Ga0209050_1000089 | 3300025298 | Bacteria | 256212 |
| 264 | Ga0209050_1002225 | 3300025298 | Bacteria | 17367 |
| 265 | Ga0209256_1000112 | 3300025299 | Bacteria | 178432 |
| 266 | Ga0209256_1000163 | 3300025299 | Bacteria | 136008 |
| 267 | Ga0209256_1000576 | 3300025299 | Bacteria | 52365 |
| 268 | Ga0207426_1007235 | 3300025302 | Bacteria | 4677 |
| 269 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 270 | Ga0207697_10007677 | 3300025315 | Bacteria | 4784 |
| 271 | Ga0207656_10153105 | 3300025321 | Bacteria | 1093 |
| 272 | Ga0207642_10007226 | 3300025899 | Bacteria | 3740 |
| 273 | Ga0207642_10101378 | 3300025899 | Bacteria | 1446 |
| 274 | Ga0207680_10056595 | 3300025903 | Bacteria | 2369 |
| 275 | Ga0207680_10065673 | 3300025903 | Bacteria | 2229 |
| 276 | Ga0207645_10000431 | 3300025907 | Bacteria | 34728 |
| 277 | Ga0207645_10007744 | 3300025907 | Bacteria | 7561 |
| 278 | Ga0207705_10175110 | 3300025909 | Bacteria | 1617 |
| 279 | Ga0207707_10170412 | 3300025912 | Bacteria | 1902 |
| 280 | Ga0207660_10109548 | 3300025917 | Unclassified | 2076 |
| 281 | Ga0207657_10183869 | 3300025919 | Bacteria | 1689 |
| 282 | Ga0207681_10005745 | 3300025923 | Bacteria | 7608 |
| 283 | Ga0207681_10060466 | 3300025923 | Bacteria | 2601 |
| 284 | Ga0207681_10142902 | 3300025923 | Bacteria | 1784 |
| 285 | Ga0207650_10006135 | 3300025925 | Bacteria | 8188 |
| 286 | Ga0207650_10011955 | 3300025925 | Bacteria | 5984 |
| 287 | Ga0207650_10012302 | 3300025925 | Bacteria | 5905 |
| 288 | Ga0207650_10013884 | 3300025925 | Bacteria | 5587 |
| 289 | Ga0207659_10026794 | 3300025926 | Bacteria | 3895 |
| 290 | Ga0207659_10520711 | 3300025926 | Bacteria | 1008 |
| 291 | Ga0207687_10044856 | 3300025927 | Unclassified | 3054 |
| 292 | Ga0207687_10063749 | 3300025927 | Bacteria | 2610 |
| 293 | Ga0207687_10232475 | 3300025927 | Bacteria | 1457 |
| 294 | Ga0207706_10189673 | 3300025933 | Bacteria | 1805 |
| 295 | Ga0207686_10009611 | 3300025934 | Bacteria | 5249 |
| 296 | Ga0207686_10037172 | 3300025934 | Bacteria | 2937 |
| 297 | Ga0207686_10118634 | 3300025934 | Bacteria | 1797 |
| 298 | Ga0207709_10126082 | 3300025935 | Bacteria | 1737 |
| 299 | Ga0207670_10015244 | 3300025936 | Bacteria | 4587 |
| 300 | Ga0207670_10274607 | 3300025936 | Bacteria | 1311 |
| 301 | Ga0207669_10004360 | 3300025937 | Bacteria | 6218 |
| 302 | Ga0207669_10300914 | 3300025937 | Bacteria | 1219 |
| 303 | Ga0207704_10009528 | 3300025938 | Bacteria | 4690 |
| 304 | Ga0207704_10049901 | 3300025938 | Unclassified | 2521 |
| 305 | Ga0207704_10104589 | 3300025938 | Bacteria | 1897 |
| 306 | Ga0207665_10154007 | 3300025939 | Bacteria | 1648 |
| 307 | Ga0207691_10000505 | 3300025940 | Bacteria | 38820 |
| 308 | Ga0207691_10047931 | 3300025940 | Bacteria | 3919 |
| 309 | Ga0207711_10019187 | 3300025941 | Bacteria | 5693 |
| 310 | Ga0207689_10000116 | 3300025942 | Bacteria | 65521 |
| 311 | Ga0207689_10000489 | 3300025942 | Bacteria | 37464 |
| 312 | Ga0207689_10002700 | 3300025942 | Bacteria | 16413 |
| 313 | Ga0207689_10016672 | 3300025942 | Bacteria | 6217 |
| 314 | Ga0207679_10191407 | 3300025945 | Bacteria | 1701 |
| 315 | Ga0207667_10064560 | 3300025949 | Bacteria | 3822 |
| 316 | Ga0207651_10009338 | 3300025960 | Bacteria | 5361 |
| 317 | Ga0207712_10167936 | 3300025961 | Unclassified | 1712 |
| 318 | Ga0207668_10000872 | 3300025972 | Bacteria | 18182 |
| 319 | Ga0207668_10507727 | 3300025972 | Bacteria | 1038 |
| 320 | Ga0207658_10007011 | 3300025986 | Bacteria | 7673 |
| 321 | Ga0207658_10100797 | 3300025986 | Bacteria | 2261 |
| 322 | Ga0207677_10008956 | 3300026023 | Bacteria | 5616 |
| 323 | Ga0207677_10391084 | 3300026023 | Bacteria | 1176 |
| 324 | Ga0207703_10000526 | 3300026035 | Bacteria | 39358 |
| 325 | Ga0207703_10030338 | 3300026035 | Bacteria | 4272 |
| 326 | Ga0207703_10369098 | 3300026035 | Bacteria | 1325 |
| 327 | Ga0207639_10002828 | 3300026041 | Bacteria | 11647 |
| 328 | Ga0207678_10113375 | 3300026067 | Bacteria | 2313 |
| 329 | Ga0207708_10001327 | 3300026075 | Bacteria | 18603 |
| 330 | Ga0207708_10037606 | 3300026075 | Bacteria | 3687 |
| 331 | Ga0207641_10001558 | 3300026088 | Bacteria | 22463 |
| 332 | Ga0207641_10007493 | 3300026088 | Bacteria | 9084 |
| 333 | Ga0207641_10075828 | 3300026088 | Bacteria | 2905 |
| 334 | Ga0207648_10000235 | 3300026089 | Bacteria | 59522 |
| 335 | Ga0207648_10002770 | 3300026089 | Bacteria | 18599 |
| 336 | Ga0207648_10011668 | 3300026089 | Bacteria | 8269 |
| 337 | Ga0207648_10023006 | 3300026089 | Bacteria | 5588 |
| 338 | Ga0207676_10126889 | 3300026095 | Bacteria | 2162 |
| 339 | Ga0207674_10010096 | 3300026116 | Bacteria | 10736 |
| 340 | Ga0207674_10063070 | 3300026116 | Bacteria | 3742 |
| 341 | Ga0207675_100000429 | 3300026118 | Bacteria | 40687 |
| 342 | Ga0207675_100000505 | 3300026118 | Bacteria | 37899 |
| 343 | Ga0207675_100074020 | 3300026118 | Bacteria | 3187 |
| 344 | Ga0207675_100776290 | 3300026118 | Bacteria | 970 |
| 345 | Ga0207683_10000063 | 3300026121 | Bacteria | 80638 |
| 346 | Ga0207683_10026337 | 3300026121 | Bacteria | 5019 |
| 347 | Ga0207683_10054624 | 3300026121 | Bacteria | 3502 |
| 348 | Ga0207683_10086287 | 3300026121 | Bacteria | 2790 |
| 349 | Ga0207683_10556042 | 3300026121 | Bacteria | 1061 |
| 350 | Ga0207698_10026942 | 3300026142 | Bacteria | 4073 |
| 351 | Ga0207698_10247849 | 3300026142 | Bacteria | 1628 |
| 352 | Ga0268266_10022024 | 3300028379 | Bacteria | 5432 |
| 353 | Ga0268266_10267470 | 3300028379 | Bacteria | 1586 |
| 354 | Ga0268265_10025979 | 3300028380 | Bacteria | 4163 |
| 355 | Ga0268265_10099033 | 3300028380 | Bacteria | 2349 |
| 356 | Ga0268265_10127067 | 3300028380 | Bacteria | 2112 |
| 357 | Ga0268264_10002349 | 3300028381 | Bacteria | 16720 |
| 358 | Ga0268264_10052651 | 3300028381 | Bacteria | 3394 |
| 359 | Ga0268264_10369959 | 3300028381 | Bacteria | 1370 |
| 360 | Ga0268264_10931704 | 3300028381 | Bacteria | 873 |
| 361 | Ga0265318_10008402 | 3300028577 | Bacteria | 4600 |
| 362 | Ga0316182_1282003 | 3300030745 | Bacteria | 1447 |
| 363 | Ga0265330_10021196 | 3300031235 | Bacteria | 2968 |
| 364 | Ga0265332_10005981 | 3300031238 | Bacteria | 5563 |
| 365 | Ga0265328_10003414 | 3300031239 | Bacteria | 7016 |
| 366 | Ga0265320_10064722 | 3300031240 | Bacteria | 1736 |
| 367 | Ga0265329_10009664 | 3300031242 | Bacteria | 3583 |
| 368 | Ga0265316_10067031 | 3300031344 | Bacteria | 2776 |
| 369 | Ga0307408_100000450 | 3300031548 | Bacteria | 36035 |
| 370 | Ga0307408_100003487 | 3300031548 | Bacteria | 10730 |
| 371 | Ga0307408_100025596 | 3300031548 | Bacteria | 4043 |
| 372 | Ga0307408_100025748 | 3300031548 | Bacteria | 4031 |
| 373 | Ga0307408_100033282 | 3300031548 | Bacteria | 3600 |
| 374 | Ga0265313_10141625 | 3300031595 | Bacteria | 1033 |
| 375 | Ga0265314_10001661 | 3300031711 | Bacteria | 24263 |
| 376 | Ga0265314_10016583 | 3300031711 | Bacteria | 5811 |
| 377 | Ga0307405_10001199 | 3300031731 | Bacteria | 10733 |
| 378 | Ga0307410_10010401 | 3300031852 | Bacteria | 5266 |
| 379 | Ga0307406_10007424 | 3300031901 | Bacteria | 6077 |
| 380 | Ga0307407_10001125 | 3300031903 | Bacteria | 9358 |
| 381 | Ga0307409_100011853 | 3300031995 | Bacteria | 5521 |
| 382 | Ga0307416_100012219 | 3300032002 | Bacteria | 5771 |
| 383 | Ga0307416_100015946 | 3300032002 | Bacteria | 5206 |
| 384 | Ga0307414_10013534 | 3300032004 | Bacteria | 4861 |
| 385 | Ga0307411_10015490 | 3300032005 | Bacteria | 4284 |
| 386 | Ga0373936_0128937 | 3300035113 | Unclassified | 1086 |
| 387 | Ga0373955_0404923 | 3300035172 | Bacteria | 829 |
| 388 | Ga0373935_0223135 | 3300035692 | Bacteria | 1310 |
| 389 | Ga0373937_0241975 | 3300036401 | Bacteria | 1700 |
| 390 | Ga0395899_0005018 | 3300037312 | Bacteria | 10292 |
| 391 | Ga0395900_0046243 | 3300037418 | Bacteria | 4482 |
| 392 | Ga0395900_0347333 | 3300037418 | Bacteria | 1458 |
| 393 | Ga0395900_0676480 | 3300037418 | Bacteria | 967 |
| 394 | Ga0395898_0262927 | 3300037466 | Bacteria | 1646 |
| 395 | Ga0395898_0330134 | 3300037466 | Bacteria | 1454 |
| 396 | Ga0395898_0420912 | 3300037466 | Bacteria | 1273 |
| 397 | Ga0395905_0001910 | 3300037471 | Bacteria | 23959 |
| 398 | Ga0395905_0013721 | 3300037471 | Bacteria | 7757 |
| 399 | Ga0395905_0065260 | 3300037471 | Bacteria | 3408 |
| 400 | Ga0395901_0054440 | 3300038443 | Bacteria | 4159 |
| 401 | Ga0436361_0085830 | 3300039447 | Bacteria | 6331 |
| 402 | Ga0436361_0249401 | 3300039447 | Bacteria | 41096 |
| 403 | Ga0436361_0309154 | 3300039447 | Bacteria | 6539 |
| 404 | Ga0436361_0429789 | 3300039447 | Bacteria | 6295 |
| 405 | Ga0436361_0438898 | 3300039447 | Bacteria | 2364 |
| 406 | Ga0439462_0107926 | 3300042015 | Bacteria | 770 |
| 407 | Ga0450904_001402 | 3300042139 | Bacteria | 3425 |
| 408 | Ga0451577_0187254 | 3300042876 | Bacteria | 1867 |
| 409 | Ga0466961_0000078 | 3300044693 | Bacteria | 60385 |
| 410 | Ga0466964_0007438 | 3300044706 | Bacteria | 4097 |
| 411 | Ga0453684_0000508 | 3300044712 | Bacteria | 151703 |
| 412 | Ga0466970_0009010 | 3300044765 | Bacteria | 5034 |
| 413 | Ga0466959_0021140 | 3300045049 | Bacteria | 4797 |
| 414 | Ga0466959_0061931 | 3300045049 | Bacteria | 2720 |
| 415 | Ga0451576_0052326 | 3300045051 | Bacteria | 4279 |
| 416 | Ga0495617_000012 | 3300046452 | Bacteria | 295916 |
| 417 | Ga0495617_000475 | 3300046452 | Bacteria | 21325 |
| 418 | Ga0495617_004034 | 3300046452 | Bacteria | 5394 |
| 419 | Ga0495617_004809 | 3300046452 | Bacteria | 4869 |
| 420 | Ga0495617_005218 | 3300046452 | Bacteria | 4631 |
| 421 | Ga0495627_000651 | 3300046453 | Bacteria | 26838 |
| 422 | Ga0495627_017673 | 3300046453 | Bacteria | 2418 |
| 423 | Ga0495627_020741 | 3300046453 | Bacteria | 2187 |
| 424 | Ga0495592_0067577 | 3300046454 | Bacteria | 2611 |
| 425 | Ga0495603_0007537 | 3300046455 | Bacteria | 6543 |
| 426 | Ga0495603_0027815 | 3300046455 | Bacteria | 3410 |
| 427 | Ga0495603_0098611 | 3300046455 | Bacteria | 1706 |
| 428 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 429 | Ga0495590_0000206 | 3300046457 | Bacteria | 32748 |
| 430 | Ga0495590_0001065 | 3300046457 | Bacteria | 12086 |
| 431 | Ga0495590_0003195 | 3300046457 | Bacteria | 6701 |
| 432 | Ga0495590_0091975 | 3300046457 | Bacteria | 1073 |
| 433 | Ga0495591_007517 | 3300046458 | Bacteria | 4620 |
| 434 | Ga0495629_0040129 | 3300046459 | Bacteria | 3293 |
| 435 | Ga0495629_0136444 | 3300046459 | Bacteria | 1708 |
| 436 | Ga0495629_0165501 | 3300046459 | Bacteria | 1535 |
| 437 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 438 | Ga0495638_0024991 | 3300046460 | Bacteria | 3888 |
| 439 | Ga0495638_0075857 | 3300046460 | Bacteria | 2048 |
| 440 | Ga0495638_0098261 | 3300046460 | Bacteria | 1754 |
| 441 | Ga0495638_0121858 | 3300046460 | Bacteria | 1540 |
| 442 | Ga0495653_0008032 | 3300046463 | Bacteria | 8642 |
| 443 | Ga0495653_0059077 | 3300046463 | Bacteria | 2912 |
| 444 | Ga0495653_0067902 | 3300046463 | Bacteria | 2675 |
| 445 | Ga0495650_0000646 | 3300046471 | Bacteria | 45968 |
| 446 | Ga0495650_0006164 | 3300046471 | Bacteria | 7536 |
| 447 | Ga0495650_0040252 | 3300046471 | Bacteria | 2008 |
| 448 | Ga0495580_0067988 | 3300046472 | Bacteria | 2492 |
| 449 | Ga0495580_0343213 | 3300046472 | Bacteria | 1012 |
| 450 | Ga0495582_0003091 | 3300046473 | Bacteria | 9330 |
| 451 | Ga0495582_0008422 | 3300046473 | Bacteria | 5689 |
| 452 | Ga0495582_0091027 | 3300046473 | Bacteria | 1701 |
| 453 | Ga0495605_0000072 | 3300046474 | Bacteria | 133731 |
| 454 | Ga0495605_0039535 | 3300046474 | Bacteria | 2362 |
| 455 | Ga0495605_0060759 | 3300046474 | Bacteria | 1810 |
| 456 | Ga0495605_0069549 | 3300046474 | Bacteria | 1666 |
| 457 | Ga0495605_0103715 | 3300046474 | Bacteria | 1304 |
| 458 | Ga0495639_0009710 | 3300046475 | Bacteria | 4130 |
| 459 | Ga0495639_0144579 | 3300046475 | Bacteria | 1145 |
| 460 | Ga0495584_0000377 | 3300046491 | Bacteria | 30691 |
| 461 | Ga0495584_0000452 | 3300046491 | Bacteria | 28285 |
| 462 | Ga0495584_0002429 | 3300046491 | Bacteria | 10564 |
| 463 | Ga0495584_0011048 | 3300046491 | Bacteria | 4630 |
| 464 | Ga0495584_0014683 | 3300046491 | Bacteria | 3990 |
| 465 | Ga0495584_0043931 | 3300046491 | Bacteria | 2256 |
| 466 | Ga0495584_0063386 | 3300046491 | Bacteria | 1858 |
| 467 | Ga0495584_0093090 | 3300046491 | Bacteria | 1520 |
| 468 | Ga0495584_0118737 | 3300046491 | Bacteria | 1339 |
| 469 | Ga0495584_0131007 | 3300046491 | Bacteria | 1272 |
| 470 | Ga0495585_0000600 | 3300046492 | Bacteria | 33658 |
| 471 | Ga0495585_0000649 | 3300046492 | Bacteria | 31919 |
| 472 | Ga0495585_0001573 | 3300046492 | Bacteria | 17726 |
| 473 | Ga0495585_0001842 | 3300046492 | Bacteria | 16034 |
| 474 | Ga0495585_0011508 | 3300046492 | Bacteria | 5235 |
| 475 | Ga0495585_0015549 | 3300046492 | Bacteria | 4421 |
| 476 | Ga0495585_0015563 | 3300046492 | Bacteria | 4419 |
| 477 | Ga0495585_0035820 | 3300046492 | Bacteria | 2802 |
| 478 | Ga0495585_0037658 | 3300046492 | Bacteria | 2723 |
| 479 | Ga0495585_0048206 | 3300046492 | Bacteria | 2369 |
| 480 | Ga0495585_0056323 | 3300046492 | Bacteria | 2171 |
| 481 | Ga0495585_0057705 | 3300046492 | Bacteria | 2142 |
| 482 | Ga0495585_0062291 | 3300046492 | Bacteria | 2049 |
| 483 | Ga0495585_0074545 | 3300046492 | Bacteria | 1846 |
| 484 | Ga0495585_0088844 | 3300046492 | Bacteria | 1666 |
| 485 | Ga0495594_0065415 | 3300046499 | Bacteria | 2016 |
| 486 | Ga0495594_0067197 | 3300046499 | Bacteria | 1989 |
| 487 | Ga0495594_0068534 | 3300046499 | Bacteria | 1970 |
| 488 | Ga0495594_0077075 | 3300046499 | Bacteria | 1859 |
| 489 | Ga0495594_0084246 | 3300046499 | Bacteria | 1777 |
| 490 | Ga0495594_0127099 | 3300046499 | Bacteria | 1442 |
| 491 | Ga0495596_0000623 | 3300046500 | Bacteria | 22239 |
| 492 | Ga0495596_0001509 | 3300046500 | Bacteria | 13308 |
| 493 | Ga0495596_0001827 | 3300046500 | Bacteria | 11811 |
| 494 | Ga0495596_0013959 | 3300046500 | Bacteria | 3392 |
| 495 | Ga0495596_0028653 | 3300046500 | Bacteria | 2235 |
| 496 | Ga0495596_0098241 | 3300046500 | Bacteria | 1136 |
| 497 | Ga0495607_0001841 | 3300046501 | Bacteria | 18064 |
| 498 | Ga0495607_0002196 | 3300046501 | Bacteria | 16190 |
| 499 | Ga0495607_0003038 | 3300046501 | Bacteria | 13079 |
| 500 | Ga0495607_0023479 | 3300046501 | Bacteria | 3860 |
| 501 | Ga0495607_0023728 | 3300046501 | Bacteria | 3835 |
| 502 | Ga0495607_0026837 | 3300046501 | Bacteria | 3569 |
| 503 | Ga0495607_0027894 | 3300046501 | Bacteria | 3486 |
| 504 | Ga0495607_0040964 | 3300046501 | Bacteria | 2753 |
| 505 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 506 | Ga0495583_0000396 | 3300046506 | Bacteria | 66329 |
| 507 | Ga0495583_0000691 | 3300046506 | Bacteria | 43701 |
| 508 | Ga0495583_0001072 | 3300046506 | Bacteria | 30556 |
| 509 | Ga0495583_0001093 | 3300046506 | Bacteria | 30047 |
| 510 | Ga0495583_0002696 | 3300046506 | Bacteria | 14752 |
| 511 | Ga0495583_0009089 | 3300046506 | Bacteria | 5975 |
| 512 | Ga0495583_0014056 | 3300046506 | Bacteria | 4430 |
| 513 | Ga0495583_0020584 | 3300046506 | Bacteria | 3412 |
| 514 | Ga0495583_0021156 | 3300046506 | Bacteria | 3351 |
| 515 | Ga0495583_0022957 | 3300046506 | Bacteria | 3169 |
| 516 | Ga0495583_0027879 | 3300046506 | Bacteria | 2782 |
| 517 | Ga0495583_0038338 | 3300046506 | Bacteria | 2264 |
| 518 | Ga0495583_0113999 | 3300046506 | Bacteria | 1143 |
| 519 | Ga0495606_0001127 | 3300046507 | Bacteria | 38097 |
| 520 | Ga0495606_0001851 | 3300046507 | Bacteria | 26596 |
| 521 | Ga0495606_0002663 | 3300046507 | Bacteria | 20322 |
| 522 | Ga0495606_0002699 | 3300046507 | Bacteria | 20051 |
| 523 | Ga0495606_0023989 | 3300046507 | Bacteria | 4408 |
| 524 | Ga0495606_0031007 | 3300046507 | Bacteria | 3723 |
| 525 | Ga0495606_0046107 | 3300046507 | Bacteria | 2883 |
| 526 | Ga0495606_0049977 | 3300046507 | Bacteria | 2738 |
| 527 | Ga0495606_0057973 | 3300046507 | Bacteria | 2492 |
| 528 | Ga0495606_0115739 | 3300046507 | Bacteria | 1611 |
| 529 | Ga0495606_0176526 | 3300046507 | Bacteria | 1235 |
| 530 | Ga0495606_0200590 | 3300046507 | Bacteria | 1137 |
| 531 | Ga0495608_0028441 | 3300046511 | Bacteria | 3799 |
| 532 | Ga0495610_0000554 | 3300046512 | Bacteria | 37430 |
| 533 | Ga0495610_0010485 | 3300046512 | Bacteria | 5755 |
| 534 | Ga0495610_0020541 | 3300046512 | Bacteria | 3664 |
| 535 | Ga0495616_0000386 | 3300046513 | Bacteria | 34362 |
| 536 | Ga0495616_0000421 | 3300046513 | Bacteria | 32621 |
| 537 | Ga0495616_0000569 | 3300046513 | Bacteria | 27955 |
| 538 | Ga0495616_0001705 | 3300046513 | Bacteria | 15001 |
| 539 | Ga0495616_0006331 | 3300046513 | Bacteria | 7178 |
| 540 | Ga0495616_0007822 | 3300046513 | Bacteria | 6378 |
| 541 | Ga0495616_0017332 | 3300046513 | Bacteria | 3974 |
| 542 | Ga0495616_0020860 | 3300046513 | Bacteria | 3558 |
| 543 | Ga0495616_0024422 | 3300046513 | Bacteria | 3242 |
| 544 | Ga0495616_0047864 | 3300046513 | Bacteria | 2151 |
| 545 | Ga0495616_0066286 | 3300046513 | Bacteria | 1756 |
| 546 | Ga0495616_0077701 | 3300046513 | Bacteria | 1593 |
| 547 | Ga0495618_0064344 | 3300046514 | Bacteria | 2330 |
| 548 | Ga0495628_0008247 | 3300046516 | Bacteria | 8954 |
| 549 | Ga0495628_0046689 | 3300046516 | Bacteria | 3439 |
| 550 | Ga0495631_0000366 | 3300046518 | Bacteria | 31016 |
| 551 | Ga0495631_0001198 | 3300046518 | Bacteria | 16006 |
| 552 | Ga0495631_0010027 | 3300046518 | Bacteria | 4706 |
| 553 | Ga0495631_0013684 | 3300046518 | Bacteria | 3931 |
| 554 | Ga0495631_0017687 | 3300046518 | Bacteria | 3366 |
| 555 | Ga0495631_0026306 | 3300046518 | Bacteria | 2673 |
| 556 | Ga0495631_0042817 | 3300046518 | Bacteria | 1999 |
| 557 | Ga0495631_0049642 | 3300046518 | Bacteria | 1836 |
| 558 | Ga0495632_0000018 | 3300046519 | Bacteria | 228282 |
| 559 | Ga0495632_0000156 | 3300046519 | Bacteria | 70702 |
| 560 | Ga0495632_0000537 | 3300046519 | Bacteria | 35765 |
| 561 | Ga0495632_0005150 | 3300046519 | Bacteria | 8724 |
| 562 | Ga0495632_0031022 | 3300046519 | Bacteria | 2768 |
| 563 | Ga0495632_0135660 | 3300046519 | Bacteria | 1144 |
| 564 | Ga0495637_0000458 | 3300046520 | Bacteria | 29716 |
| 565 | Ga0495637_0014342 | 3300046520 | Bacteria | 3738 |
| 566 | Ga0495637_0025328 | 3300046520 | Bacteria | 2674 |
| 567 | Ga0495643_0000605 | 3300046522 | Bacteria | 43303 |
| 568 | Ga0495643_0000709 | 3300046522 | Bacteria | 38269 |
| 569 | Ga0495643_0000898 | 3300046522 | Bacteria | 31694 |
| 570 | Ga0495643_0003553 | 3300046522 | Bacteria | 11337 |
| 571 | Ga0495643_0024064 | 3300046522 | Bacteria | 3457 |
| 572 | Ga0495643_0068373 | 3300046522 | Bacteria | 1869 |
| 573 | Ga0495643_0081507 | 3300046522 | Bacteria | 1682 |
| 574 | Ga0495643_0128778 | 3300046522 | Bacteria | 1272 |
| 575 | Ga0495644_0000268 | 3300046523 | Bacteria | 23891 |
| 576 | Ga0495644_0001551 | 3300046523 | Bacteria | 9372 |
| 577 | Ga0495644_0002717 | 3300046523 | Bacteria | 7018 |
| 578 | Ga0495644_0003445 | 3300046523 | Bacteria | 6259 |
| 579 | Ga0495644_0018746 | 3300046523 | Bacteria | 2641 |
| 580 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 581 | Ga0495648_0000866 | 3300046524 | Bacteria | 31938 |
| 582 | Ga0495648_0001243 | 3300046524 | Bacteria | 25500 |
| 583 | Ga0495648_0001470 | 3300046524 | Bacteria | 23040 |
| 584 | Ga0495648_0020742 | 3300046524 | Bacteria | 4573 |
| 585 | Ga0495648_0024701 | 3300046524 | Bacteria | 4084 |
| 586 | Ga0495648_0047867 | 3300046524 | Bacteria | 2638 |
| 587 | Ga0495648_0048170 | 3300046524 | Bacteria | 2626 |
| 588 | Ga0495648_0061250 | 3300046524 | Bacteria | 2236 |
| 589 | Ga0495648_0080812 | 3300046524 | Bacteria | 1851 |
| 590 | Ga0495648_0092936 | 3300046524 | Bacteria | 1683 |
| 591 | Ga0495648_0199666 | 3300046524 | Bacteria | 1002 |
| 592 | Ga0495666_0000138 | 3300046526 | Bacteria | 30215 |
| 593 | Ga0495666_0002401 | 3300046526 | Bacteria | 9326 |
| 594 | Ga0495666_0003366 | 3300046526 | Bacteria | 8067 |
| 595 | Ga0495666_0012868 | 3300046526 | Bacteria | 4170 |
| 596 | Ga0495642_0000387 | 3300046528 | Bacteria | 23805 |
| 597 | Ga0495642_0002203 | 3300046528 | Bacteria | 7987 |
| 598 | Ga0495642_0003215 | 3300046528 | Bacteria | 6478 |
| 599 | Ga0495642_0005090 | 3300046528 | Bacteria | 5063 |
| 600 | Ga0495642_0007542 | 3300046528 | Bacteria | 4168 |
| 601 | Ga0495642_0019074 | 3300046528 | Bacteria | 2686 |
| 602 | Ga0495642_0027782 | 3300046528 | Bacteria | 2252 |
| 603 | Ga0495642_0043022 | 3300046528 | Bacteria | 1842 |
| 604 | Ga0495642_0069342 | 3300046528 | Bacteria | 1472 |
| 605 | Ga0495642_0126535 | 3300046528 | Bacteria | 1098 |
| 606 | Ga0495652_0032836 | 3300046529 | Bacteria | 4536 |
| 607 | Ga0495652_0105629 | 3300046529 | Bacteria | 2275 |
| 608 | Ga0495652_0128834 | 3300046529 | Bacteria | 2006 |
| 609 | Ga0495654_0007423 | 3300046530 | Bacteria | 6125 |
| 610 | Ga0495654_0014157 | 3300046530 | Bacteria | 4251 |
| 611 | Ga0495654_0068114 | 3300046530 | Bacteria | 1692 |
| 612 | Ga0495665_0001262 | 3300046531 | Bacteria | 13477 |
| 613 | Ga0495665_0011493 | 3300046531 | Bacteria | 4793 |
| 614 | Ga0495665_0050029 | 3300046531 | Bacteria | 2215 |
| 615 | Ga0495586_0009312 | 3300046535 | Bacteria | 5224 |
| 616 | Ga0495586_0046472 | 3300046535 | Bacteria | 2340 |
| 617 | Ga0495586_0116288 | 3300046535 | Bacteria | 1491 |
| 618 | Ga0495586_0245298 | 3300046535 | Bacteria | 1021 |
| 619 | Ga0495587_0014893 | 3300046536 | Bacteria | 4865 |
| 620 | Ga0495587_0199652 | 3300046536 | Bacteria | 1131 |
| 621 | Ga0495609_0000615 | 3300046538 | Bacteria | 27708 |
| 622 | Ga0495609_0001333 | 3300046538 | Bacteria | 16772 |
| 623 | Ga0495609_0001528 | 3300046538 | Bacteria | 15219 |
| 624 | Ga0495609_0002184 | 3300046538 | Bacteria | 12299 |
| 625 | Ga0495609_0003541 | 3300046538 | Bacteria | 8901 |
| 626 | Ga0495609_0012993 | 3300046538 | Bacteria | 3939 |
| 627 | Ga0495609_0017690 | 3300046538 | Bacteria | 3308 |
| 628 | Ga0495609_0021139 | 3300046538 | Bacteria | 3002 |
| 629 | Ga0495609_0022115 | 3300046538 | Bacteria | 2931 |
| 630 | Ga0495609_0023269 | 3300046538 | Bacteria | 2848 |
| 631 | Ga0495609_0045781 | 3300046538 | Bacteria | 1960 |
| 632 | Ga0495609_0102061 | 3300046538 | Bacteria | 1242 |
| 633 | Ga0495597_0000025 | 3300046542 | Bacteria | 142649 |
| 634 | Ga0495597_0000304 | 3300046542 | Bacteria | 44096 |
| 635 | Ga0495597_0000488 | 3300046542 | Bacteria | 33250 |
| 636 | Ga0495597_0000740 | 3300046542 | Bacteria | 26020 |
| 637 | Ga0495597_0000859 | 3300046542 | Bacteria | 23781 |
| 638 | Ga0495597_0001242 | 3300046542 | Bacteria | 18906 |
| 639 | Ga0495597_0001429 | 3300046542 | Bacteria | 17172 |
| 640 | Ga0495597_0008775 | 3300046542 | Bacteria | 5049 |
| 641 | Ga0495597_0017983 | 3300046542 | Bacteria | 3321 |
| 642 | Ga0495597_0071561 | 3300046542 | Bacteria | 1493 |
| 643 | Ga0495597_0091125 | 3300046542 | Bacteria | 1294 |
| 644 | Ga0495645_0012498 | 3300046543 | Bacteria | 5983 |
| 645 | Ga0495645_0027716 | 3300046543 | Bacteria | 4115 |
| 646 | Ga0495622_0000251 | 3300046557 | Bacteria | 41754 |
| 647 | Ga0495622_0000257 | 3300046557 | Bacteria | 40639 |
| 648 | Ga0495622_0000983 | 3300046557 | Bacteria | 15286 |
| 649 | Ga0495622_0023723 | 3300046557 | Bacteria | 2861 |
| 650 | Ga0495622_0043804 | 3300046557 | Bacteria | 2080 |
| 651 | Ga0495622_0052529 | 3300046557 | Bacteria | 1891 |
| 652 | Ga0495633_0000451 | 3300046558 | Bacteria | 42167 |
| 653 | Ga0495633_0000501 | 3300046558 | Bacteria | 39408 |
| 654 | Ga0495633_0000901 | 3300046558 | Bacteria | 25363 |
| 655 | Ga0495633_0001151 | 3300046558 | Bacteria | 21225 |
| 656 | Ga0495633_0001968 | 3300046558 | Bacteria | 14886 |
| 657 | Ga0495633_0005258 | 3300046558 | Bacteria | 7974 |
| 658 | Ga0495633_0005473 | 3300046558 | Bacteria | 7741 |
| 659 | Ga0495633_0013244 | 3300046558 | Bacteria | 4353 |
| 660 | Ga0495633_0021428 | 3300046558 | Bacteria | 3233 |
| 661 | Ga0495633_0050781 | 3300046558 | Bacteria | 1954 |
| 662 | Ga0495633_0063775 | 3300046558 | Bacteria | 1723 |
| 663 | Ga0495633_0072436 | 3300046558 | Bacteria | 1606 |
| 664 | Ga0495656_0008155 | 3300046615 | Bacteria | 3728 |
| 665 | Ga0495656_0033997 | 3300046615 | Bacteria | 2084 |
| 666 | Ga0495656_0037462 | 3300046615 | Bacteria | 2003 |
| 667 | Ga0495656_0039406 | 3300046615 | Bacteria | 1962 |
| 668 | Ga0495656_0061812 | 3300046615 | Bacteria | 1637 |
| 669 | Ga0495656_0075225 | 3300046615 | Bacteria | 1510 |
| 670 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 671 | Ga0495668_0001034 | 3300046616 | Bacteria | 29500 |
| 672 | Ga0495668_0003188 | 3300046616 | Bacteria | 12562 |
| 673 | Ga0495668_0005866 | 3300046616 | Bacteria | 8187 |
| 674 | Ga0495668_0006443 | 3300046616 | Bacteria | 7683 |
| 675 | Ga0495668_0013157 | 3300046616 | Bacteria | 4893 |
| 676 | Ga0495668_0024688 | 3300046616 | Bacteria | 3418 |
| 677 | Ga0495668_0035387 | 3300046616 | Bacteria | 2800 |
| 678 | Ga0495668_0045801 | 3300046616 | Bacteria | 2431 |
| 679 | Ga0495668_0077884 | 3300046616 | Bacteria | 1820 |
| 680 | Ga0495668_0123519 | 3300046616 | Bacteria | 1416 |
| 681 | Ga0495634_0181446 | 3300046642 | Bacteria | 1317 |
| 682 | Ga0495611_0000537 | 3300046648 | Bacteria | 22226 |
| 683 | Ga0495611_0004037 | 3300046648 | Bacteria | 6388 |
| 684 | Ga0495611_0006608 | 3300046648 | Bacteria | 4940 |
| 685 | Ga0495611_0024846 | 3300046648 | Bacteria | 2607 |
| 686 | Ga0495611_0041779 | 3300046648 | Bacteria | 2045 |
| 687 | Ga0495611_0159525 | 3300046648 | Bacteria | 1053 |
| 688 | Ga0495611_0180205 | 3300046648 | Bacteria | 987 |
| 689 | Ga0495625_0000835 | 3300046660 | Bacteria | 42300 |
| 690 | Ga0495625_0011466 | 3300046660 | Bacteria | 7227 |
| 691 | Ga0495625_0021395 | 3300046660 | Bacteria | 4982 |
| 692 | Ga0495625_0039434 | 3300046660 | Bacteria | 3449 |
| 693 | Ga0495625_0039765 | 3300046660 | Bacteria | 3432 |
| 694 | Ga0495625_0045467 | 3300046660 | Bacteria | 3173 |
| 695 | Ga0495625_0070045 | 3300046660 | Bacteria | 2463 |
| 696 | Ga0495625_0167113 | 3300046660 | Bacteria | 1470 |
| 697 | Ga0495625_0186903 | 3300046660 | Bacteria | 1374 |
| 698 | Ga0495625_0227247 | 3300046660 | Bacteria | 1220 |
| 699 | Ga0495635_0001439 | 3300046663 | Bacteria | 15903 |
| 700 | Ga0495659_0000370 | 3300046664 | Bacteria | 17443 |
| 701 | Ga0495659_0001025 | 3300046664 | Bacteria | 9773 |
| 702 | Ga0495659_0128088 | 3300046664 | Bacteria | 1005 |
| 703 | Ga0495661_0000082 | 3300046665 | Bacteria | 116600 |
| 704 | Ga0495661_0003296 | 3300046665 | Bacteria | 11978 |
| 705 | Ga0495661_0012047 | 3300046665 | Bacteria | 5851 |
| 706 | Ga0495661_0021899 | 3300046665 | Bacteria | 4160 |
| 707 | Ga0495661_0026716 | 3300046665 | Bacteria | 3715 |
| 708 | Ga0495661_0035259 | 3300046665 | Bacteria | 3140 |
| 709 | Ga0495661_0040723 | 3300046665 | Bacteria | 2879 |
| 710 | Ga0495661_0047394 | 3300046665 | Bacteria | 2617 |
| 711 | Ga0495661_0059533 | 3300046665 | Bacteria | 2273 |
| 712 | Ga0495588_0011746 | 3300046674 | Bacteria | 4118 |
| 713 | Ga0495588_0093542 | 3300046674 | Bacteria | 1575 |
| 714 | Ga0495588_0098452 | 3300046674 | Bacteria | 1535 |
| 715 | Ga0495588_0128498 | 3300046674 | Bacteria | 1336 |
| 716 | Ga0495588_0135751 | 3300046674 | Bacteria | 1298 |
| 717 | Ga0495588_0140780 | 3300046674 | Bacteria | 1274 |
| 718 | Ga0495657_0086070 | 3300046675 | Bacteria | 2025 |
| 719 | Ga0495599_0001621 | 3300046678 | Bacteria | 12971 |
| 720 | Ga0495623_0002537 | 3300046679 | Bacteria | 12074 |
| 721 | Ga0495623_0027554 | 3300046679 | Bacteria | 3656 |
| 722 | Ga0495623_0124627 | 3300046679 | Bacteria | 1547 |
| 723 | Ga0495646_0004694 | 3300046680 | Bacteria | 8610 |
| 724 | Ga0495658_0233159 | 3300046683 | Bacteria | 1155 |
| 725 | Ga0495669_0000292 | 3300046684 | Bacteria | 28348 |
| 726 | Ga0495669_0001593 | 3300046684 | Bacteria | 9322 |
| 727 | Ga0495669_0003904 | 3300046684 | Bacteria | 6134 |
| 728 | Ga0495669_0014711 | 3300046684 | Bacteria | 3346 |
| 729 | Ga0495669_0016478 | 3300046684 | Bacteria | 3165 |
| 730 | Ga0495669_0018506 | 3300046684 | Bacteria | 2995 |
| 731 | Ga0495669_0100715 | 3300046684 | Bacteria | 1342 |
| 732 | Ga0495624_0002448 | 3300046690 | Bacteria | 14084 |
| 733 | Ga0495624_0033456 | 3300046690 | Bacteria | 3329 |
| 734 | Ga0495670_0004090 | 3300046691 | Bacteria | 7157 |
| 735 | Ga0495670_0005302 | 3300046691 | Bacteria | 6344 |
| 736 | Ga0495670_0014635 | 3300046691 | Bacteria | 3858 |
| 737 | Ga0495670_0015846 | 3300046691 | Bacteria | 3703 |
| 738 | Ga0495670_0035845 | 3300046691 | Bacteria | 2471 |
| 739 | Ga0495670_0043169 | 3300046691 | Bacteria | 2250 |
| 740 | Ga0495670_0052236 | 3300046691 | Bacteria | 2046 |
| 741 | Ga0495670_0058622 | 3300046691 | Bacteria | 1932 |
| 742 | Ga0495670_0063790 | 3300046691 | Bacteria | 1855 |
| 743 | Ga0495670_0085088 | 3300046691 | Bacteria | 1614 |
| 744 | Ga0495670_0094170 | 3300046691 | Bacteria | 1535 |
| 745 | Ga0495671_0000354 | 3300046692 | Bacteria | 38143 |
| 746 | Ga0495671_0002915 | 3300046692 | Bacteria | 10668 |
| 747 | Ga0495671_0035766 | 3300046692 | Bacteria | 2520 |
| 748 | Ga0495671_0042293 | 3300046692 | Bacteria | 2290 |
| 749 | Ga0495671_0063478 | 3300046692 | Bacteria | 1819 |
| 750 | Ga0495671_0074545 | 3300046692 | Bacteria | 1665 |
| 751 | Ga0495671_0102904 | 3300046692 | Bacteria | 1395 |
| 752 | Ga0495671_0157447 | 3300046692 | Bacteria | 1105 |
| 753 | Ga0495649_0000537 | 3300046694 | Bacteria | 32173 |
| 754 | Ga0495649_0013148 | 3300046694 | Bacteria | 4783 |
| 755 | Ga0495649_0024047 | 3300046694 | Bacteria | 3400 |
| 756 | Ga0495649_0062159 | 3300046694 | Bacteria | 2008 |
| 757 | Ga0495649_0125994 | 3300046694 | Bacteria | 1353 |
| 758 | Ga0495589_0000354 | 3300046794 | Bacteria | 35716 |
| 759 | Ga0495589_0003737 | 3300046794 | Bacteria | 8198 |
| 760 | Ga0495589_0017349 | 3300046794 | Bacteria | 3696 |
| 761 | Ga0495589_0024045 | 3300046794 | Bacteria | 3098 |
| 762 | Ga0495589_0026949 | 3300046794 | Bacteria | 2909 |
| 763 | Ga0495589_0041290 | 3300046794 | Bacteria | 2302 |
| 764 | Ga0495589_0047456 | 3300046794 | Bacteria | 2128 |
| 765 | Ga0495589_0109395 | 3300046794 | Bacteria | 1334 |
| 766 | Ga0495600_0002072 | 3300046809 | Bacteria | 11317 |
| 767 | Ga0495600_0011378 | 3300046809 | Bacteria | 5544 |
| 768 | Ga0495660_0012257 | 3300046810 | Bacteria | 4974 |
| 769 | Ga0495660_0023206 | 3300046810 | Bacteria | 3540 |
| 770 | Ga0495660_0030924 | 3300046810 | Bacteria | 3013 |
| 771 | Ga0495660_0052088 | 3300046810 | Bacteria | 2225 |
| 772 | Ga0495660_0059775 | 3300046810 | Bacteria | 2049 |
| 773 | Ga0495581_0000444 | 3300047315 | Bacteria | 21134 |
| 774 | Ga0495581_0005600 | 3300047315 | Bacteria | 7280 |
| 775 | Ga0495581_0036587 | 3300047315 | Bacteria | 2840 |
| 776 | Ga0495604_0071327 | 3300047317 | Bacteria | 2627 |
| 777 | Ga0495604_0183218 | 3300047317 | Bacteria | 1463 |
| 778 | Ga0495636_0000418 | 3300047318 | Bacteria | 15797 |
| 779 | Ga0495636_0001813 | 3300047318 | Bacteria | 8168 |
| 780 | Ga0495636_0004439 | 3300047318 | Bacteria | 5489 |
| 781 | Ga0495636_0086044 | 3300047318 | Bacteria | 1359 |
| 782 | Ga0495672_0000219 | 3300047320 | Bacteria | 81635 |
| 783 | Ga0495672_0000258 | 3300047320 | Bacteria | 73971 |
| 784 | Ga0495672_0000493 | 3300047320 | Bacteria | 45721 |
| 785 | Ga0495672_0006283 | 3300047320 | Bacteria | 9250 |
| 786 | Ga0495672_0013765 | 3300047320 | Bacteria | 5566 |
| 787 | Ga0495676_0000352 | 3300047321 | Bacteria | 37571 |
| 788 | Ga0495676_0044244 | 3300047321 | Bacteria | 3636 |
| 789 | Ga0495676_0113162 | 3300047321 | Bacteria | 1987 |
| 790 | Ga0495683_0000446 | 3300047323 | Bacteria | 32629 |
| 791 | Ga0495683_0005804 | 3300047323 | Bacteria | 6794 |
| 792 | Ga0495683_0010304 | 3300047323 | Bacteria | 4946 |
| 793 | Ga0495683_0010366 | 3300047323 | Bacteria | 4927 |
| 794 | Ga0495683_0029179 | 3300047323 | Bacteria | 2819 |
| 795 | Ga0495683_0030327 | 3300047323 | Bacteria | 2759 |
| 796 | Ga0495683_0044951 | 3300047323 | Bacteria | 2220 |
| 797 | Ga0495683_0049201 | 3300047323 | Bacteria | 2112 |
| 798 | Ga0495687_000015 | 3300047443 | Bacteria | 365627 |
| 799 | Ga0495687_000034 | 3300047443 | Bacteria | 257321 |
| 800 | Ga0495687_000081 | 3300047443 | Bacteria | 147362 |
| 801 | Ga0495687_000587 | 3300047443 | Bacteria | 42438 |
| 802 | Ga0495687_001660 | 3300047443 | Bacteria | 19980 |
| 803 | Ga0495687_006472 | 3300047443 | Bacteria | 7172 |
| 804 | Ga0495687_020170 | 3300047443 | Bacteria | 3254 |
| 805 | Ga0495687_020171 | 3300047443 | Bacteria | 3254 |
| 806 | Ga0495687_029212 | 3300047443 | Bacteria | 2555 |
| 807 | Ga0495687_081385 | 3300047443 | Bacteria | 1267 |
| 808 | Ga0495675_0002959 | 3300047444 | Bacteria | 10199 |
| 809 | Ga0495675_0104620 | 3300047444 | Bacteria | 1769 |
| 810 | Ga0495675_0200296 | 3300047444 | Bacteria | 1215 |
| 811 | Ga0495677_0000195 | 3300047445 | Bacteria | 27965 |
| 812 | Ga0495677_0008402 | 3300047445 | Bacteria | 3834 |
| 813 | Ga0495677_0011858 | 3300047445 | Bacteria | 3183 |
| 814 | Ga0495677_0014308 | 3300047445 | Bacteria | 2889 |
| 815 | Ga0495677_0039576 | 3300047445 | Bacteria | 1723 |
| 816 | Ga0495677_0098869 | 3300047445 | Bacteria | 1103 |
| 817 | Ga0495679_003649 | 3300047446 | Bacteria | 7358 |
| 818 | Ga0495679_052739 | 3300047446 | Bacteria | 1216 |
| 819 | Ga0495685_000078 | 3300047447 | Bacteria | 37109 |
| 820 | Ga0495685_003560 | 3300047447 | Bacteria | 4981 |
| 821 | Ga0495685_010214 | 3300047447 | Bacteria | 3146 |
| 822 | Ga0495673_0000015 | 3300047469 | Bacteria | 598766 |
| 823 | Ga0495673_0005789 | 3300047469 | Bacteria | 7401 |
| 824 | Ga0495681_0000144 | 3300047470 | Bacteria | 60089 |
| 825 | Ga0495681_0000428 | 3300047470 | Bacteria | 32244 |
| 826 | Ga0495681_0001162 | 3300047470 | Bacteria | 19960 |
| 827 | Ga0495681_0003308 | 3300047470 | Bacteria | 11230 |
| 828 | Ga0495681_0035635 | 3300047470 | Bacteria | 2469 |
| 829 | Ga0495681_0090019 | 3300047470 | Bacteria | 1356 |
| 830 | Ga0495681_0135789 | 3300047470 | Bacteria | 1043 |
| 831 | Ga0495686_0001101 | 3300047472 | Bacteria | 32108 |
| 832 | Ga0495686_0057064 | 3300047472 | Bacteria | 2438 |
| 833 | Ga0495686_0061421 | 3300047472 | Bacteria | 2333 |
| 834 | Ga0495593_0002509 | 3300047673 | Bacteria | 11031 |
| 835 | Ga0495593_0003002 | 3300047673 | Bacteria | 10167 |
| 836 | Ga0495593_0034958 | 3300047673 | Bacteria | 2731 |
| 837 | Ga0495602_0068835 | 3300048088 | Bacteria | 3038 |
| 838 | Ga0495615_0002932 | 3300048090 | Bacteria | 2803 |
| 839 | Ga0495626_0010300 | 3300048091 | Bacteria | 5000 |
| 840 | Ga0495626_0012239 | 3300048091 | Bacteria | 4504 |
| 841 | Ga0495626_0012998 | 3300048091 | Bacteria | 4341 |
| 842 | Ga0495626_0041423 | 3300048091 | Bacteria | 2169 |
| 843 | Ga0495626_0047939 | 3300048091 | Bacteria | 1984 |
| 844 | Ga0495626_0102903 | 3300048091 | Bacteria | 1243 |
| 845 | Ga0496101_0049161 | 3300048904 | Bacteria | 3032 |
| 846 | Ga0496102_0000058 | 3300048905 | Bacteria | 168714 |
| 847 | Ga0496102_0001515 | 3300048905 | Bacteria | 20505 |
| 848 | Ga0496102_0032694 | 3300048905 | Bacteria | 4674 |
| 849 | Ga0496102_0077459 | 3300048905 | Bacteria | 3060 |
| 850 | Ga0496102_0282711 | 3300048905 | Bacteria | 1564 |
| 851 | Ga0496102_0288233 | 3300048905 | Bacteria | 1547 |
| 852 | Ga0496103_0004164 | 3300048906 | Bacteria | 8779 |
| 853 | Ga0496103_0403395 | 3300048906 | Bacteria | 878 |
| 854 | Ga0496105_0201613 | 3300048908 | Bacteria | 1624 |
| 855 | Ga0496107_0061012 | 3300048910 | Bacteria | 2730 |
| 856 | Ga0496108_0199567 | 3300048911 | Bacteria | 1736 |
| 857 | Ga0496108_0450286 | 3300048911 | Bacteria | 1125 |
| 858 | Ga0496109_0084931 | 3300048912 | Bacteria | 2921 |
| 859 | Ga0496109_0349137 | 3300048912 | Bacteria | 1398 |
| 860 | Ga0496110_0000251 | 3300048913 | Bacteria | 34859 |
| 861 | Ga0496110_0630604 | 3300048913 | Unclassified | 971 |
| 862 | Ga0496111_0027090 | 3300048914 | Bacteria | 4052 |
| 863 | Ga0496111_0427248 | 3300048914 | Bacteria | 978 |
| 864 | Ga0496112_0396415 | 3300048915 | Bacteria | 1320 |
| 865 | Ga0496113_0008918 | 3300048916 | Bacteria | 6563 |
| 866 | Ga0496114_0253977 | 3300048917 | Bacteria | 1547 |
| 867 | Ga0496115_0009163 | 3300048918 | Bacteria | 7347 |
| 868 | Ga0496115_0086929 | 3300048918 | Bacteria | 2551 |
| 869 | Ga0496115_0180676 | 3300048918 | Bacteria | 1744 |
| 870 | Ga0496116_0029391 | 3300048919 | Bacteria | 3963 |
| 871 | Ga0496116_0089629 | 3300048919 | Bacteria | 1875 |
| 872 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 873 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 874 | Ga0496121_0005466 | 3300048924 | Bacteria | 16278 |
| 875 | Ga0496121_0020195 | 3300048924 | Bacteria | 6609 |
| 876 | Ga0496122_0000255 | 3300048925 | Bacteria | 120384 |
| 877 | Ga0496122_0001676 | 3300048925 | Bacteria | 34352 |
| 878 | Ga0496123_0000138 | 3300048926 | Bacteria | 151844 |
| 879 | Ga0496123_0004104 | 3300048926 | Bacteria | 15621 |
| 880 | Ga0496124_0009103 | 3300048927 | Bacteria | 10266 |
| 881 | Ga0496124_0032737 | 3300048927 | Bacteria | 4585 |
| 882 | Ga0496125_0002620 | 3300048928 | Bacteria | 23073 |
| 883 | Ga0496125_0086612 | 3300048928 | Bacteria | 2368 |
| 884 | Ga0495678_000069 | 3300049459 | Bacteria | 131739 |
| 885 | Ga0495678_000094 | 3300049459 | Bacteria | 111548 |
| 886 | Ga0495678_000110 | 3300049459 | Bacteria | 97228 |
| 887 | Ga0495678_000294 | 3300049459 | Bacteria | 54947 |
| 888 | Ga0495678_000962 | 3300049459 | Bacteria | 24920 |
| 889 | Ga0495678_001220 | 3300049459 | Bacteria | 21076 |
| 890 | Ga0495678_013301 | 3300049459 | Bacteria | 3869 |
| 891 | Ga0495678_041165 | 3300049459 | Bacteria | 1851 |
| 892 | Ga0495682_0000295 | 3300049460 | Bacteria | 38015 |
| 893 | Ga0495682_0000618 | 3300049460 | Bacteria | 23926 |
| 894 | Ga0495682_0000781 | 3300049460 | Bacteria | 20182 |
| 895 | Ga0495682_0010195 | 3300049460 | Bacteria | 3650 |
| 896 | Ga0495682_0016043 | 3300049460 | Bacteria | 2834 |
| 897 | Ga0495682_0030475 | 3300049460 | Bacteria | 1995 |
| 898 | Ga0501034_0038883 | 3300049571 | Bacteria | 4819 |
| 899 | Ga0501067_0024395 | 3300049583 | Bacteria | 3354 |
| 900 | Ga0501070_0015021 | 3300049586 | Bacteria | 6515 |
| 901 | Ga0501074_0110257 | 3300049590 | Bacteria | 1969 |
| 902 | Ga0501227_019315 | 3300049665 | Bacteria | 1553 |
| 903 | Ga0501079_0156266 | 3300049741 | Bacteria | 1778 |
| 904 | Ga0501080_0028810 | 3300049742 | Bacteria | 5169 |
| 905 | Ga0501080_0112570 | 3300049742 | Bacteria | 2523 |
| 906 | nmdc:mga05p37_79194_c1 | 3300050507 | Bacteria | 4046 |
| 907 | nmdc:mga0n895_137164_c1 | 3300050512 | Bacteria | 2473 |
| 908 | nmdc:mga0n895_196779_c1 | 3300050512 | Bacteria | 2047 |
| 909 | nmdc:mga0n895_205471_c1 | 3300050512 | Bacteria | 2000 |
| 910 | nmdc:mga0rr50_407439_c1 | 3300050513 | Bacteria | 1149 |
| 911 | nmdc:mga08x19_112143_c1 | 3300050514 | Bacteria | 1820 |
| 912 | Ga0495601_0006267 | 3300053077 | Bacteria | 6947 |
| 913 | Ga0500583_0026491 | 3300053092 | Bacteria | 2491 |
| 914 | Ga0500595_005111 | 3300053119 | Bacteria | 5759 |
| 915 | Ga0500574_000096 | 3300053141 | Bacteria | 9825 |
| 916 | Ga0500586_000061 | 3300053145 | Bacteria | 19380 |
| 917 | Ga0500619_015034 | 3300053154 | Bacteria | 2095 |
| 918 | Ga0466962_0015210 | 3300061719 | Bacteria | 3710 |
| 919 | 2601668157 | 2600255292 | Bacteria | 6300551 |
| 920 | 2643792349 | 2643221554 | Bacteria | 6603920 |
| 921 | 2644029046 | 2643221603 | Bacteria | 6147767 |
| 922 | 2644212158 | 2643221638 | Bacteria | 6579467 |
| 923 | 2644251019 | 2643221645 | Bacteria | 7207331 |
| 924 | 2644354800 | 2643221664 | Bacteria | 7272945 |
| 925 | 2738739768 | 2738541280 | Bacteria | 6630198 |
| 926 | 2738842259 | 2738541300 | Bacteria | 6675882 |
| 927 | 2739273960 | 2738543018 | Bacteria | 6718814 |
| 928 | 2739343004 | 2738543030 | Bacteria | 6719714 |
| 929 | 2819542577 | 2818991436 | Bacteria | 5376622 |
| 930 | 2842716540 | 2842711865 | Bacteria | 7155354 |
| 931 | 2857550391 | 2857547612 | Bacteria | 6179999 |
| 932 | 2857560138 | 2857558681 | Bacteria | 6617694 |
| 933 | 2885083215 | 2885080285 | Bacteria | 6355622 |
| 934 | 2932411865 | 2932410948 | Bacteria | 6312192 |
| 935 | 2932418568 | 2932416698 | Bacteria | 6315112 |
| 936 | Ga0182007_10006019 | |||
| 937 | JGI25162J39368_1000036 | |||
| 938 | JGI25154J39366_1001019 | |||
| 939 | JGI25163J39215_1003650 | |||
| 940 | JGI25152J39213_1000065 | |||
| 941 | JGI25152J39213_1015922 | |||
| 942 | JGI25150J39212_1000346 | |||
| 943 | JGI25159J45721_1001368 | |||
| 944 | JGI25165J46597_1000022 | |||
| 945 | JGI25153J46596_10007935 | |||
| 946 | rootH1_10102612 | |||
| 947 | rootL2_10211091 | |||
| 948 | JGI25160J50197_1004125 | |||
| 949 | JGI25161J50226_1002833 | |||
| 950 | Ga0055538_1000011 | |||
| 951 | Ga0055539_1000016 | |||
| 952 | Ga0055533_1000019 | |||
| 953 | Ga0055525_1000042 | |||
| 954 | Ga0055526_1000023 | |||
| 955 | Ga0055526_1001736 | |||
| 956 | Ga0055537_1000063 | |||
| 957 | Ga0055537_1002797 | |||
| 958 | Ga0055524_1001987 | |||
| 959 | Ga0055524_1008914 | |||
| 960 | Ga0055534_1000208 | |||
| 961 | Ga0055528_1000013 | |||
| 962 | Ga0055530_10000461 | |||
| 963 | Ga0055530_10003093 | |||
| 964 | Ga0055530_10006707 | |||
| 965 | Ga0055531_10013515 | |||
| 966 | Ga0055541_1000017 | |||
| 967 | Ga0055543_1000422 | |||
| 968 | Ga0065165_1001381 | |||
| 969 | Ga0065165_1006361 | |||
| 970 | Ga0065714_10170089 | |||
| 971 | Ga0065715_10003962 | |||
| 972 | Ga0065715_10230288 | |||
| 973 | Ga0070676_10005143 | |||
| 974 | Ga0070676_10012878 | |||
| 975 | Ga0070676_10318258 | |||
| 976 | Ga0070690_100047413 | |||
| 977 | Ga0070690_100053410 | |||
| 978 | Ga0070670_100001112 | |||
| 979 | Ga0070670_100049502 | |||
| 980 | Ga0070670_100116793 | |||
| 981 | Ga0070670_100286196 | |||
| 982 | Ga0070670_100392460 | |||
| 983 | Ga0068869_100000291 | |||
| 984 | Ga0068869_100002348 | |||
| 985 | Ga0068869_100005568 | |||
| 986 | Ga0068869_100022000 | |||
| 987 | Ga0068869_100496261 | |||
| 988 | Ga0070666_10003040 | |||
| 989 | Ga0070666_10013730 | |||
| 990 | Ga0070666_10071851 | |||
| 991 | Ga0070682_100002234 | |||
| 992 | Ga0070660_100192344 | |||
| 993 | Ga0070689_100001992 | |||
| 994 | Ga0070691_10041187 | |||
| 995 | Ga0070687_100008539 | |||
| 996 | Ga0070661_100052320 | |||
| 997 | Ga0070692_10002809 | |||
| 998 | Ga0070692_10023681 | |||
| 999 | Ga0070668_100000278 | |||
| 1000 | Ga0070668_100009945 | |||
| 1001 | Ga0070668_100014523 | |||
| 1002 | Ga0070668_100349400 | |||
| 1003 | Ga0070669_100003607 | |||
| 1004 | Ga0070669_100003853 | |||
| 1005 | Ga0070669_100039052 | |||
| 1006 | Ga0070669_100099933 | |||
| 1007 | Ga0070675_100000728 | |||
| 1008 | Ga0070675_100095212 | |||
| 1009 | Ga0070675_100255197 | |||
| 1010 | Ga0070675_100542306 | |||
| 1011 | Ga0070671_100020282 | |||
| 1012 | Ga0070674_100006874 | |||
| 1013 | Ga0070673_100000973 | |||
| 1014 | Ga0070673_100016641 | |||
| 1015 | Ga0070688_100028467 | |||
| 1016 | Ga0070667_100014030 | |||
| 1017 | Ga0070667_100130097 | |||
| 1018 | Ga0070701_10014527 | |||
| 1019 | Ga0070705_100076881 | |||
| 1020 | Ga0070700_100011183 | |||
| 1021 | Ga0070663_100050102 | |||
| 1022 | Ga0070663_100204787 | |||
| 1023 | Ga0070678_100003218 | |||
| 1024 | Ga0070678_100015793 | |||
| 1025 | Ga0070678_100576932 | |||
| 1026 | Ga0070681_10006107 | |||
| 1027 | Ga0070681_10087514 | |||
| 1028 | Ga0070681_10349502 | |||
| 1029 | Ga0068867_100021693 | |||
| 1030 | Ga0068867_100039158 | |||
| 1031 | Ga0070707_100090234 | |||
| 1032 | Ga0070698_100041150 | |||
| 1033 | Ga0070698_100082890 | |||
| 1034 | Ga0070699_100083368 | |||
| 1035 | Ga0070699_100548129 | |||
| 1036 | Ga0070679_100138478 | |||
| 1037 | Ga0068853_100001406 | |||
| 1038 | Ga0070672_100001592 | |||
| 1039 | Ga0070672_100003716 | |||
| 1040 | Ga0070686_100019140 | |||
| 1041 | Ga0070695_100174311 | |||
| 1042 | Ga0070696_100133093 | |||
| 1043 | Ga0070665_100070093 | |||
| 1044 | Ga0070665_100206326 | |||
| 1045 | Ga0070665_100331401 | |||
| 1046 | Ga0070704_100276094 | |||
| 1047 | Ga0068855_100018998 | |||
| 1048 | Ga0068855_100361479 | |||
| 1049 | Ga0068855_100446376 | |||
| 1050 | Ga0070664_100094498 | |||
| 1051 | Ga0068857_100007996 | |||
| 1052 | Ga0068857_100013001 | |||
| 1053 | Ga0068854_100143918 | |||
| 1054 | Ga0068856_100826701 | |||
| 1055 | Ga0070702_100001644 | |||
| 1056 | Ga0070702_100047302 | |||
| 1057 | Ga0068859_100010193 | |||
| 1058 | Ga0068859_100088188 | |||
| 1059 | Ga0068859_100096071 | |||
| 1060 | Ga0068859_100164744 | |||
| 1061 | Ga0068859_100219727 | |||
| 1062 | Ga0068859_100540275 | |||
| 1063 | Ga0068864_100022171 | |||
| 1064 | Ga0068866_10001046 | |||
| 1065 | Ga0068861_100010393 | |||
| 1066 | Ga0068861_100512711 | |||
| 1067 | Ga0068870_10117575 | |||
| 1068 | Ga0068863_100000706 | |||
| 1069 | Ga0068863_100092019 | |||
| 1070 | Ga0068858_100028351 | |||
| 1071 | Ga0068858_100174331 | |||
| 1072 | Ga0068860_100001246 | |||
| 1073 | Ga0068860_100012972 | |||
| 1074 | Ga0068860_100033588 | |||
| 1075 | Ga0068860_100074636 | |||
| 1076 | Ga0068860_100109058 | |||
| 1077 | Ga0068862_100005052 | |||
| 1078 | Ga0068862_100104997 | |||
| 1079 | Ga0068862_100197409 | |||
| 1080 | Ga0068862_100318643 | |||
| 1081 | Ga0070716_100118245 | |||
| 1082 | Ga0097621_100003745 | |||
| 1083 | Ga0097621_100003861 | |||
| 1084 | Ga0097621_100081772 | |||
| 1085 | Ga0097621_100778738 | |||
| 1086 | Ga0068871_100001583 | |||
| 1087 | Ga0068871_100008576 | |||
| 1088 | Ga0068871_100036330 | |||
| 1089 | Ga0068871_100395444 | |||
| 1090 | Ga0075433_10017285 | |||
| 1091 | Ga0075434_100002459 | |||
| 1092 | Ga0075434_100208310 | |||
| 1093 | Ga0068865_100001318 | |||
| 1094 | Ga0068865_100008961 | |||
| 1095 | Ga0068865_100086428 | |||
| 1096 | Ga0075436_100028068 | |||
| 1097 | Ga0097620_100010193 | |||
| 1098 | Ga0097620_100088193 | |||
| 1099 | Ga0097620_100096079 | |||
| 1100 | Ga0097620_100164738 | |||
| 1101 | Ga0097620_100219725 | |||
| 1102 | Ga0097620_100540345 | |||
| 1103 | Ga0075435_100383230 | |||
| 1104 | Ga0105245_10001874 | |||
| 1105 | Ga0105245_10068769 | |||
| 1106 | Ga0105247_10023982 | |||
| 1107 | Ga0114129_10720569 | |||
| 1108 | Ga0105243_10015224 | |||
| 1109 | Ga0105243_10375329 | |||
| 1110 | Ga0105241_10011098 | |||
| 1111 | Ga0105242_10028096 | |||
| 1112 | Ga0105242_10061461 | |||
| 1113 | Ga0105248_10017738 | |||
| 1114 | Ga0105248_10032456 | |||
| 1115 | Ga0105248_10039352 | |||
| 1116 | Ga0105248_11109063 | |||
| 1117 | Ga0105237_10679688 | |||
| 1118 | Ga0105249_10024362 | |||
| 1119 | Ga0105249_10071331 | |||
| 1120 | Ga0105249_10180532 | |||
| 1121 | Ga0105239_10005320 | |||
| 1122 | Ga0105239_10206263 | |||
| 1123 | Ga0105239_10221443 | |||
| 1124 | Ga0105239_10233541 | |||
| 1125 | Ga0105246_10247582 | |||
| 1126 | Ga0105246_10249593 | |||
| 1127 | Ga0157374_10001776 | |||
| 1128 | Ga0157378_10035232 | |||
| 1129 | Ga0157378_10062343 | |||
| 1130 | Ga0157378_10187039 | |||
| 1131 | Ga0163162_10019047 | |||
| 1132 | Ga0163162_10055366 | |||
| 1133 | Ga0163162_10503507 | |||
| 1134 | Ga0157375_10066464 | |||
| 1135 | Ga0157375_10068729 | |||
| 1136 | Ga0157375_10082118 | |||
| 1137 | Ga0157375_10337929 | |||
| 1138 | Ga0157375_10437743 | |||
| 1139 | Ga0163163_10000704 | |||
| 1140 | Ga0157380_10018746 | |||
| 1141 | Ga0157380_10448278 | |||
| 1142 | Ga0182008_10000119 | |||
| 1143 | Ga0182008_10067880 | |||
| 1144 | Ga0157379_10000063 | |||
| 1145 | Ga0157379_10005248 | |||
| 1146 | Ga0157379_10078545 | |||
| 1147 | Ga0157379_10916230 | |||
| 1148 | Ga0157376_10007237 | |||
| 1149 | Ga0157376_10015494 | |||
| 1150 | Ga0182006_1000067 | |||
| 1151 | Ga0182006_1006797 | |||
| 1152 | Ga0182007_10000372 | |||
| 1153 | Ga0182007_10012853 | |||
| 1154 | Ga0182005_1000002 | |||
| 1155 | Ga0182005_1012480 | |||
| 1156 | Ga0163161_10005333 | |||
| 1157 | Ga0163161_10034189 | |||
| 1158 | Ga0213872_10000148 | |||
| 1159 | Ga0213872_10008640 | |||
| 1160 | Ga0213872_10026310 | |||
| 1161 | Ga0213872_10034502 | |||
| 1162 | Ga0209436_100212 | |||
| 1163 | Ga0209436_104879 | |||
| 1164 | Ga0209784_100019 | |||
| 1165 | Ga0209566_100017 | |||
| 1166 | Ga0209674_100031 | |||
| 1167 | Ga0209563_100035 | |||
| 1168 | Ga0207427_101091 | |||
| 1169 | Ga0209437_100038 | |||
| 1170 | Ga0207425_1000001 | |||
| 1171 | Ga0207425_1000048 | |||
| 1172 | Ga0207425_1032299 | |||
| 1173 | Ga0209646_1000252 | |||
| 1174 | Ga0209026_1006209 | |||
| 1175 | Ga0209677_100020 | |||
| 1176 | Ga0209129_1000003 | |||
| 1177 | Ga0209129_1001011 | |||
| 1178 | Ga0209233_1000049 | |||
| 1179 | Ga0209565_1000003 | |||
| 1180 | Ga0209565_1000369 | |||
| 1181 | Ga0209565_1000940 | |||
| 1182 | Ga0209565_1006948 | |||
| 1183 | Ga0209565_1017460 | |||
| 1184 | Ga0209673_1000003 | |||
| 1185 | Ga0209130_1000352 | |||
| 1186 | Ga0209130_1016931 | |||
| 1187 | Ga0209675_1000003 | |||
| 1188 | Ga0209675_1002174 | |||
| 1189 | Ga0209675_1002350 | |||
| 1190 | Ga0209675_1002512 | |||
| 1191 | Ga0209564_1000002 | |||
| 1192 | Ga0209564_1000012 | |||
| 1193 | Ga0209564_1000199 | |||
| 1194 | Ga0209564_1006244 | |||
| 1195 | Ga0209564_1010716 | |||
| 1196 | Ga0209758_1000041 | |||
| 1197 | Ga0209050_1000011 | |||
| 1198 | Ga0209050_1000089 | |||
| 1199 | Ga0209050_1002225 | |||
| 1200 | Ga0209256_1000112 | |||
| 1201 | Ga0209256_1000163 | |||
| 1202 | Ga0209256_1000576 | |||
| 1203 | Ga0207426_1007235 | |||
| 1204 | Ga0209257_1000003 | |||
| 1205 | Ga0207697_10007677 | |||
| 1206 | Ga0207656_10153105 | |||
| 1207 | Ga0207642_10007226 | |||
| 1208 | Ga0207642_10101378 | |||
| 1209 | Ga0207680_10056595 | |||
| 1210 | Ga0207680_10065673 | |||
| 1211 | Ga0207645_10000431 | |||
| 1212 | Ga0207645_10007744 | |||
| 1213 | Ga0207705_10175110 | |||
| 1214 | Ga0207707_10170412 | |||
| 1215 | Ga0207660_10109548 | |||
| 1216 | Ga0207657_10183869 | |||
| 1217 | Ga0207681_10005745 | |||
| 1218 | Ga0207681_10060466 | |||
| 1219 | Ga0207681_10142902 | |||
| 1220 | Ga0207650_10006135 | |||
| 1221 | Ga0207650_10011955 | |||
| 1222 | Ga0207650_10012302 | |||
| 1223 | Ga0207650_10013884 | |||
| 1224 | Ga0207659_10026794 | |||
| 1225 | Ga0207659_10520711 | |||
| 1226 | Ga0207687_10044856 | |||
| 1227 | Ga0207687_10063749 | |||
| 1228 | Ga0207687_10232475 | |||
| 1229 | Ga0207706_10189673 | |||
| 1230 | Ga0207686_10009611 | |||
| 1231 | Ga0207686_10037172 | |||
| 1232 | Ga0207686_10118634 | |||
| 1233 | Ga0207709_10126082 | |||
| 1234 | Ga0207670_10015244 | |||
| 1235 | Ga0207670_10274607 | |||
| 1236 | Ga0207669_10004360 | |||
| 1237 | Ga0207669_10300914 | |||
| 1238 | Ga0207704_10009528 | |||
| 1239 | Ga0207704_10049901 | |||
| 1240 | Ga0207704_10104589 | |||
| 1241 | Ga0207665_10154007 | |||
| 1242 | Ga0207691_10000505 | |||
| 1243 | Ga0207691_10047931 | |||
| 1244 | Ga0207711_10019187 | |||
| 1245 | Ga0207689_10000116 | |||
| 1246 | Ga0207689_10000489 | |||
| 1247 | Ga0207689_10002700 | |||
| 1248 | Ga0207689_10016672 | |||
| 1249 | Ga0207679_10191407 | |||
| 1250 | Ga0207667_10064560 | |||
| 1251 | Ga0207651_10009338 | |||
| 1252 | Ga0207712_10167936 | |||
| 1253 | Ga0207668_10000872 | |||
| 1254 | Ga0207668_10507727 | |||
| 1255 | Ga0207658_10007011 | |||
| 1256 | Ga0207658_10100797 | |||
| 1257 | Ga0207677_10008956 | |||
| 1258 | Ga0207677_10391084 | |||
| 1259 | Ga0207703_10000526 | |||
| 1260 | Ga0207703_10030338 | |||
| 1261 | Ga0207703_10369098 | |||
| 1262 | Ga0207639_10002828 | |||
| 1263 | Ga0207678_10113375 | |||
| 1264 | Ga0207708_10001327 | |||
| 1265 | Ga0207708_10037606 | |||
| 1266 | Ga0207641_10001558 | |||
| 1267 | Ga0207641_10007493 | |||
| 1268 | Ga0207641_10075828 | |||
| 1269 | Ga0207648_10000235 | |||
| 1270 | Ga0207648_10002770 | |||
| 1271 | Ga0207648_10011668 | |||
| 1272 | Ga0207648_10023006 | |||
| 1273 | Ga0207676_10126889 | |||
| 1274 | Ga0207674_10010096 | |||
| 1275 | Ga0207674_10063070 | |||
| 1276 | Ga0207675_100000429 | |||
| 1277 | Ga0207675_100000505 | |||
| 1278 | Ga0207675_100074020 | |||
| 1279 | Ga0207675_100776290 | |||
| 1280 | Ga0207683_10000063 | |||
| 1281 | Ga0207683_10026337 | |||
| 1282 | Ga0207683_10054624 | |||
| 1283 | Ga0207683_10086287 | |||
| 1284 | Ga0207683_10556042 | |||
| 1285 | Ga0207698_10026942 | |||
| 1286 | Ga0207698_10247849 | |||
| 1287 | Ga0268266_10022024 | |||
| 1288 | Ga0268266_10267470 | |||
| 1289 | Ga0268265_10025979 | |||
| 1290 | Ga0268265_10099033 | |||
| 1291 | Ga0268265_10127067 | |||
| 1292 | Ga0268264_10002349 | |||
| 1293 | Ga0268264_10052651 | |||
| 1294 | Ga0268264_10369959 | |||
| 1295 | Ga0268264_10931704 | |||
| 1296 | Ga0265318_10008402 | |||
| 1297 | Ga0316182_1282003 | |||
| 1298 | Ga0265330_10021196 | |||
| 1299 | Ga0265332_10005981 | |||
| 1300 | Ga0265328_10003414 | |||
| 1301 | Ga0265320_10064722 | |||
| 1302 | Ga0265329_10009664 | |||
| 1303 | Ga0265316_10067031 | |||
| 1304 | Ga0307408_100000450 | |||
| 1305 | Ga0307408_100003487 | |||
| 1306 | Ga0307408_100025596 | |||
| 1307 | Ga0307408_100025748 | |||
| 1308 | Ga0307408_100033282 | |||
| 1309 | Ga0265313_10141625 | |||
| 1310 | Ga0265314_10001661 | |||
| 1311 | Ga0265314_10016583 | |||
| 1312 | Ga0307405_10001199 | |||
| 1313 | Ga0307410_10010401 | |||
| 1314 | Ga0307406_10007424 | |||
| 1315 | Ga0307407_10001125 | |||
| 1316 | Ga0307409_100011853 | |||
| 1317 | Ga0307416_100012219 | |||
| 1318 | Ga0307416_100015946 | |||
| 1319 | Ga0307414_10013534 | |||
| 1320 | Ga0307411_10015490 | |||
| 1321 | Ga0373936_0128937 | |||
| 1322 | Ga0373955_0404923 | |||
| 1323 | Ga0373935_0223135 | |||
| 1324 | Ga0373937_0241975 | |||
| 1325 | Ga0395899_0005018 | |||
| 1326 | Ga0395900_0046243 | |||
| 1327 | Ga0395900_0347333 | |||
| 1328 | Ga0395900_0676480 | |||
| 1329 | Ga0395898_0262927 | |||
| 1330 | Ga0395898_0330134 | |||
| 1331 | Ga0395898_0420912 | |||
| 1332 | Ga0395905_0001910 | |||
| 1333 | Ga0395905_0013721 | |||
| 1334 | Ga0395905_0065260 | |||
| 1335 | Ga0395901_0054440 | |||
| 1336 | Ga0436361_0085830 | |||
| 1337 | Ga0436361_0249401 | |||
| 1338 | Ga0436361_0309154 | |||
| 1339 | Ga0436361_0429789 | |||
| 1340 | Ga0436361_0438898 | |||
| 1341 | Ga0439462_0107926 | |||
| 1342 | Ga0450904_001402 | |||
| 1343 | Ga0451577_0187254 | |||
| 1344 | Ga0466961_0000078 | |||
| 1345 | Ga0466964_0007438 | |||
| 1346 | Ga0453684_0000508 | |||
| 1347 | Ga0466970_0009010 | |||
| 1348 | Ga0466959_0021140 | |||
| 1349 | Ga0466959_0061931 | |||
| 1350 | Ga0451576_0052326 | |||
| 1351 | Ga0495617_000012 | |||
| 1352 | Ga0495617_000475 | |||
| 1353 | Ga0495617_004034 | |||
| 1354 | Ga0495617_004809 | |||
| 1355 | Ga0495617_005218 | |||
| 1356 | Ga0495627_000651 | |||
| 1357 | Ga0495627_017673 | |||
| 1358 | Ga0495627_020741 | |||
| 1359 | Ga0495592_0067577 | |||
| 1360 | Ga0495603_0007537 | |||
| 1361 | Ga0495603_0027815 | |||
| 1362 | Ga0495603_0098611 | |||
| 1363 | Ga0495590_0000016 | |||
| 1364 | Ga0495590_0000206 | |||
| 1365 | Ga0495590_0001065 | |||
| 1366 | Ga0495590_0003195 | |||
| 1367 | Ga0495590_0091975 | |||
| 1368 | Ga0495591_007517 | |||
| 1369 | Ga0495629_0040129 | |||
| 1370 | Ga0495629_0136444 | |||
| 1371 | Ga0495629_0165501 | |||
| 1372 | Ga0495638_0000057 | |||
| 1373 | Ga0495638_0024991 | |||
| 1374 | Ga0495638_0075857 | |||
| 1375 | Ga0495638_0098261 | |||
| 1376 | Ga0495638_0121858 | |||
| 1377 | Ga0495653_0008032 | |||
| 1378 | Ga0495653_0059077 | |||
| 1379 | Ga0495653_0067902 | |||
| 1380 | Ga0495650_0000646 | |||
| 1381 | Ga0495650_0006164 | |||
| 1382 | Ga0495650_0040252 | |||
| 1383 | Ga0495580_0067988 | |||
| 1384 | Ga0495580_0343213 | |||
| 1385 | Ga0495582_0003091 | |||
| 1386 | Ga0495582_0008422 | |||
| 1387 | Ga0495582_0091027 | |||
| 1388 | Ga0495605_0000072 | |||
| 1389 | Ga0495605_0039535 | |||
| 1390 | Ga0495605_0060759 | |||
| 1391 | Ga0495605_0069549 | |||
| 1392 | Ga0495605_0103715 | |||
| 1393 | Ga0495639_0009710 | |||
| 1394 | Ga0495639_0144579 | |||
| 1395 | Ga0495584_0000377 | |||
| 1396 | Ga0495584_0000452 | |||
| 1397 | Ga0495584_0002429 | |||
| 1398 | Ga0495584_0011048 | |||
| 1399 | Ga0495584_0014683 | |||
| 1400 | Ga0495584_0043931 | |||
| 1401 | Ga0495584_0063386 | |||
| 1402 | Ga0495584_0093090 | |||
| 1403 | Ga0495584_0118737 | |||
| 1404 | Ga0495584_0131007 | |||
| 1405 | Ga0495585_0000600 | |||
| 1406 | Ga0495585_0000649 | |||
| 1407 | Ga0495585_0001573 | |||
| 1408 | Ga0495585_0001842 | |||
| 1409 | Ga0495585_0011508 | |||
| 1410 | Ga0495585_0015549 | |||
| 1411 | Ga0495585_0015563 | |||
| 1412 | Ga0495585_0035820 | |||
| 1413 | Ga0495585_0037658 | |||
| 1414 | Ga0495585_0048206 | |||
| 1415 | Ga0495585_0056323 | |||
| 1416 | Ga0495585_0057705 | |||
| 1417 | Ga0495585_0062291 | |||
| 1418 | Ga0495585_0074545 | |||
| 1419 | Ga0495585_0088844 | |||
| 1420 | Ga0495594_0065415 | |||
| 1421 | Ga0495594_0067197 | |||
| 1422 | Ga0495594_0068534 | |||
| 1423 | Ga0495594_0077075 | |||
| 1424 | Ga0495594_0084246 | |||
| 1425 | Ga0495594_0127099 | |||
| 1426 | Ga0495596_0000623 | |||
| 1427 | Ga0495596_0001509 | |||
| 1428 | Ga0495596_0001827 | |||
| 1429 | Ga0495596_0013959 | |||
| 1430 | Ga0495596_0028653 | |||
| 1431 | Ga0495596_0098241 | |||
| 1432 | Ga0495607_0001841 | |||
| 1433 | Ga0495607_0002196 | |||
| 1434 | Ga0495607_0003038 | |||
| 1435 | Ga0495607_0023479 | |||
| 1436 | Ga0495607_0023728 | |||
| 1437 | Ga0495607_0026837 | |||
| 1438 | Ga0495607_0027894 | |||
| 1439 | Ga0495607_0040964 | |||
| 1440 | Ga0495583_0000026 | |||
| 1441 | Ga0495583_0000396 | |||
| 1442 | Ga0495583_0000691 | |||
| 1443 | Ga0495583_0001072 | |||
| 1444 | Ga0495583_0001093 | |||
| 1445 | Ga0495583_0002696 | |||
| 1446 | Ga0495583_0009089 | |||
| 1447 | Ga0495583_0014056 | |||
| 1448 | Ga0495583_0020584 | |||
| 1449 | Ga0495583_0021156 | |||
| 1450 | Ga0495583_0022957 | |||
| 1451 | Ga0495583_0027879 | |||
| 1452 | Ga0495583_0038338 | |||
| 1453 | Ga0495583_0113999 | |||
| 1454 | Ga0495606_0001127 | |||
| 1455 | Ga0495606_0001851 | |||
| 1456 | Ga0495606_0002663 | |||
| 1457 | Ga0495606_0002699 | |||
| 1458 | Ga0495606_0023989 | |||
| 1459 | Ga0495606_0031007 | |||
| 1460 | Ga0495606_0046107 | |||
| 1461 | Ga0495606_0049977 | |||
| 1462 | Ga0495606_0057973 | |||
| 1463 | Ga0495606_0115739 | |||
| 1464 | Ga0495606_0176526 | |||
| 1465 | Ga0495606_0200590 | |||
| 1466 | Ga0495608_0028441 | |||
| 1467 | Ga0495610_0000554 | |||
| 1468 | Ga0495610_0010485 | |||
| 1469 | Ga0495610_0020541 | |||
| 1470 | Ga0495616_0000386 | |||
| 1471 | Ga0495616_0000421 | |||
| 1472 | Ga0495616_0000569 | |||
| 1473 | Ga0495616_0001705 | |||
| 1474 | Ga0495616_0006331 | |||
| 1475 | Ga0495616_0007822 | |||
| 1476 | Ga0495616_0017332 | |||
| 1477 | Ga0495616_0020860 | |||
| 1478 | Ga0495616_0024422 | |||
| 1479 | Ga0495616_0047864 | |||
| 1480 | Ga0495616_0066286 | |||
| 1481 | Ga0495616_0077701 | |||
| 1482 | Ga0495618_0064344 | |||
| 1483 | Ga0495628_0008247 | |||
| 1484 | Ga0495628_0046689 | |||
| 1485 | Ga0495631_0000366 | |||
| 1486 | Ga0495631_0001198 | |||
| 1487 | Ga0495631_0010027 | |||
| 1488 | Ga0495631_0013684 | |||
| 1489 | Ga0495631_0017687 | |||
| 1490 | Ga0495631_0026306 | |||
| 1491 | Ga0495631_0042817 | |||
| 1492 | Ga0495631_0049642 | |||
| 1493 | Ga0495632_0000018 | |||
| 1494 | Ga0495632_0000156 | |||
| 1495 | Ga0495632_0000537 | |||
| 1496 | Ga0495632_0005150 | |||
| 1497 | Ga0495632_0031022 | |||
| 1498 | Ga0495632_0135660 | |||
| 1499 | Ga0495637_0000458 | |||
| 1500 | Ga0495637_0014342 | |||
| 1501 | Ga0495637_0025328 | |||
| 1502 | Ga0495643_0000605 | |||
| 1503 | Ga0495643_0000709 | |||
| 1504 | Ga0495643_0000898 | |||
| 1505 | Ga0495643_0003553 | |||
| 1506 | Ga0495643_0024064 | |||
| 1507 | Ga0495643_0068373 | |||
| 1508 | Ga0495643_0081507 | |||
| 1509 | Ga0495643_0128778 | |||
| 1510 | Ga0495644_0000268 | |||
| 1511 | Ga0495644_0001551 | |||
| 1512 | Ga0495644_0002717 | |||
| 1513 | Ga0495644_0003445 | |||
| 1514 | Ga0495644_0018746 | |||
| 1515 | Ga0495648_0000002 | |||
| 1516 | Ga0495648_0000866 | |||
| 1517 | Ga0495648_0001243 | |||
| 1518 | Ga0495648_0001470 | |||
| 1519 | Ga0495648_0020742 | |||
| 1520 | Ga0495648_0024701 | |||
| 1521 | Ga0495648_0047867 | |||
| 1522 | Ga0495648_0048170 | |||
| 1523 | Ga0495648_0061250 | |||
| 1524 | Ga0495648_0080812 | |||
| 1525 | Ga0495648_0092936 | |||
| 1526 | Ga0495648_0199666 | |||
| 1527 | Ga0495666_0000138 | |||
| 1528 | Ga0495666_0002401 | |||
| 1529 | Ga0495666_0003366 | |||
| 1530 | Ga0495666_0012868 | |||
| 1531 | Ga0495642_0000387 | |||
| 1532 | Ga0495642_0002203 | |||
| 1533 | Ga0495642_0003215 | |||
| 1534 | Ga0495642_0005090 | |||
| 1535 | Ga0495642_0007542 | |||
| 1536 | Ga0495642_0019074 | |||
| 1537 | Ga0495642_0027782 | |||
| 1538 | Ga0495642_0043022 | |||
| 1539 | Ga0495642_0069342 | |||
| 1540 | Ga0495642_0126535 | |||
| 1541 | Ga0495652_0032836 | |||
| 1542 | Ga0495652_0105629 | |||
| 1543 | Ga0495652_0128834 | |||
| 1544 | Ga0495654_0007423 | |||
| 1545 | Ga0495654_0014157 | |||
| 1546 | Ga0495654_0068114 | |||
| 1547 | Ga0495665_0001262 | |||
| 1548 | Ga0495665_0011493 | |||
| 1549 | Ga0495665_0050029 | |||
| 1550 | Ga0495586_0009312 | |||
| 1551 | Ga0495586_0046472 | |||
| 1552 | Ga0495586_0116288 | |||
| 1553 | Ga0495586_0245298 | |||
| 1554 | Ga0495587_0014893 | |||
| 1555 | Ga0495587_0199652 | |||
| 1556 | Ga0495609_0000615 | |||
| 1557 | Ga0495609_0001333 | |||
| 1558 | Ga0495609_0001528 | |||
| 1559 | Ga0495609_0002184 | |||
| 1560 | Ga0495609_0003541 | |||
| 1561 | Ga0495609_0012993 | |||
| 1562 | Ga0495609_0017690 | |||
| 1563 | Ga0495609_0021139 | |||
| 1564 | Ga0495609_0022115 | |||
| 1565 | Ga0495609_0023269 | |||
| 1566 | Ga0495609_0045781 | |||
| 1567 | Ga0495609_0102061 | |||
| 1568 | Ga0495597_0000025 | |||
| 1569 | Ga0495597_0000304 | |||
| 1570 | Ga0495597_0000488 | |||
| 1571 | Ga0495597_0000740 | |||
| 1572 | Ga0495597_0000859 | |||
| 1573 | Ga0495597_0001242 | |||
| 1574 | Ga0495597_0001429 | |||
| 1575 | Ga0495597_0008775 | |||
| 1576 | Ga0495597_0017983 | |||
| 1577 | Ga0495597_0071561 | |||
| 1578 | Ga0495597_0091125 | |||
| 1579 | Ga0495645_0012498 | |||
| 1580 | Ga0495645_0027716 | |||
| 1581 | Ga0495622_0000251 | |||
| 1582 | Ga0495622_0000257 | |||
| 1583 | Ga0495622_0000983 | |||
| 1584 | Ga0495622_0023723 | |||
| 1585 | Ga0495622_0043804 | |||
| 1586 | Ga0495622_0052529 | |||
| 1587 | Ga0495633_0000451 | |||
| 1588 | Ga0495633_0000501 | |||
| 1589 | Ga0495633_0000901 | |||
| 1590 | Ga0495633_0001151 | |||
| 1591 | Ga0495633_0001968 | |||
| 1592 | Ga0495633_0005258 | |||
| 1593 | Ga0495633_0005473 | |||
| 1594 | Ga0495633_0013244 | |||
| 1595 | Ga0495633_0021428 | |||
| 1596 | Ga0495633_0050781 | |||
| 1597 | Ga0495633_0063775 | |||
| 1598 | Ga0495633_0072436 | |||
| 1599 | Ga0495656_0008155 | |||
| 1600 | Ga0495656_0033997 | |||
| 1601 | Ga0495656_0037462 | |||
| 1602 | Ga0495656_0039406 | |||
| 1603 | Ga0495656_0061812 | |||
| 1604 | Ga0495656_0075225 | |||
| 1605 | Ga0495668_0000132 | |||
| 1606 | Ga0495668_0001034 | |||
| 1607 | Ga0495668_0003188 | |||
| 1608 | Ga0495668_0005866 | |||
| 1609 | Ga0495668_0006443 | |||
| 1610 | Ga0495668_0013157 | |||
| 1611 | Ga0495668_0024688 | |||
| 1612 | Ga0495668_0035387 | |||
| 1613 | Ga0495668_0045801 | |||
| 1614 | Ga0495668_0077884 | |||
| 1615 | Ga0495668_0123519 | |||
| 1616 | Ga0495634_0181446 | |||
| 1617 | Ga0495611_0000537 | |||
| 1618 | Ga0495611_0004037 | |||
| 1619 | Ga0495611_0006608 | |||
| 1620 | Ga0495611_0024846 | |||
| 1621 | Ga0495611_0041779 | |||
| 1622 | Ga0495611_0159525 | |||
| 1623 | Ga0495611_0180205 | |||
| 1624 | Ga0495625_0000835 | |||
| 1625 | Ga0495625_0011466 | |||
| 1626 | Ga0495625_0021395 | |||
| 1627 | Ga0495625_0039434 | |||
| 1628 | Ga0495625_0039765 | |||
| 1629 | Ga0495625_0045467 | |||
| 1630 | Ga0495625_0070045 | |||
| 1631 | Ga0495625_0167113 | |||
| 1632 | Ga0495625_0186903 | |||
| 1633 | Ga0495625_0227247 | |||
| 1634 | Ga0495635_0001439 | |||
| 1635 | Ga0495659_0000370 | |||
| 1636 | Ga0495659_0001025 | |||
| 1637 | Ga0495659_0128088 | |||
| 1638 | Ga0495661_0000082 | |||
| 1639 | Ga0495661_0003296 | |||
| 1640 | Ga0495661_0012047 | |||
| 1641 | Ga0495661_0021899 | |||
| 1642 | Ga0495661_0026716 | |||
| 1643 | Ga0495661_0035259 | |||
| 1644 | Ga0495661_0040723 | |||
| 1645 | Ga0495661_0047394 | |||
| 1646 | Ga0495661_0059533 | |||
| 1647 | Ga0495588_0011746 | |||
| 1648 | Ga0495588_0093542 | |||
| 1649 | Ga0495588_0098452 | |||
| 1650 | Ga0495588_0128498 | |||
| 1651 | Ga0495588_0135751 | |||
| 1652 | Ga0495588_0140780 | |||
| 1653 | Ga0495657_0086070 | |||
| 1654 | Ga0495599_0001621 | |||
| 1655 | Ga0495623_0002537 | |||
| 1656 | Ga0495623_0027554 | |||
| 1657 | Ga0495623_0124627 | |||
| 1658 | Ga0495646_0004694 | |||
| 1659 | Ga0495658_0233159 | |||
| 1660 | Ga0495669_0000292 | |||
| 1661 | Ga0495669_0001593 | |||
| 1662 | Ga0495669_0003904 | |||
| 1663 | Ga0495669_0014711 | |||
| 1664 | Ga0495669_0016478 | |||
| 1665 | Ga0495669_0018506 | |||
| 1666 | Ga0495669_0100715 | |||
| 1667 | Ga0495624_0002448 | |||
| 1668 | Ga0495624_0033456 | |||
| 1669 | Ga0495670_0004090 | |||
| 1670 | Ga0495670_0005302 | |||
| 1671 | Ga0495670_0014635 | |||
| 1672 | Ga0495670_0015846 | |||
| 1673 | Ga0495670_0035845 | |||
| 1674 | Ga0495670_0043169 | |||
| 1675 | Ga0495670_0052236 | |||
| 1676 | Ga0495670_0058622 | |||
| 1677 | Ga0495670_0063790 | |||
| 1678 | Ga0495670_0085088 | |||
| 1679 | Ga0495670_0094170 | |||
| 1680 | Ga0495671_0000354 | |||
| 1681 | Ga0495671_0002915 | |||
| 1682 | Ga0495671_0035766 | |||
| 1683 | Ga0495671_0042293 | |||
| 1684 | Ga0495671_0063478 | |||
| 1685 | Ga0495671_0074545 | |||
| 1686 | Ga0495671_0102904 | |||
| 1687 | Ga0495671_0157447 | |||
| 1688 | Ga0495649_0000537 | |||
| 1689 | Ga0495649_0013148 | |||
| 1690 | Ga0495649_0024047 | |||
| 1691 | Ga0495649_0062159 | |||
| 1692 | Ga0495649_0125994 | |||
| 1693 | Ga0495589_0000354 | |||
| 1694 | Ga0495589_0003737 | |||
| 1695 | Ga0495589_0017349 | |||
| 1696 | Ga0495589_0024045 | |||
| 1697 | Ga0495589_0026949 | |||
| 1698 | Ga0495589_0041290 | |||
| 1699 | Ga0495589_0047456 | |||
| 1700 | Ga0495589_0109395 | |||
| 1701 | Ga0495600_0002072 | |||
| 1702 | Ga0495600_0011378 | |||
| 1703 | Ga0495660_0012257 | |||
| 1704 | Ga0495660_0023206 | |||
| 1705 | Ga0495660_0030924 | |||
| 1706 | Ga0495660_0052088 | |||
| 1707 | Ga0495660_0059775 | |||
| 1708 | Ga0495581_0000444 | |||
| 1709 | Ga0495581_0005600 | |||
| 1710 | Ga0495581_0036587 | |||
| 1711 | Ga0495604_0071327 | |||
| 1712 | Ga0495604_0183218 | |||
| 1713 | Ga0495636_0000418 | |||
| 1714 | Ga0495636_0001813 | |||
| 1715 | Ga0495636_0004439 | |||
| 1716 | Ga0495636_0086044 | |||
| 1717 | Ga0495672_0000219 | |||
| 1718 | Ga0495672_0000258 | |||
| 1719 | Ga0495672_0000493 | |||
| 1720 | Ga0495672_0006283 | |||
| 1721 | Ga0495672_0013765 | |||
| 1722 | Ga0495676_0000352 | |||
| 1723 | Ga0495676_0044244 | |||
| 1724 | Ga0495676_0113162 | |||
| 1725 | Ga0495683_0000446 | |||
| 1726 | Ga0495683_0005804 | |||
| 1727 | Ga0495683_0010304 | |||
| 1728 | Ga0495683_0010366 | |||
| 1729 | Ga0495683_0029179 | |||
| 1730 | Ga0495683_0030327 | |||
| 1731 | Ga0495683_0044951 | |||
| 1732 | Ga0495683_0049201 | |||
| 1733 | Ga0495687_000015 | |||
| 1734 | Ga0495687_000034 | |||
| 1735 | Ga0495687_000081 | |||
| 1736 | Ga0495687_000587 | |||
| 1737 | Ga0495687_001660 | |||
| 1738 | Ga0495687_006472 | |||
| 1739 | Ga0495687_020170 | |||
| 1740 | Ga0495687_020171 | |||
| 1741 | Ga0495687_029212 | |||
| 1742 | Ga0495687_081385 | |||
| 1743 | Ga0495675_0002959 | |||
| 1744 | Ga0495675_0104620 | |||
| 1745 | Ga0495675_0200296 | |||
| 1746 | Ga0495677_0000195 | |||
| 1747 | Ga0495677_0008402 | |||
| 1748 | Ga0495677_0011858 | |||
| 1749 | Ga0495677_0014308 | |||
| 1750 | Ga0495677_0039576 | |||
| 1751 | Ga0495677_0098869 | |||
| 1752 | Ga0495679_003649 | |||
| 1753 | Ga0495679_052739 | |||
| 1754 | Ga0495685_000078 | |||
| 1755 | Ga0495685_003560 | |||
| 1756 | Ga0495685_010214 | |||
| 1757 | Ga0495673_0000015 | |||
| 1758 | Ga0495673_0005789 | |||
| 1759 | Ga0495681_0000144 | |||
| 1760 | Ga0495681_0000428 | |||
| 1761 | Ga0495681_0001162 | |||
| 1762 | Ga0495681_0003308 | |||
| 1763 | Ga0495681_0035635 | |||
| 1764 | Ga0495681_0090019 | |||
| 1765 | Ga0495681_0135789 | |||
| 1766 | Ga0495686_0001101 | |||
| 1767 | Ga0495686_0057064 | |||
| 1768 | Ga0495686_0061421 | |||
| 1769 | Ga0495593_0002509 | |||
| 1770 | Ga0495593_0003002 | |||
| 1771 | Ga0495593_0034958 | |||
| 1772 | Ga0495602_0068835 | |||
| 1773 | Ga0495615_0002932 | |||
| 1774 | Ga0495626_0010300 | |||
| 1775 | Ga0495626_0012239 | |||
| 1776 | Ga0495626_0012998 | |||
| 1777 | Ga0495626_0041423 | |||
| 1778 | Ga0495626_0047939 | |||
| 1779 | Ga0495626_0102903 | |||
| 1780 | Ga0496101_0049161 | |||
| 1781 | Ga0496102_0000058 | |||
| 1782 | Ga0496102_0001515 | |||
| 1783 | Ga0496102_0032694 | |||
| 1784 | Ga0496102_0077459 | |||
| 1785 | Ga0496102_0282711 | |||
| 1786 | Ga0496102_0288233 | |||
| 1787 | Ga0496103_0004164 | |||
| 1788 | Ga0496103_0403395 | |||
| 1789 | Ga0496105_0201613 | |||
| 1790 | Ga0496107_0061012 | |||
| 1791 | Ga0496108_0199567 | |||
| 1792 | Ga0496108_0450286 | |||
| 1793 | Ga0496109_0084931 | |||
| 1794 | Ga0496109_0349137 | |||
| 1795 | Ga0496110_0000251 | |||
| 1796 | Ga0496110_0630604 | |||
| 1797 | Ga0496111_0027090 | |||
| 1798 | Ga0496111_0427248 | |||
| 1799 | Ga0496112_0396415 | |||
| 1800 | Ga0496113_0008918 | |||
| 1801 | Ga0496114_0253977 | |||
| 1802 | Ga0496115_0009163 | |||
| 1803 | Ga0496115_0086929 | |||
| 1804 | Ga0496115_0180676 | |||
| 1805 | Ga0496116_0029391 | |||
| 1806 | Ga0496116_0089629 | |||
| 1807 | Ga0496117_0000001 | |||
| 1808 | Ga0496118_0000002 | |||
| 1809 | Ga0496121_0005466 | |||
| 1810 | Ga0496121_0020195 | |||
| 1811 | Ga0496122_0000255 | |||
| 1812 | Ga0496122_0001676 | |||
| 1813 | Ga0496123_0000138 | |||
| 1814 | Ga0496123_0004104 | |||
| 1815 | Ga0496124_0009103 | |||
| 1816 | Ga0496124_0032737 | |||
| 1817 | Ga0496125_0002620 | |||
| 1818 | Ga0496125_0086612 | |||
| 1819 | Ga0495678_000069 | |||
| 1820 | Ga0495678_000094 | |||
| 1821 | Ga0495678_000110 | |||
| 1822 | Ga0495678_000294 | |||
| 1823 | Ga0495678_000962 | |||
| 1824 | Ga0495678_001220 | |||
| 1825 | Ga0495678_013301 | |||
| 1826 | Ga0495678_041165 | |||
| 1827 | Ga0495682_0000295 | |||
| 1828 | Ga0495682_0000618 | |||
| 1829 | Ga0495682_0000781 | |||
| 1830 | Ga0495682_0010195 | |||
| 1831 | Ga0495682_0016043 | |||
| 1832 | Ga0495682_0030475 | |||
| 1833 | Ga0501034_0038883 | |||
| 1834 | Ga0501067_0024395 | |||
| 1835 | Ga0501070_0015021 | |||
| 1836 | Ga0501074_0110257 | |||
| 1837 | Ga0501227_019315 | |||
| 1838 | Ga0501079_0156266 | |||
| 1839 | Ga0501080_0028810 | |||
| 1840 | Ga0501080_0112570 | |||
| 1841 | nmdc:mga05p37_79194_c1 | |||
| 1842 | nmdc:mga0n895_137164_c1 | |||
| 1843 | nmdc:mga0n895_196779_c1 | |||
| 1844 | nmdc:mga0n895_205471_c1 | |||
| 1845 | nmdc:mga0rr50_407439_c1 | |||
| 1846 | nmdc:mga08x19_112143_c1 | |||
| 1847 | Ga0495601_0006267 | |||
| 1848 | Ga0500583_0026491 | |||
| 1849 | Ga0500595_005111 | |||
| 1850 | Ga0500574_000096 | |||
| 1851 | Ga0500586_000061 | |||
| 1852 | Ga0500619_015034 | |||
| 1853 | Ga0466962_0015210 | |||
| 1854 | 2601668157 | |||
| 1855 | 2643792349 | |||
| 1856 | 2644029046 | |||
| 1857 | 2644212158 | |||
| 1858 | 2644251019 | |||
| 1859 | 2644354800 | |||
| 1860 | 2738739768 | |||
| 1861 | 2738842259 | |||
| 1862 | 2739273960 | |||
| 1863 | 2739343004 | |||
| 1864 | 2819542577 | |||
| 1865 | 2842716540 | |||
| 1866 | 2857550391 | |||
| 1867 | 2857560138 | |||
| 1868 | 2885083215 | |||
| 1869 | 2932411865 | |||
| 1870 | 2932418568 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.8462 | 8 | 273 |
| 5h3h-assembly1.cif.gz_A | esterase (eaest) from exiguobacterium antarcticum | 0.8408 | 2 | 273 |
| 5frd-assembly2.cif.gz_B | structure of a thermophilic esterase | 0.839 | 1 | 275 |
| 3hea-assembly1.cif.gz_A | the l29p/l124i mutation of pseudomonas fluorescens esterase | 0.8346 | 3 | 273 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.833 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h3hA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8408 | 2 | 273 | 3.40.50.1820 |
| 5frdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8346 | 1 | 275 | 3.40.50.1820 |
| 1va4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8345 | 3 | 273 | 3.40.50.1820 |
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8286 | 10 | 273 | 3.40.50.1820 |
| 5h3hA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.826 | 2 | 273 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3Q450-F1-model_v4 | deleted | 0.9596 | 1 | 230 |
|
| AF-A0A1Q3Y792-F1-model_v4 | Alpha/beta hydrolase | 0.9483 | 1 | 271 |
GO:0016020
GO:0046464 GO:0047372 |
| AF-A0A4Q3Q450-F1-model_v4 | deleted | 0.9472 | 1 | 230 |
|
| AF-A0A536TWL7-F1-model_v4 | Alpha/beta fold hydrolase | 0.9462 | 1 | 140 |
GO:0016020
GO:0016787 |
| AF-A0A7Y3FLN2-F1-model_v4 | Alpha/beta hydrolase | 0.9371 | 1 | 273 |
GO:0016020
GO:0016787 |