F486159

General Info

Members Datasets Scaffolds Average Seq Length
935 246 1870 355

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10017205|Ga0207703_100172056
Length 387
Sequence VYSPGVHKGQKLEEAIRAEAGRLGFVACGFARADAADAAGLDLKRWLEAGHHGTMGWMEERAHHRVSPLALWPEARSAIALGMSYTPASDPLALAERPELGRISAYAQGGDYHKTVKKALKALARFITDRAASELKVFVDTAPVMEKPLAQAAGIGWQGKHTNLVSREHGSWLFLGVILTGLELEPDSPASDGIHCGTCTRCLDSCPTQAFVGPHRIDARRCISYRTIEHDGAIPEELRPAMGNRIYGCDDCLAVCPWNRFADAAAANRAFLARAELAAPRLADLLALDDAAFREMFAGSPIKRIGVKRMIRNCLIAAGNSGDRSLVASVKAHLDDPDAVIAEAAAWAVAQLGTPSAAMQADWSVSAPDGSRVSTWVTRSGAPAWDA

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
246 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.49
Rhizosphere 95.29
Stem 0
Stem Tuber 0.11
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10017205 3300026035 Bacteria 5641
2 JGI24741J21665_1002624 3300001915 Bacteria 4597
3 JGI24740J21852_10002399 3300001979 Bacteria 8518
4 JGI24740J21852_10005120 3300001979 Bacteria 5566
5 JGI24740J21852_10017958 3300001979 Bacteria 2519
6 JGI24740J21852_10037536 3300001979 Bacteria 1495
7 JGI24739J22299_10000659 3300001989 Bacteria 12414
8 JGI24739J22299_10005413 3300001989 Bacteria 4851
9 JGI24739J22299_10005850 3300001989 Bacteria 4656
10 JGI24739J22299_10020069 3300001989 Bacteria 2388
11 JGI24737J22298_10000051 3300001990 Bacteria 34099
12 JGI24737J22298_10000119 3300001990 Bacteria 24121
13 JGI24737J22298_10006471 3300001990 Bacteria 4001
14 JGI24737J22298_10014594 3300001990 Bacteria 2549
15 JGI24737J22298_10017353 3300001990 Bacteria 2320
16 JGI24737J22298_10024655 3300001990 Bacteria 1905
17 JGI24735J21928_10010063 3300002067 Bacteria 3024
18 JGI24738J21930_10000189 3300002075 Bacteria 16094
19 JGI24738J21930_10010662 3300002075 Bacteria 2041
20 JGI24738J21930_10011785 3300002075 Bacteria 1917
21 Ga0065715_10016189 3300005293 Bacteria 2138
22 Ga0065715_10113515 3300005293 Bacteria 2486
23 Ga0065715_10147636 3300005293 Bacteria 1758
24 Ga0070658_10000179 3300005327 Bacteria 55511
25 Ga0070658_10007967 3300005327 Bacteria 8527
26 Ga0070658_10021959 3300005327 Bacteria 5118
27 Ga0070658_10028874 3300005327 Bacteria 4453
28 Ga0070658_10046694 3300005327 Bacteria 3504
29 Ga0070658_10065793 3300005327 Bacteria 2960
30 Ga0070658_10074367 3300005327 Bacteria 2786
31 Ga0070658_10086773 3300005327 Bacteria 2574
32 Ga0070658_10203858 3300005327 Bacteria 1669
33 Ga0070676_10002487 3300005328 Bacteria 9457
34 Ga0070676_10078150 3300005328 Bacteria 2001
35 Ga0070676_10094065 3300005328 Bacteria 1841
36 Ga0070683_100000209 3300005329 Bacteria 39666
37 Ga0070683_100015961 3300005329 Bacteria 6607
38 Ga0070683_100035143 3300005329 Bacteria 4581
39 Ga0070670_100007357 3300005331 Bacteria 9347
40 Ga0070670_100015501 3300005331 Bacteria 6545
41 Ga0070670_100020869 3300005331 Bacteria 5633
42 Ga0070670_100035198 3300005331 Bacteria 4311
43 Ga0070670_100080567 3300005331 Bacteria 2798
44 Ga0070670_100119093 3300005331 Bacteria 2277
45 Ga0070670_100137261 3300005331 Bacteria 2114
46 Ga0070670_100173668 3300005331 Bacteria 1870
47 Ga0070670_100362834 3300005331 Unclassified 1274
48 Ga0070677_10000456 3300005333 Bacteria 14007
49 Ga0070677_10008734 3300005333 Bacteria 3419
50 Ga0068869_100106347 3300005334 Bacteria 2129
51 Ga0070666_10000253 3300005335 Bacteria 35588
52 Ga0070666_10009562 3300005335 Bacteria 6049
53 Ga0070666_10016172 3300005335 Bacteria 4769
54 Ga0070666_10025968 3300005335 Bacteria 3822
55 Ga0070680_100001266 3300005336 Bacteria 18260
56 Ga0070680_100001515 3300005336 Bacteria 16912
57 Ga0070680_100028062 3300005336 Bacteria 4513
58 Ga0070680_100057373 3300005336 Bacteria 3183
59 Ga0070682_100005834 3300005337 Bacteria 6877
60 Ga0070682_100132508 3300005337 Bacteria 1689
61 Ga0068868_100029600 3300005338 Bacteria 4194
62 Ga0068868_100043537 3300005338 Bacteria 3507
63 Ga0068868_100166675 3300005338 Bacteria 1822
64 Ga0068868_100232346 3300005338 Bacteria 1547
65 Ga0068868_100409680 3300005338 Bacteria 1171
66 Ga0070660_100000496 3300005339 Bacteria 26199
67 Ga0070660_100000843 3300005339 Bacteria 20403
68 Ga0070660_100002806 3300005339 Bacteria 11979
69 Ga0070660_100005800 3300005339 Bacteria 8556
70 Ga0070660_100015320 3300005339 Bacteria 5533
71 Ga0070660_100039830 3300005339 Bacteria 3573
72 Ga0070660_100081923 3300005339 Bacteria 2533
73 Ga0070660_100117230 3300005339 Bacteria 2123
74 Ga0070660_100160812 3300005339 Bacteria 1810
75 Ga0070660_100165940 3300005339 Bacteria 1781
76 Ga0070660_100346688 3300005339 Bacteria 1222
77 Ga0070689_100065582 3300005340 Bacteria 2828
78 Ga0070661_100000509 3300005344 Bacteria 29863
79 Ga0070661_100005747 3300005344 Bacteria 8538
80 Ga0070661_100040027 3300005344 Bacteria 3417
81 Ga0070661_100090855 3300005344 Bacteria 2261
82 Ga0070661_100153210 3300005344 Bacteria 1743
83 Ga0070661_100157838 3300005344 Bacteria 1717
84 Ga0070692_10005156 3300005345 Bacteria 5531
85 Ga0070692_10008858 3300005345 Bacteria 4508
86 Ga0070692_10025489 3300005345 Bacteria 2914
87 Ga0070668_100040320 3300005347 Bacteria 3573
88 Ga0070668_100051657 3300005347 Bacteria 3168
89 Ga0070668_100132104 3300005347 Bacteria 2004
90 Ga0070669_100000752 3300005353 Bacteria 23599
91 Ga0070669_100053914 3300005353 Bacteria 2944
92 Ga0070669_100100448 3300005353 Bacteria 2182
93 Ga0070675_100001728 3300005354 Bacteria 16125
94 Ga0070675_100003423 3300005354 Bacteria 12018
95 Ga0070675_100016857 3300005354 Bacteria 5803
96 Ga0070675_100048235 3300005354 Bacteria 3491
97 Ga0070675_100149831 3300005354 Bacteria 1999
98 Ga0070671_100000322 3300005355 Bacteria 32627
99 Ga0070671_100001874 3300005355 Bacteria 16076
100 Ga0070671_100011263 3300005355 Bacteria 7185
101 Ga0070671_100022292 3300005355 Bacteria 5172
102 Ga0070671_100027587 3300005355 Bacteria 4675
103 Ga0070671_100031306 3300005355 Bacteria 4394
104 Ga0070671_100033237 3300005355 Bacteria 4264
105 Ga0070671_100037717 3300005355 Bacteria 4009
106 Ga0070671_100058342 3300005355 Bacteria 3213
107 Ga0070671_100076246 3300005355 Bacteria 2801
108 Ga0070671_100078624 3300005355 Bacteria 2757
109 Ga0070674_100008524 3300005356 Bacteria 6111
110 Ga0070674_100009790 3300005356 Bacteria 5763
111 Ga0070674_100015477 3300005356 Bacteria 4762
112 Ga0070674_100033712 3300005356 Bacteria 3411
113 Ga0070674_100056597 3300005356 Bacteria 2720
114 Ga0070674_100084491 3300005356 Bacteria 2276
115 Ga0070673_100000145 3300005364 Bacteria 33646
116 Ga0070673_100000648 3300005364 Bacteria 19061
117 Ga0070673_100080660 3300005364 Bacteria 2637
118 Ga0070673_100182225 3300005364 Bacteria 1799
119 Ga0070659_100000138 3300005366 Bacteria 56073
120 Ga0070659_100000982 3300005366 Bacteria 20978
121 Ga0070659_100005079 3300005366 Bacteria 9434
122 Ga0070659_100044495 3300005366 Bacteria 3476
123 Ga0070659_100061943 3300005366 Bacteria 2957
124 Ga0070659_100093808 3300005366 Bacteria 2409
125 Ga0070659_100095885 3300005366 Bacteria 2382
126 Ga0070659_100115416 3300005366 Bacteria 2170
127 Ga0070659_100179375 3300005366 Bacteria 1737
128 Ga0070667_100004445 3300005367 Bacteria 11821
129 Ga0070667_100013165 3300005367 Bacteria 6838
130 Ga0070667_100024755 3300005367 Bacteria 4987
131 Ga0070667_100087481 3300005367 Bacteria 2674
132 Ga0070667_100137943 3300005367 Bacteria 2133
133 Ga0070667_100268413 3300005367 Bacteria 1529
134 Ga0070714_100005008 3300005435 Bacteria 10072
135 Ga0070714_100237089 3300005435 Bacteria 1683
136 Ga0070713_100285227 3300005436 Bacteria 1516
137 Ga0070694_100005589 3300005444 Bacteria 7621
138 Ga0070694_100069423 3300005444 Bacteria 2424
139 Ga0070663_100002302 3300005455 Bacteria 10722
140 Ga0070663_100010464 3300005455 Bacteria 5780
141 Ga0070663_100013265 3300005455 Bacteria 5247
142 Ga0070663_100044609 3300005455 Bacteria 3127
143 Ga0070663_100060180 3300005455 Bacteria 2731
144 Ga0070663_100061328 3300005455 Bacteria 2708
145 Ga0070663_100110272 3300005455 Bacteria 2067
146 Ga0070663_100111594 3300005455 Bacteria 2055
147 Ga0070663_100241680 3300005455 Bacteria 1425
148 Ga0070678_100001515 3300005456 Bacteria 12399
149 Ga0070678_100024057 3300005456 Bacteria 4070
150 Ga0070678_100223695 3300005456 Bacteria 1565
151 Ga0070662_100000034 3300005457 Bacteria 78070
152 Ga0070662_100000586 3300005457 Bacteria 22135
153 Ga0070662_100004865 3300005457 Bacteria 8519
154 Ga0070662_100010818 3300005457 Bacteria 6007
155 Ga0070662_100014132 3300005457 Bacteria 5327
156 Ga0070662_100018565 3300005457 Bacteria 4706
157 Ga0070662_100022273 3300005457 Bacteria 4335
158 Ga0070662_100025100 3300005457 Bacteria 4113
159 Ga0070662_100066522 3300005457 Bacteria 2644
160 Ga0070662_100084172 3300005457 Bacteria 2375
161 Ga0070662_100105859 3300005457 Bacteria 2136
162 Ga0070662_100116038 3300005457 Bacteria 2046
163 Ga0070662_100147321 3300005457 Bacteria 1830
164 Ga0070681_10155864 3300005458 Bacteria 2209
165 Ga0070681_10168304 3300005458 Bacteria 2114
166 Ga0070681_10189335 3300005458 Bacteria 1977
167 Ga0068867_100001195 3300005459 Bacteria 17808
168 Ga0068867_100032233 3300005459 Bacteria 3788
169 Ga0070679_100006786 3300005530 Bacteria 10677
170 Ga0070679_100095333 3300005530 Bacteria 2963
171 Ga0070679_100207703 3300005530 Bacteria 1922
172 Ga0070679_100215858 3300005530 Bacteria 1881
173 Ga0070679_100225170 3300005530 Bacteria 1836
174 Ga0070679_100229356 3300005530 Bacteria 1817
175 Ga0070684_100013978 3300005535 Bacteria 6489
176 Ga0070684_100014070 3300005535 Bacteria 6471
177 Ga0070684_100108458 3300005535 Bacteria 2488
178 Ga0070684_100165981 3300005535 Bacteria 2004
179 Ga0068853_100000470 3300005539 Bacteria 27505
180 Ga0068853_100001329 3300005539 Bacteria 17794
181 Ga0068853_100043335 3300005539 Bacteria 3849
182 Ga0068853_100056367 3300005539 Bacteria 3388
183 Ga0068853_100066802 3300005539 Bacteria 3123
184 Ga0068853_100257425 3300005539 Bacteria 1603
185 Ga0070672_100001962 3300005543 Bacteria 12901
186 Ga0070672_100002839 3300005543 Bacteria 11106
187 Ga0070672_100026460 3300005543 Bacteria 4317
188 Ga0070672_100026805 3300005543 Bacteria 4294
189 Ga0070672_100113478 3300005543 Bacteria 2212
190 Ga0070672_100159392 3300005543 Bacteria 1871
191 Ga0070686_100005958 3300005544 Bacteria 6758
192 Ga0070695_100076239 3300005545 Bacteria 2208
193 Ga0070695_100093298 3300005545 Bacteria 2014
194 Ga0070696_100127487 3300005546 Bacteria 1848
195 Ga0070693_100001471 3300005547 Bacteria 10606
196 Ga0070693_100004705 3300005547 Bacteria 6488
197 Ga0070693_100016055 3300005547 Bacteria 3868
198 Ga0070665_100006112 3300005548 Bacteria 12313
199 Ga0070665_100006985 3300005548 Bacteria 11473
200 Ga0070665_100013697 3300005548 Bacteria 8160
201 Ga0070665_100073597 3300005548 Bacteria 3422
202 Ga0070665_100112645 3300005548 Bacteria 2723
203 Ga0070704_100009106 3300005549 Bacteria 5991
204 Ga0068855_100000163 3300005563 Bacteria 85587
205 Ga0068855_100005215 3300005563 Bacteria 15851
206 Ga0068855_100018325 3300005563 Bacteria 8410
207 Ga0068855_100018458 3300005563 Bacteria 8382
208 Ga0068855_100023294 3300005563 Bacteria 7416
209 Ga0068855_100044931 3300005563 Bacteria 5225
210 Ga0068855_100055642 3300005563 Bacteria 4646
211 Ga0068855_100100332 3300005563 Bacteria 3334
212 Ga0070664_100000544 3300005564 Bacteria 28761
213 Ga0070664_100027011 3300005564 Bacteria 4768
214 Ga0070664_100040129 3300005564 Bacteria 3945
215 Ga0070664_100042960 3300005564 Bacteria 3813
216 Ga0070664_100055425 3300005564 Bacteria 3365
217 Ga0070664_100143150 3300005564 Bacteria 2107
218 Ga0070664_100238659 3300005564 Bacteria 1631
219 Ga0070664_100338699 3300005564 Bacteria 1366
220 Ga0068857_100001148 3300005577 Bacteria 20637
221 Ga0068857_100006801 3300005577 Bacteria 9844
222 Ga0068857_100030168 3300005577 Bacteria 4785
223 Ga0068857_100049879 3300005577 Bacteria 3713
224 Ga0068857_100061314 3300005577 Bacteria 3341
225 Ga0068857_100098362 3300005577 Bacteria 2624
226 Ga0068857_100144651 3300005577 Bacteria 2151
227 Ga0068857_100149631 3300005577 Bacteria 2114
228 Ga0068854_100000061 3300005578 Bacteria 78663
229 Ga0068854_100004256 3300005578 Bacteria 9013
230 Ga0068854_100009527 3300005578 Bacteria 6270
231 Ga0068854_100014552 3300005578 Bacteria 5190
232 Ga0068854_100023143 3300005578 Bacteria 4241
233 Ga0068854_100051866 3300005578 Bacteria 2940
234 Ga0068854_100132584 3300005578 Bacteria 1904
235 Ga0068854_100170830 3300005578 Bacteria 1692
236 Ga0068856_100001006 3300005614 Bacteria 30001
237 Ga0068856_100005334 3300005614 Bacteria 12686
238 Ga0068856_100051151 3300005614 Bacteria 4074
239 Ga0068856_100054245 3300005614 Bacteria 3953
240 Ga0068856_100091892 3300005614 Bacteria 3019
241 Ga0068856_100153914 3300005614 Bacteria 2309
242 Ga0068856_100236171 3300005614 Bacteria 1843
243 Ga0068852_100000288 3300005616 Bacteria 33771
244 Ga0068852_100000502 3300005616 Bacteria 25705
245 Ga0068852_100001393 3300005616 Bacteria 16266
246 Ga0068852_100003438 3300005616 Bacteria 11065
247 Ga0068852_100005965 3300005616 Bacteria 8772
248 Ga0068852_100033509 3300005616 Bacteria 4266
249 Ga0068852_100034505 3300005616 Bacteria 4210
250 Ga0068852_100053207 3300005616 Bacteria 3483
251 Ga0068852_100070631 3300005616 Bacteria 3064
252 Ga0068852_100084581 3300005616 Bacteria 2824
253 Ga0068859_100000778 3300005617 Bacteria 32222
254 Ga0068859_100006927 3300005617 Bacteria 11509
255 Ga0068859_100055150 3300005617 Bacteria 3999
256 Ga0068859_100058514 3300005617 Bacteria 3882
257 Ga0068859_100117088 3300005617 Bacteria 2729
258 Ga0068859_100159838 3300005617 Bacteria 2332
259 Ga0068864_100000795 3300005618 Bacteria 26479
260 Ga0068864_100004007 3300005618 Bacteria 12124
261 Ga0068864_100004624 3300005618 Bacteria 11288
262 Ga0068864_100025223 3300005618 Bacteria 5004
263 Ga0068864_100116874 3300005618 Bacteria 2380
264 Ga0068864_100187812 3300005618 Bacteria 1893
265 Ga0068864_100195506 3300005618 Bacteria 1856
266 Ga0068866_10006297 3300005718 Bacteria 4942
267 Ga0068851_10003515 3300005834 Bacteria 6970
268 Ga0068851_10014976 3300005834 Bacteria 3689
269 Ga0068851_10063918 3300005834 Bacteria 1890
270 Ga0068863_100000921 3300005841 Bacteria 29492
271 Ga0068863_100001605 3300005841 Bacteria 22350
272 Ga0068863_100016353 3300005841 Bacteria 7117
273 Ga0068863_100095330 3300005841 Bacteria 2824
274 Ga0068858_100002203 3300005842 Bacteria 19730
275 Ga0068858_100044220 3300005842 Bacteria 4129
276 Ga0068858_100056752 3300005842 Bacteria 3619
277 Ga0068858_100217016 3300005842 Bacteria 1811
278 Ga0068860_100001686 3300005843 Bacteria 23599
279 Ga0068860_100004579 3300005843 Bacteria 14114
280 Ga0068860_100030822 3300005843 Bacteria 5156
281 Ga0068860_100117249 3300005843 Bacteria 2547
282 Ga0068860_100311570 3300005843 Bacteria 1543
283 Ga0068862_100008684 3300005844 Bacteria 8406
284 Ga0068862_100116929 3300005844 Bacteria 2346
285 Ga0068862_100141871 3300005844 Bacteria 2133
286 Ga0068862_100156094 3300005844 Bacteria 2034
287 Ga0081539_10017913 3300005985 Bacteria 4943
288 Ga0070712_100036377 3300006175 Bacteria 3350
289 Ga0097621_100263660 3300006237 Bacteria 1512
290 Ga0068871_100033208 3300006358 Bacteria 4084
291 Ga0068871_100043797 3300006358 Bacteria 3596
292 Ga0075428_100003038 3300006844 Bacteria 18316
293 Ga0075428_100035786 3300006844 Bacteria 5473
294 Ga0075430_100000051 3300006846 Bacteria 61002
295 Ga0075430_100001778 3300006846 Bacteria 17614
296 Ga0075431_100001402 3300006847 Bacteria 22101
297 Ga0075431_100004328 3300006847 Bacteria 13911
298 Ga0075433_10004091 3300006852 Bacteria 11310
299 Ga0075433_10084909 3300006852 Bacteria 2795
300 Ga0075434_100038613 3300006871 Bacteria 4729
301 Ga0075429_100000587 3300006880 Bacteria 27992
302 Ga0068865_100006108 3300006881 Bacteria 7343
303 Ga0068865_100007421 3300006881 Bacteria 6747
304 Ga0068865_100050532 3300006881 Bacteria 2872
305 Ga0068865_100120223 3300006881 Bacteria 1952
306 Ga0097620_100000778 3300006931 Bacteria 32222
307 Ga0097620_100006927 3300006931 Bacteria 11509
308 Ga0097620_100055150 3300006931 Bacteria 3999
309 Ga0097620_100058512 3300006931 Bacteria 3882
310 Ga0097620_100117089 3300006931 Bacteria 2729
311 Ga0097620_100159839 3300006931 Bacteria 2332
312 Ga0075435_100035579 3300007076 Bacteria 3952
313 Ga0105240_10136953 3300009093 Bacteria 2931
314 Ga0111539_10043101 3300009094 Bacteria 5412
315 Ga0105245_10000326 3300009098 Bacteria 44899
316 Ga0105245_10009842 3300009098 Bacteria 8329
317 Ga0105247_10145959 3300009101 Bacteria 1555
318 Ga0114129_10003334 3300009147 Bacteria 22561
319 Ga0114129_10338243 3300009147 Bacteria 1997
320 Ga0105243_10023495 3300009148 Bacteria 4695
321 Ga0105243_10059854 3300009148 Bacteria 3041
322 Ga0105241_10033347 3300009174 Bacteria 3865
323 Ga0105241_10147963 3300009174 Bacteria 1918
324 Ga0105242_10377160 3300009176 Bacteria 1317
325 Ga0105248_10000159 3300009177 Bacteria 78504
326 Ga0105248_10008781 3300009177 Bacteria 11096
327 Ga0105248_10019159 3300009177 Bacteria 7570
328 Ga0105248_10071059 3300009177 Bacteria 3909
329 Ga0105248_10206710 3300009177 Bacteria 2212
330 Ga0105248_10539493 3300009177 Bacteria 1316
331 Ga0105237_10021454 3300009545 Bacteria 6640
332 Ga0105237_10092943 3300009545 Bacteria 3006
333 Ga0105238_10030087 3300009551 Bacteria 5526
334 Ga0105238_10152582 3300009551 Bacteria 2285
335 Ga0105249_10008541 3300009553 Bacteria 8928
336 Ga0105239_10020658 3300010375 Bacteria 7265
337 Ga0105239_10056048 3300010375 Bacteria 4323
338 Ga0105239_10188401 3300010375 Bacteria 2309
339 Ga0105246_10058328 3300011119 Bacteria 2674
340 Ga0157373_10002218 3300013100 Bacteria 14697
341 Ga0157373_10002590 3300013100 Bacteria 13733
342 Ga0157373_10013488 3300013100 Bacteria 5994
343 Ga0157373_10022296 3300013100 Bacteria 4595
344 Ga0157373_10033010 3300013100 Bacteria 3726
345 Ga0157373_10063464 3300013100 Bacteria 2615
346 Ga0157371_10001589 3300013102 Bacteria 23310
347 Ga0157371_10025211 3300013102 Bacteria 4335
348 Ga0157371_10065197 3300013102 Bacteria 2579
349 Ga0157371_10104530 3300013102 Bacteria 2010
350 Ga0157370_10020584 3300013104 Bacteria 6586
351 Ga0157370_10025173 3300013104 Bacteria 5891
352 Ga0157370_10027636 3300013104 Bacteria 5593
353 Ga0157370_10090908 3300013104 Bacteria 2866
354 Ga0157370_10317414 3300013104 Bacteria 1438
355 Ga0157369_10001821 3300013105 Bacteria 25788
356 Ga0157369_10068122 3300013105 Bacteria 3824
357 Ga0157369_10129558 3300013105 Bacteria 2674
358 Ga0157374_10003309 3300013296 Bacteria 13538
359 Ga0157378_10002474 3300013297 Bacteria 16436
360 Ga0157378_10249728 3300013297 Bacteria 1698
361 Ga0163162_10000839 3300013306 Bacteria 28555
362 Ga0163162_10016620 3300013306 Bacteria 7190
363 Ga0163162_10131605 3300013306 Bacteria 2610
364 Ga0163162_10134720 3300013306 Bacteria 2581
365 Ga0163162_10250401 3300013306 Bacteria 1903
366 Ga0163162_10304817 3300013306 Bacteria 1725
367 Ga0157372_10148357 3300013307 Bacteria 2705
368 Ga0157372_10282826 3300013307 Bacteria 1929
369 Ga0157375_10002246 3300013308 Bacteria 16691
370 Ga0157375_10110275 3300013308 Bacteria 2849
371 Ga0163163_10000338 3300014325 Bacteria 45226
372 Ga0163163_10061718 3300014325 Bacteria 3714
373 Ga0157380_10003748 3300014326 Bacteria 10454
374 Ga0157380_10012637 3300014326 Bacteria 6128
375 Ga0157380_10035058 3300014326 Bacteria 3874
376 Ga0157380_10046903 3300014326 Bacteria 3396
377 Ga0157379_10017162 3300014968 Bacteria 6376
378 Ga0157379_10064317 3300014968 Bacteria 3278
379 Ga0157376_10148706 3300014969 Bacteria 2110
380 Ga0163161_10038874 3300017792 Bacteria 3414
381 Ga0163161_10072139 3300017792 Bacteria 2528
382 Ga0163161_10136466 3300017792 Bacteria 1855
383 Ga0206354_11145685 3300020081 Bacteria 1761
384 Ga0206353_10127208 3300020082 Bacteria 3387
385 Ga0207697_10000664 3300025315 Bacteria 19543
386 Ga0207697_10009612 3300025315 Bacteria 4168
387 Ga0207697_10022713 3300025315 Bacteria 2569
388 Ga0207656_10002673 3300025321 Bacteria 6041
389 Ga0207682_10019136 3300025893 Bacteria 2680
390 Ga0207688_10000730 3300025901 Bacteria 16298
391 Ga0207688_10003567 3300025901 Bacteria 8492
392 Ga0207688_10084428 3300025901 Bacteria 1818
393 Ga0207688_10139543 3300025901 Bacteria 1426
394 Ga0207680_10001430 3300025903 Bacteria 11319
395 Ga0207680_10012172 3300025903 Bacteria 4376
396 Ga0207680_10013220 3300025903 Bacteria 4233
397 Ga0207680_10019376 3300025903 Bacteria 3637
398 Ga0207647_10000232 3300025904 Bacteria 46114
399 Ga0207647_10001671 3300025904 Bacteria 17080
400 Ga0207647_10002581 3300025904 Bacteria 13711
401 Ga0207647_10006556 3300025904 Bacteria 8456
402 Ga0207647_10014490 3300025904 Bacteria 5434
403 Ga0207647_10050037 3300025904 Bacteria 2589
404 Ga0207699_10015306 3300025906 Bacteria 3981
405 Ga0207645_10000418 3300025907 Bacteria 35293
406 Ga0207645_10015378 3300025907 Bacteria 5086
407 Ga0207645_10026959 3300025907 Bacteria 3712
408 Ga0207645_10078126 3300025907 Bacteria 2121
409 Ga0207645_10122381 3300025907 Bacteria 1689
410 Ga0207643_10033452 3300025908 Bacteria 2876
411 Ga0207705_10000260 3300025909 Bacteria 51366
412 Ga0207705_10001202 3300025909 Bacteria 21004
413 Ga0207705_10001212 3300025909 Bacteria 20900
414 Ga0207705_10002824 3300025909 Bacteria 13284
415 Ga0207705_10017643 3300025909 Bacteria 5108
416 Ga0207705_10028556 3300025909 Bacteria 3977
417 Ga0207705_10058310 3300025909 Bacteria 2786
418 Ga0207654_10138858 3300025911 Bacteria 1547
419 Ga0207707_10024583 3300025912 Bacteria 5272
420 Ga0207707_10060102 3300025912 Bacteria 3306
421 Ga0207707_10109491 3300025912 Bacteria 2415
422 Ga0207707_10261972 3300025912 Bacteria 1500
423 Ga0207695_10293876 3300025913 Bacteria 1517
424 Ga0207671_10020914 3300025914 Bacteria 4975
425 Ga0207671_10028185 3300025914 Bacteria 4198
426 Ga0207660_10000428 3300025917 Bacteria 27695
427 Ga0207660_10004722 3300025917 Bacteria 8872
428 Ga0207660_10006807 3300025917 Bacteria 7406
429 Ga0207660_10007440 3300025917 Bacteria 7086
430 Ga0207660_10014482 3300025917 Bacteria 5188
431 Ga0207657_10000031 3300025919 Bacteria 132167
432 Ga0207657_10001025 3300025919 Bacteria 29642
433 Ga0207657_10002385 3300025919 Bacteria 20327
434 Ga0207657_10002400 3300025919 Bacteria 20254
435 Ga0207657_10006951 3300025919 Bacteria 11662
436 Ga0207657_10007667 3300025919 Bacteria 11042
437 Ga0207657_10014192 3300025919 Bacteria 7789
438 Ga0207657_10026790 3300025919 Bacteria 5289
439 Ga0207657_10028941 3300025919 Bacteria 5047
440 Ga0207657_10057554 3300025919 Bacteria 3350
441 Ga0207657_10065289 3300025919 Bacteria 3103
442 Ga0207649_10000148 3300025920 Bacteria 57865
443 Ga0207649_10003558 3300025920 Bacteria 8509
444 Ga0207649_10005898 3300025920 Bacteria 6642
445 Ga0207649_10021412 3300025920 Bacteria 3722
446 Ga0207649_10021728 3300025920 Bacteria 3699
447 Ga0207649_10027624 3300025920 Bacteria 3332
448 Ga0207649_10082091 3300025920 Bacteria 2089
449 Ga0207649_10104801 3300025920 Bacteria 1878
450 Ga0207649_10126366 3300025920 Bacteria 1731
451 Ga0207652_10007304 3300025921 Bacteria 8901
452 Ga0207652_10019490 3300025921 Bacteria 5579
453 Ga0207652_10118836 3300025921 Bacteria 2350
454 Ga0207652_10187576 3300025921 Bacteria 1859
455 Ga0207681_10001054 3300025923 Bacteria 17872
456 Ga0207681_10014078 3300025923 Bacteria 4960
457 Ga0207681_10046640 3300025923 Bacteria 2915
458 Ga0207681_10052396 3300025923 Bacteria 2767
459 Ga0207694_10000526 3300025924 Bacteria 34586
460 Ga0207650_10010360 3300025925 Bacteria 6391
461 Ga0207650_10054625 3300025925 Bacteria 2963
462 Ga0207650_10080742 3300025925 Bacteria 2466
463 Ga0207650_10114582 3300025925 Bacteria 2091
464 Ga0207650_10277162 3300025925 Unclassified 1365
465 Ga0207659_10002591 3300025926 Bacteria 10766
466 Ga0207659_10041692 3300025926 Bacteria 3215
467 Ga0207659_10053944 3300025926 Bacteria 2869
468 Ga0207687_10011622 3300025927 Bacteria 5754
469 Ga0207687_10072944 3300025927 Bacteria 2457
470 Ga0207700_10079890 3300025928 Bacteria 2548
471 Ga0207700_10084051 3300025928 Bacteria 2494
472 Ga0207664_10053292 3300025929 Bacteria 3201
473 Ga0207664_10085865 3300025929 Bacteria 2569
474 Ga0207664_10108152 3300025929 Bacteria 2308
475 Ga0207664_10125595 3300025929 Bacteria 2153
476 Ga0207644_10003944 3300025931 Bacteria 9625
477 Ga0207644_10007023 3300025931 Bacteria 7332
478 Ga0207644_10010565 3300025931 Bacteria 6086
479 Ga0207644_10011535 3300025931 Bacteria 5850
480 Ga0207644_10014161 3300025931 Bacteria 5334
481 Ga0207644_10019388 3300025931 Bacteria 4614
482 Ga0207644_10024679 3300025931 Bacteria 4129
483 Ga0207644_10025193 3300025931 Bacteria 4089
484 Ga0207644_10038199 3300025931 Bacteria 3381
485 Ga0207644_10129143 3300025931 Bacteria 1932
486 Ga0207644_10130884 3300025931 Bacteria 1920
487 Ga0207690_10000185 3300025932 Bacteria 47899
488 Ga0207690_10005791 3300025932 Bacteria 7309
489 Ga0207690_10006190 3300025932 Bacteria 7088
490 Ga0207690_10013540 3300025932 Bacteria 4902
491 Ga0207690_10018913 3300025932 Bacteria 4230
492 Ga0207690_10041251 3300025932 Bacteria 3023
493 Ga0207690_10042100 3300025932 Bacteria 2997
494 Ga0207690_10044325 3300025932 Bacteria 2932
495 Ga0207690_10056195 3300025932 Bacteria 2654
496 Ga0207690_10059623 3300025932 Bacteria 2586
497 Ga0207690_10062785 3300025932 Bacteria 2531
498 Ga0207690_10090443 3300025932 Bacteria 2161
499 Ga0207706_10000028 3300025933 Bacteria 149092
500 Ga0207706_10000171 3300025933 Bacteria 72122
501 Ga0207706_10000285 3300025933 Bacteria 55179
502 Ga0207706_10001955 3300025933 Bacteria 20220
503 Ga0207706_10004522 3300025933 Bacteria 13061
504 Ga0207706_10010342 3300025933 Bacteria 8529
505 Ga0207706_10010714 3300025933 Bacteria 8374
506 Ga0207706_10048133 3300025933 Bacteria 3771
507 Ga0207706_10058189 3300025933 Bacteria 3405
508 Ga0207706_10063787 3300025933 Bacteria 3243
509 Ga0207706_10067453 3300025933 Bacteria 3147
510 Ga0207706_10069464 3300025933 Bacteria 3099
511 Ga0207706_10093706 3300025933 Bacteria 2641
512 Ga0207706_10119175 3300025933 Bacteria 2320
513 Ga0207706_10145074 3300025933 Bacteria 2088
514 Ga0207706_10147728 3300025933 Bacteria 2068
515 Ga0207669_10005747 3300025937 Bacteria 5598
516 Ga0207669_10007663 3300025937 Bacteria 5014
517 Ga0207669_10007970 3300025937 Bacteria 4943
518 Ga0207669_10008080 3300025937 Bacteria 4922
519 Ga0207704_10008679 3300025938 Bacteria 4873
520 Ga0207704_10019395 3300025938 Bacteria 3571
521 Ga0207704_10388205 3300025938 Bacteria 1098
522 Ga0207691_10001864 3300025940 Bacteria 20610
523 Ga0207691_10002244 3300025940 Bacteria 18938
524 Ga0207691_10019764 3300025940 Bacteria 6370
525 Ga0207691_10037523 3300025940 Bacteria 4487
526 Ga0207691_10058360 3300025940 Bacteria 3510
527 Ga0207691_10216903 3300025940 Bacteria 1660
528 Ga0207711_10000829 3300025941 Bacteria 30054
529 Ga0207711_10002458 3300025941 Bacteria 16528
530 Ga0207711_10009134 3300025941 Bacteria 8280
531 Ga0207711_10017453 3300025941 Bacteria 5963
532 Ga0207711_10032851 3300025941 Bacteria 4389
533 Ga0207711_10095490 3300025941 Bacteria 2622
534 Ga0207711_10191705 3300025941 Bacteria 1863
535 Ga0207689_10000092 3300025942 Bacteria 73254
536 Ga0207689_10147210 3300025942 Bacteria 1940
537 Ga0207661_10000261 3300025944 Bacteria 33999
538 Ga0207661_10008508 3300025944 Bacteria 7334
539 Ga0207661_10020152 3300025944 Bacteria 4980
540 Ga0207661_10041737 3300025944 Bacteria 3613
541 Ga0207661_10198087 3300025944 Bacteria 1764
542 Ga0207679_10000129 3300025945 Bacteria 61477
543 Ga0207679_10006872 3300025945 Bacteria 7212
544 Ga0207679_10010870 3300025945 Bacteria 5869
545 Ga0207679_10061703 3300025945 Bacteria 2791
546 Ga0207679_10145769 3300025945 Bacteria 1920
547 Ga0207679_10294465 3300025945 Bacteria 1396
548 Ga0207679_10349071 3300025945 Bacteria 1289
549 Ga0207667_10000357 3300025949 Bacteria 62034
550 Ga0207667_10005746 3300025949 Bacteria 15140
551 Ga0207667_10013242 3300025949 Bacteria 9456
552 Ga0207667_10016701 3300025949 Bacteria 8283
553 Ga0207667_10018799 3300025949 Bacteria 7737
554 Ga0207667_10039899 3300025949 Bacteria 5000
555 Ga0207667_10045671 3300025949 Bacteria 4638
556 Ga0207667_10111587 3300025949 Bacteria 2820
557 Ga0207667_10125740 3300025949 Bacteria 2641
558 Ga0207667_10128750 3300025949 Bacteria 2607
559 Ga0207667_10507129 3300025949 Bacteria 1223
560 Ga0207651_10000521 3300025960 Bacteria 16209
561 Ga0207651_10001044 3300025960 Bacteria 12264
562 Ga0207651_10005094 3300025960 Bacteria 6709
563 Ga0207651_10066663 3300025960 Bacteria 2530
564 Ga0207712_10000269 3300025961 Bacteria 50416
565 Ga0207668_10000080 3300025972 Bacteria 72198
566 Ga0207668_10010968 3300025972 Bacteria 5493
567 Ga0207668_10037769 3300025972 Bacteria 3235
568 Ga0207668_10169808 3300025972 Bacteria 1709
569 Ga0207640_10012200 3300025981 Bacteria 4889
570 Ga0207640_10014993 3300025981 Bacteria 4475
571 Ga0207640_10016048 3300025981 Bacteria 4348
572 Ga0207640_10031129 3300025981 Bacteria 3293
573 Ga0207640_10045081 3300025981 Bacteria 2830
574 Ga0207640_10058906 3300025981 Bacteria 2532
575 Ga0207640_10102231 3300025981 Bacteria 2013
576 Ga0207658_10002199 3300025986 Bacteria 14477
577 Ga0207658_10036886 3300025986 Bacteria 3507
578 Ga0207658_10174007 3300025986 Bacteria 1776
579 Ga0207677_10114933 3300026023 Bacteria 2012
580 Ga0207677_10143164 3300026023 Bacteria 1834
581 Ga0207703_10002403 3300026035 Bacteria 16272
582 Ga0207703_10076330 3300026035 Bacteria 2779
583 Ga0207639_10000131 3300026041 Bacteria 54681
584 Ga0207639_10002585 3300026041 Bacteria 12151
585 Ga0207639_10007251 3300026041 Bacteria 7555
586 Ga0207639_10030514 3300026041 Bacteria 3953
587 Ga0207639_10113682 3300026041 Bacteria 2211
588 Ga0207678_10000198 3300026067 Bacteria 52573
589 Ga0207678_10000385 3300026067 Bacteria 40115
590 Ga0207678_10000732 3300026067 Bacteria 30036
591 Ga0207678_10001415 3300026067 Bacteria 21990
592 Ga0207678_10001794 3300026067 Bacteria 19668
593 Ga0207678_10100554 3300026067 Bacteria 2470
594 Ga0207678_10118315 3300026067 Bacteria 2261
595 Ga0207702_10000247 3300026078 Bacteria 62873
596 Ga0207702_10008747 3300026078 Bacteria 8536
597 Ga0207702_10015384 3300026078 Bacteria 6341
598 Ga0207702_10015948 3300026078 Bacteria 6221
599 Ga0207702_10057919 3300026078 Bacteria 3295
600 Ga0207702_10295773 3300026078 Bacteria 1535
601 Ga0207702_10369139 3300026078 Bacteria 1377
602 Ga0207641_10002549 3300026088 Bacteria 16763
603 Ga0207641_10038269 3300026088 Bacteria 4010
604 Ga0207641_10074536 3300026088 Bacteria 2927
605 Ga0207641_10248900 3300026088 Bacteria 1659
606 Ga0207641_10282634 3300026088 Bacteria 1561
607 Ga0207648_10000317 3300026089 Bacteria 52853
608 Ga0207648_10007723 3300026089 Bacteria 10512
609 Ga0207676_10000908 3300026095 Bacteria 22927
610 Ga0207676_10001355 3300026095 Bacteria 18216
611 Ga0207676_10020931 3300026095 Bacteria 4793
612 Ga0207676_10022076 3300026095 Bacteria 4678
613 Ga0207676_10030692 3300026095 Bacteria 4036
614 Ga0207676_10061608 3300026095 Bacteria 2971
615 Ga0207676_10134492 3300026095 Bacteria 2107
616 Ga0207674_10000289 3300026116 Bacteria 63604
617 Ga0207674_10002023 3300026116 Bacteria 25726
618 Ga0207674_10012074 3300026116 Bacteria 9675
619 Ga0207674_10019458 3300026116 Bacteria 7352
620 Ga0207674_10021794 3300026116 Bacteria 6896
621 Ga0207674_10025013 3300026116 Bacteria 6373
622 Ga0207674_10041598 3300026116 Bacteria 4751
623 Ga0207674_10061115 3300026116 Bacteria 3807
624 Ga0207683_10001680 3300026121 Bacteria 19810
625 Ga0207683_10040385 3300026121 Bacteria 4072
626 Ga0207698_10000125 3300026142 Bacteria 48032
627 Ga0207698_10002361 3300026142 Bacteria 11191
628 Ga0207698_10002697 3300026142 Bacteria 10570
629 Ga0207698_10003972 3300026142 Bacteria 8964
630 Ga0207698_10007716 3300026142 Bacteria 6752
631 Ga0207698_10019393 3300026142 Bacteria 4655
632 Ga0207698_10044264 3300026142 Bacteria 3343
633 Ga0207698_10147579 3300026142 Bacteria 2036
634 Ga0207698_10212865 3300026142 Bacteria 1740
635 Ga0268266_10000433 3300028379 Bacteria 62887
636 Ga0268266_10004212 3300028379 Bacteria 13847
637 Ga0268266_10005862 3300028379 Bacteria 11370
638 Ga0268266_10023589 3300028379 Bacteria 5237
639 Ga0268266_10023805 3300028379 Bacteria 5212
640 Ga0268266_10047507 3300028379 Bacteria 3678
641 Ga0268265_10075874 3300028380 Bacteria 2635
642 Ga0268265_10078944 3300028380 Bacteria 2590
643 Ga0268265_10083031 3300028380 Bacteria 2535
644 Ga0268264_10010718 3300028381 Bacteria 7573
645 Ga0268264_10017640 3300028381 Bacteria 5845
646 Ga0268264_10048046 3300028381 Bacteria 3549
647 Ga0268264_10305030 3300028381 Bacteria 1500
648 Ga0307408_100027036 3300031548 Bacteria 3950
649 Ga0307408_100189580 3300031548 Bacteria 1655
650 Ga0307408_100197536 3300031548 Bacteria 1625
651 Ga0307405_10031957 3300031731 Bacteria 3105
652 Ga0307405_10033665 3300031731 Bacteria 3042
653 Ga0307405_10114906 3300031731 Bacteria 1830
654 Ga0307405_10321536 3300031731 Bacteria 1182
655 Ga0307413_10013794 3300031824 Bacteria 4079
656 Ga0307410_10007253 3300031852 Bacteria 6055
657 Ga0307410_10013692 3300031852 Bacteria 4743
658 Ga0307410_10023600 3300031852 Bacteria 3827
659 Ga0307410_10026779 3300031852 Bacteria 3634
660 Ga0307410_10055893 3300031852 Bacteria 2681
661 Ga0307406_10016813 3300031901 Bacteria 4256
662 Ga0307406_10057918 3300031901 Bacteria 2487
663 Ga0307406_10211311 3300031901 Bacteria 1435
664 Ga0307406_10294758 3300031901 Bacteria 1243
665 Ga0307407_10034555 3300031903 Bacteria 2769
666 Ga0307407_10050287 3300031903 Bacteria 2384
667 Ga0307407_10062771 3300031903 Bacteria 2177
668 Ga0307407_10093148 3300031903 Bacteria 1852
669 Ga0307407_10147471 3300031903 Bacteria 1525
670 Ga0307407_10204211 3300031903 Bacteria 1326
671 Ga0307412_10023898 3300031911 Bacteria 3767
672 Ga0307412_10175236 3300031911 Bacteria 1607
673 Ga0307409_100011712 3300031995 Bacteria 5547
674 Ga0307409_100022838 3300031995 Bacteria 4319
675 Ga0307409_100039663 3300031995 Bacteria 3497
676 Ga0307409_100052322 3300031995 Bacteria 3130
677 Ga0307409_100064658 3300031995 Bacteria 2875
678 Ga0307409_100162037 3300031995 Bacteria 1957
679 Ga0307409_100268647 3300031995 Bacteria 1569
680 Ga0307416_100006841 3300032002 Bacteria 7176
681 Ga0307416_100009490 3300032002 Bacteria 6374
682 Ga0307416_100013849 3300032002 Bacteria 5497
683 Ga0307416_100031747 3300032002 Bacteria 3980
684 Ga0307416_100041366 3300032002 Bacteria 3589
685 Ga0307416_100047800 3300032002 Bacteria 3390
686 Ga0307416_100055853 3300032002 Bacteria 3182
687 Ga0307416_100093250 3300032002 Bacteria 2593
688 Ga0307416_100124402 3300032002 Bacteria 2307
689 Ga0307416_100181069 3300032002 Bacteria 1975
690 Ga0307416_100249778 3300032002 Bacteria 1725
691 Ga0307414_10002384 3300032004 Bacteria 9827
692 Ga0307414_10012920 3300032004 Bacteria 4957
693 Ga0307414_10013759 3300032004 Bacteria 4826
694 Ga0307414_10095759 3300032004 Bacteria 2219
695 Ga0307414_10141089 3300032004 Bacteria 1886
696 Ga0307414_10184258 3300032004 Bacteria 1682
697 Ga0307414_10324239 3300032004 Bacteria 1312
698 Ga0307411_10001217 3300032005 Bacteria 10213
699 Ga0307411_10003270 3300032005 Bacteria 7480
700 Ga0307411_10014798 3300032005 Bacteria 4356
701 Ga0307411_10033889 3300032005 Bacteria 3171
702 Ga0307411_10041638 3300032005 Bacteria 2924
703 Ga0307411_10053936 3300032005 Bacteria 2637
704 Ga0307411_10086775 3300032005 Bacteria 2172
705 Ga0307411_10111128 3300032005 Bacteria 1961
706 Ga0307411_10114986 3300032005 Bacteria 1934
707 Ga0307411_10117370 3300032005 Bacteria 1917
708 Ga0307411_10161588 3300032005 Bacteria 1678
709 Ga0307411_10200955 3300032005 Bacteria 1530
710 Ga0307415_100007011 3300032126 Bacteria 6128
711 Ga0307415_100028455 3300032126 Bacteria 3556
712 Ga0307415_100036008 3300032126 Bacteria 3239
713 Ga0373941_0011627 3300035115 Bacteria 2279
714 Ga0373943_0080471 3300035170 Bacteria 1670
715 Ga0373946_0007177 3300035171 Bacteria 4070
716 Ga0373931_0006642 3300035691 Bacteria 5418
717 Ga0373931_0032214 3300035691 Bacteria 2711
718 Ga0373935_0007020 3300035692 Bacteria 6722
719 Ga0373937_0009398 3300036401 Bacteria 8497
720 Ga0373925_0007643 3300037068 Bacteria 7874
721 Ga0395899_0000881 3300037312 Bacteria 28514
722 Ga0395899_0005689 3300037312 Bacteria 9678
723 Ga0395899_0014823 3300037312 Bacteria 5949
724 Ga0395899_0016947 3300037312 Bacteria 5553
725 Ga0395899_0034965 3300037312 Bacteria 3773
726 Ga0395899_0074895 3300037312 Bacteria 2472
727 Ga0395899_0141920 3300037312 Bacteria 1708
728 Ga0395899_0149653 3300037312 Bacteria 1655
729 Ga0395899_0171647 3300037312 Bacteria 1527
730 Ga0395899_0191839 3300037312 Bacteria 1429
731 Ga0395900_0000564 3300037418 Bacteria 51387
732 Ga0395900_0005731 3300037418 Bacteria 12985
733 Ga0395900_0012280 3300037418 Bacteria 8759
734 Ga0395900_0020262 3300037418 Bacteria 6787
735 Ga0395900_0022463 3300037418 Bacteria 6452
736 Ga0395900_0027265 3300037418 Bacteria 5849
737 Ga0395900_0030897 3300037418 Bacteria 5501
738 Ga0395900_0034408 3300037418 Bacteria 5217
739 Ga0395900_0035752 3300037418 Bacteria 5118
740 Ga0395900_0067301 3300037418 Bacteria 3680
741 Ga0395900_0094506 3300037418 Bacteria 3071
742 Ga0395900_0094958 3300037418 Bacteria 3063
743 Ga0395900_0129626 3300037418 Bacteria 2585
744 Ga0395900_0133684 3300037418 Bacteria 2541
745 Ga0395900_0133930 3300037418 Bacteria 2538
746 Ga0395900_0180632 3300037418 Bacteria 2144
747 Ga0395900_0186192 3300037418 Bacteria 2107
748 Ga0395900_0309377 3300037418 Bacteria 1563
749 Ga0395900_0381093 3300037418 Bacteria 1378
750 Ga0395900_0518421 3300037418 Bacteria 1140
751 Ga0395898_0000941 3300037466 Bacteria 46344
752 Ga0395898_0003841 3300037466 Bacteria 16653
753 Ga0395898_0006833 3300037466 Bacteria 12135
754 Ga0395898_0022292 3300037466 Bacteria 6414
755 Ga0395898_0022488 3300037466 Bacteria 6385
756 Ga0395898_0081950 3300037466 Bacteria 3110
757 Ga0395898_0118217 3300037466 Bacteria 2539
758 Ga0395898_0122808 3300037466 Bacteria 2488
759 Ga0395898_0165616 3300037466 Bacteria 2114
760 Ga0395898_0244811 3300037466 Bacteria 1710
761 Ga0395898_0274615 3300037466 Bacteria 1607
762 Ga0395898_0402549 3300037466 Bacteria 1305
763 Ga0395898_0409016 3300037466 Bacteria 1293
764 Ga0395898_0416532 3300037466 Bacteria 1280
765 Ga0395905_0000104 3300037471 Bacteria 141965
766 Ga0395905_0000926 3300037471 Bacteria 37874
767 Ga0395905_0002062 3300037471 Bacteria 22902
768 Ga0395905_0004632 3300037471 Bacteria 14224
769 Ga0395905_0004757 3300037471 Bacteria 14031
770 Ga0395905_0007779 3300037471 Bacteria 10629
771 Ga0395905_0008521 3300037471 Bacteria 10110
772 Ga0395905_0013490 3300037471 Bacteria 7829
773 Ga0395905_0020376 3300037471 Bacteria 6282
774 Ga0395905_0031926 3300037471 Bacteria 4954
775 Ga0395905_0033983 3300037471 Bacteria 4790
776 Ga0395905_0036765 3300037471 Bacteria 4600
777 Ga0395905_0042133 3300037471 Bacteria 4283
778 Ga0395905_0057881 3300037471 Bacteria 3625
779 Ga0395905_0103487 3300037471 Bacteria 2673
780 Ga0395905_0109731 3300037471 Bacteria 2590
781 Ga0395905_0112860 3300037471 Bacteria 2553
782 Ga0395905_0116009 3300037471 Bacteria 2516
783 Ga0395905_0122546 3300037471 Bacteria 2444
784 Ga0395905_0127249 3300037471 Bacteria 2395
785 Ga0395905_0147118 3300037471 Bacteria 2216
786 Ga0395905_0183164 3300037471 Bacteria 1966
787 Ga0395901_0000276 3300038443 Bacteria 63580
788 Ga0395901_0001094 3300038443 Bacteria 28836
789 Ga0395901_0001229 3300038443 Bacteria 27314
790 Ga0395901_0001482 3300038443 Bacteria 24416
791 Ga0395901_0006023 3300038443 Bacteria 12287
792 Ga0395901_0026549 3300038443 Bacteria 5947
793 Ga0395901_0029685 3300038443 Bacteria 5630
794 Ga0395901_0039088 3300038443 Bacteria 4909
795 Ga0395901_0040400 3300038443 Bacteria 4831
796 Ga0395901_0044924 3300038443 Bacteria 4583
797 Ga0395901_0048158 3300038443 Bacteria 4426
798 Ga0395901_0065389 3300038443 Bacteria 3786
799 Ga0395901_0134340 3300038443 Bacteria 2600
800 Ga0395901_0200020 3300038443 Bacteria 2094
801 Ga0395901_0278762 3300038443 Bacteria 1737
802 Ga0395901_0293880 3300038443 Bacteria 1685
803 Ga0395901_0385160 3300038443 Bacteria 1442
804 Ga0436365_0970995 3300039437 Bacteria 5728
805 Ga0439448_0013952 3300042005 Bacteria 2420
806 Ga0439432_014402 3300042006 Bacteria 2677
807 Ga0439432_016998 3300042006 Bacteria 2444
808 Ga0439449_0063145 3300042007 Bacteria 1367
809 Ga0439452_024182 3300042010 Bacteria 1556
810 Ga0439464_0001906 3300042439 Bacteria 5040
811 Ga0466969_0005422 3300044656 Bacteria 6782
812 Ga0466969_0023182 3300044656 Bacteria 3199
813 Ga0466966_0000004 3300044684 Bacteria 223594
814 Ga0466966_0010501 3300044684 Bacteria 6153
815 Ga0466966_0019739 3300044684 Bacteria 4434
816 Ga0466966_0042876 3300044684 Bacteria 2902
817 Ga0466961_0010917 3300044693 Bacteria 5802
818 Ga0466961_0015585 3300044693 Bacteria 4877
819 Ga0466961_0027095 3300044693 Bacteria 3684
820 Ga0466961_0045613 3300044693 Bacteria 2804
821 Ga0466961_0105574 3300044693 Bacteria 1773
822 Ga0466963_0001967 3300044694 Bacteria 11280
823 Ga0466963_0016274 3300044694 Bacteria 4622
824 Ga0466963_0026962 3300044694 Bacteria 3675
825 Ga0466963_0077383 3300044694 Bacteria 2247
826 Ga0466971_0001327 3300044719 Bacteria 10342
827 Ga0466971_0002026 3300044719 Bacteria 8579
828 Ga0466970_0015736 3300044765 Bacteria 3894
829 Ga0466970_0040285 3300044765 Bacteria 2481
830 Ga0466970_0046496 3300044765 Bacteria 2312
831 Ga0466970_0096670 3300044765 Bacteria 1606
832 Ga0466957_0004237 3300044842 Bacteria 7953
833 Ga0466957_0014050 3300044842 Bacteria 4657
834 Ga0466957_0016598 3300044842 Bacteria 4306
835 Ga0466957_0035470 3300044842 Bacteria 2993
836 Ga0466959_0017246 3300045049 Bacteria 5290
837 Ga0466959_0035546 3300045049 Bacteria 3684
838 Ga0466959_0116506 3300045049 Bacteria 1902
839 Ga0466958_0001495 3300045836 Bacteria 11169
840 Ga0466958_0026679 3300045836 Bacteria 3415
841 Ga0466958_0096860 3300045836 Bacteria 1830
842 Ga0466967_0011537 3300045976 Bacteria 6702
843 Ga0466967_0011679 3300045976 Bacteria 6673
844 Ga0466967_0059273 3300045976 Bacteria 3388
845 Ga0466967_0074735 3300045976 Bacteria 3044
846 Ga0466967_0077302 3300045976 Bacteria 2996
847 Ga0466967_0137134 3300045976 Bacteria 2276
848 Ga0466967_0388264 3300045976 Bacteria 1356
849 Ga0495629_0180772 3300046459 Bacteria 1462
850 Ga0495663_0002774 3300046525 Bacteria 5184
851 Ga0495663_0039928 3300046525 Bacteria 1423
852 Ga0495598_0000608 3300046537 Bacteria 6771
853 Ga0495621_0000022 3300046539 Bacteria 28970
854 Ga0495621_0000916 3300046539 Bacteria 7490
855 Ga0495621_0020264 3300046539 Bacteria 2180
856 Ga0495668_0010329 3300046616 Bacteria 5656
857 Ga0495668_0090708 3300046616 Bacteria 1674
858 Ga0495659_0005488 3300046664 Bacteria 3989
859 Ga0495659_0006947 3300046664 Bacteria 3583
860 Ga0495623_0036479 3300046679 Bacteria 3149
861 Ga0495669_0000720 3300046684 Bacteria 14382
862 Ga0495669_0014285 3300046684 Bacteria 3395
863 Ga0495669_0036191 3300046684 Bacteria 2182
864 Ga0495602_0121921 3300048088 Bacteria 2096
865 Ga0496100_0133010 3300048903 Bacteria 1754
866 Ga0496101_0030190 3300048904 Bacteria 3798
867 Ga0496101_0091714 3300048904 Bacteria 2261
868 Ga0496102_0011422 3300048905 Bacteria 7656
869 Ga0496102_0021292 3300048905 Bacteria 5734
870 Ga0496102_0324649 3300048905 Bacteria 1450
871 Ga0496103_0106096 3300048906 Bacteria 1782
872 Ga0496104_0092125 3300048907 Bacteria 2898
873 Ga0496105_0050426 3300048908 Bacteria 3438
874 Ga0496106_0186524 3300048909 Bacteria 1648
875 Ga0496107_0019286 3300048910 Bacteria 4812
876 Ga0496107_0025147 3300048910 Bacteria 4214
877 Ga0496107_0032250 3300048910 Bacteria 3743
878 Ga0496107_0069487 3300048910 Bacteria 2556
879 Ga0496108_0004923 3300048911 Bacteria 10790
880 Ga0496108_0014595 3300048911 Bacteria 6412
881 Ga0496108_0058526 3300048911 Bacteria 3239
882 Ga0496108_0063070 3300048911 Bacteria 3120
883 Ga0496109_0001378 3300048912 Bacteria 20162
884 Ga0496109_0013835 3300048912 Bacteria 7011
885 Ga0496109_0027709 3300048912 Bacteria 5062
886 Ga0496109_0091700 3300048912 Bacteria 2810
887 Ga0496109_0251166 3300048912 Bacteria 1665
888 Ga0496110_0026796 3300048913 Bacteria 4935
889 Ga0496110_0139843 3300048913 Bacteria 2189
890 Ga0496110_0328936 3300048913 Bacteria 1392
891 Ga0496111_0003302 3300048914 Bacteria 9974
892 Ga0496111_0004431 3300048914 Bacteria 8875
893 Ga0496111_0010752 3300048914 Bacteria 6154
894 Ga0496111_0029199 3300048914 Bacteria 3915
895 Ga0496111_0069794 3300048914 Bacteria 2555
896 Ga0496112_0006510 3300048915 Bacteria 10269
897 Ga0496112_0011278 3300048915 Bacteria 8152
898 Ga0496112_0020604 3300048915 Bacteria 6252
899 Ga0496112_0072366 3300048915 Bacteria 3407
900 Ga0496112_0129421 3300048915 Bacteria 2495
901 Ga0496113_0007500 3300048916 Bacteria 7027
902 Ga0496113_0038080 3300048916 Bacteria 3533
903 Ga0496113_0210305 3300048916 Bacteria 1548
904 Ga0496113_0244487 3300048916 Bacteria 1432
905 Ga0496114_0000109 3300048917 Bacteria 59733
906 Ga0496114_0164964 3300048917 Bacteria 1928
907 Ga0501046_0134308 3300049580 Bacteria 1875
908 Ga0501048_0115655 3300049582 Bacteria 1895
909 Ga0501069_0101942 3300049585 Bacteria 1630
910 Ga0501071_0199717 3300049587 Bacteria 1502
911 Ga0501072_0099289 3300049588 Bacteria 2314
912 Ga0501075_0285468 3300049591 Bacteria 1257
913 Ga0501076_0102939 3300049592 Bacteria 2303
914 Ga0501217_041500 3300049661 Bacteria 1173
915 Ga0501079_0276885 3300049741 Bacteria 1312
916 Ga0501080_0042295 3300049742 Bacteria 4243
917 Ga0501081_0232065 3300049743 Bacteria 1344
918 Ga0501268_000278 3300049765 Bacteria 5241
919 Ga0501268_003940 3300049765 Bacteria 2066
920 Ga0501268_009934 3300049765 Bacteria 1472
921 nmdc:mga05p37_78844_c1 3300050507 Bacteria 4056
922 nmdc:mga09592_15357_c1 3300050508 Bacteria 6254
923 nmdc:mga0qj67_1071_c1 3300050509 Bacteria 18948
924 nmdc:mga0qj67_14629_c1 3300050509 Bacteria 5933
925 nmdc:mga0qj67_173779_c1 3300050509 Bacteria 1749
926 nmdc:mga06r32_12592_c1 3300050510 Bacteria 7640
927 nmdc:mga06r32_6029_c1 3300050510 Bacteria 10904
928 nmdc:mga08y16_22841_c1 3300050511 Bacteria 6602
929 nmdc:mga0rr50_28035_c1 3300050513 Bacteria 3953
930 nmdc:mga0a205_201229_c1 3300050515 Bacteria 1882
931 Ga0501082_0160464 3300060353 Bacteria 1954
932 Ga0466962_0010660 3300061719 Bacteria 4421
933 Ga0466962_0012080 3300061719 Bacteria 4152
934 2885429509 2885427238 Bacteria 2291351
935 2896432048 2896429255 Bacteria 2557483
936 Ga0207703_10017205
937 JGI24741J21665_1002624
938 JGI24740J21852_10002399
939 JGI24740J21852_10005120
940 JGI24740J21852_10017958
941 JGI24740J21852_10037536
942 JGI24739J22299_10000659
943 JGI24739J22299_10005413
944 JGI24739J22299_10005850
945 JGI24739J22299_10020069
946 JGI24737J22298_10000051
947 JGI24737J22298_10000119
948 JGI24737J22298_10006471
949 JGI24737J22298_10014594
950 JGI24737J22298_10017353
951 JGI24737J22298_10024655
952 JGI24735J21928_10010063
953 JGI24738J21930_10000189
954 JGI24738J21930_10010662
955 JGI24738J21930_10011785
956 Ga0065715_10016189
957 Ga0065715_10113515
958 Ga0065715_10147636
959 Ga0070658_10000179
960 Ga0070658_10007967
961 Ga0070658_10021959
962 Ga0070658_10028874
963 Ga0070658_10046694
964 Ga0070658_10065793
965 Ga0070658_10074367
966 Ga0070658_10086773
967 Ga0070658_10203858
968 Ga0070676_10002487
969 Ga0070676_10078150
970 Ga0070676_10094065
971 Ga0070683_100000209
972 Ga0070683_100015961
973 Ga0070683_100035143
974 Ga0070670_100007357
975 Ga0070670_100015501
976 Ga0070670_100020869
977 Ga0070670_100035198
978 Ga0070670_100080567
979 Ga0070670_100119093
980 Ga0070670_100137261
981 Ga0070670_100173668
982 Ga0070670_100362834
983 Ga0070677_10000456
984 Ga0070677_10008734
985 Ga0068869_100106347
986 Ga0070666_10000253
987 Ga0070666_10009562
988 Ga0070666_10016172
989 Ga0070666_10025968
990 Ga0070680_100001266
991 Ga0070680_100001515
992 Ga0070680_100028062
993 Ga0070680_100057373
994 Ga0070682_100005834
995 Ga0070682_100132508
996 Ga0068868_100029600
997 Ga0068868_100043537
998 Ga0068868_100166675
999 Ga0068868_100232346
1000 Ga0068868_100409680
1001 Ga0070660_100000496
1002 Ga0070660_100000843
1003 Ga0070660_100002806
1004 Ga0070660_100005800
1005 Ga0070660_100015320
1006 Ga0070660_100039830
1007 Ga0070660_100081923
1008 Ga0070660_100117230
1009 Ga0070660_100160812
1010 Ga0070660_100165940
1011 Ga0070660_100346688
1012 Ga0070689_100065582
1013 Ga0070661_100000509
1014 Ga0070661_100005747
1015 Ga0070661_100040027
1016 Ga0070661_100090855
1017 Ga0070661_100153210
1018 Ga0070661_100157838
1019 Ga0070692_10005156
1020 Ga0070692_10008858
1021 Ga0070692_10025489
1022 Ga0070668_100040320
1023 Ga0070668_100051657
1024 Ga0070668_100132104
1025 Ga0070669_100000752
1026 Ga0070669_100053914
1027 Ga0070669_100100448
1028 Ga0070675_100001728
1029 Ga0070675_100003423
1030 Ga0070675_100016857
1031 Ga0070675_100048235
1032 Ga0070675_100149831
1033 Ga0070671_100000322
1034 Ga0070671_100001874
1035 Ga0070671_100011263
1036 Ga0070671_100022292
1037 Ga0070671_100027587
1038 Ga0070671_100031306
1039 Ga0070671_100033237
1040 Ga0070671_100037717
1041 Ga0070671_100058342
1042 Ga0070671_100076246
1043 Ga0070671_100078624
1044 Ga0070674_100008524
1045 Ga0070674_100009790
1046 Ga0070674_100015477
1047 Ga0070674_100033712
1048 Ga0070674_100056597
1049 Ga0070674_100084491
1050 Ga0070673_100000145
1051 Ga0070673_100000648
1052 Ga0070673_100080660
1053 Ga0070673_100182225
1054 Ga0070659_100000138
1055 Ga0070659_100000982
1056 Ga0070659_100005079
1057 Ga0070659_100044495
1058 Ga0070659_100061943
1059 Ga0070659_100093808
1060 Ga0070659_100095885
1061 Ga0070659_100115416
1062 Ga0070659_100179375
1063 Ga0070667_100004445
1064 Ga0070667_100013165
1065 Ga0070667_100024755
1066 Ga0070667_100087481
1067 Ga0070667_100137943
1068 Ga0070667_100268413
1069 Ga0070714_100005008
1070 Ga0070714_100237089
1071 Ga0070713_100285227
1072 Ga0070694_100005589
1073 Ga0070694_100069423
1074 Ga0070663_100002302
1075 Ga0070663_100010464
1076 Ga0070663_100013265
1077 Ga0070663_100044609
1078 Ga0070663_100060180
1079 Ga0070663_100061328
1080 Ga0070663_100110272
1081 Ga0070663_100111594
1082 Ga0070663_100241680
1083 Ga0070678_100001515
1084 Ga0070678_100024057
1085 Ga0070678_100223695
1086 Ga0070662_100000034
1087 Ga0070662_100000586
1088 Ga0070662_100004865
1089 Ga0070662_100010818
1090 Ga0070662_100014132
1091 Ga0070662_100018565
1092 Ga0070662_100022273
1093 Ga0070662_100025100
1094 Ga0070662_100066522
1095 Ga0070662_100084172
1096 Ga0070662_100105859
1097 Ga0070662_100116038
1098 Ga0070662_100147321
1099 Ga0070681_10155864
1100 Ga0070681_10168304
1101 Ga0070681_10189335
1102 Ga0068867_100001195
1103 Ga0068867_100032233
1104 Ga0070679_100006786
1105 Ga0070679_100095333
1106 Ga0070679_100207703
1107 Ga0070679_100215858
1108 Ga0070679_100225170
1109 Ga0070679_100229356
1110 Ga0070684_100013978
1111 Ga0070684_100014070
1112 Ga0070684_100108458
1113 Ga0070684_100165981
1114 Ga0068853_100000470
1115 Ga0068853_100001329
1116 Ga0068853_100043335
1117 Ga0068853_100056367
1118 Ga0068853_100066802
1119 Ga0068853_100257425
1120 Ga0070672_100001962
1121 Ga0070672_100002839
1122 Ga0070672_100026460
1123 Ga0070672_100026805
1124 Ga0070672_100113478
1125 Ga0070672_100159392
1126 Ga0070686_100005958
1127 Ga0070695_100076239
1128 Ga0070695_100093298
1129 Ga0070696_100127487
1130 Ga0070693_100001471
1131 Ga0070693_100004705
1132 Ga0070693_100016055
1133 Ga0070665_100006112
1134 Ga0070665_100006985
1135 Ga0070665_100013697
1136 Ga0070665_100073597
1137 Ga0070665_100112645
1138 Ga0070704_100009106
1139 Ga0068855_100000163
1140 Ga0068855_100005215
1141 Ga0068855_100018325
1142 Ga0068855_100018458
1143 Ga0068855_100023294
1144 Ga0068855_100044931
1145 Ga0068855_100055642
1146 Ga0068855_100100332
1147 Ga0070664_100000544
1148 Ga0070664_100027011
1149 Ga0070664_100040129
1150 Ga0070664_100042960
1151 Ga0070664_100055425
1152 Ga0070664_100143150
1153 Ga0070664_100238659
1154 Ga0070664_100338699
1155 Ga0068857_100001148
1156 Ga0068857_100006801
1157 Ga0068857_100030168
1158 Ga0068857_100049879
1159 Ga0068857_100061314
1160 Ga0068857_100098362
1161 Ga0068857_100144651
1162 Ga0068857_100149631
1163 Ga0068854_100000061
1164 Ga0068854_100004256
1165 Ga0068854_100009527
1166 Ga0068854_100014552
1167 Ga0068854_100023143
1168 Ga0068854_100051866
1169 Ga0068854_100132584
1170 Ga0068854_100170830
1171 Ga0068856_100001006
1172 Ga0068856_100005334
1173 Ga0068856_100051151
1174 Ga0068856_100054245
1175 Ga0068856_100091892
1176 Ga0068856_100153914
1177 Ga0068856_100236171
1178 Ga0068852_100000288
1179 Ga0068852_100000502
1180 Ga0068852_100001393
1181 Ga0068852_100003438
1182 Ga0068852_100005965
1183 Ga0068852_100033509
1184 Ga0068852_100034505
1185 Ga0068852_100053207
1186 Ga0068852_100070631
1187 Ga0068852_100084581
1188 Ga0068859_100000778
1189 Ga0068859_100006927
1190 Ga0068859_100055150
1191 Ga0068859_100058514
1192 Ga0068859_100117088
1193 Ga0068859_100159838
1194 Ga0068864_100000795
1195 Ga0068864_100004007
1196 Ga0068864_100004624
1197 Ga0068864_100025223
1198 Ga0068864_100116874
1199 Ga0068864_100187812
1200 Ga0068864_100195506
1201 Ga0068866_10006297
1202 Ga0068851_10003515
1203 Ga0068851_10014976
1204 Ga0068851_10063918
1205 Ga0068863_100000921
1206 Ga0068863_100001605
1207 Ga0068863_100016353
1208 Ga0068863_100095330
1209 Ga0068858_100002203
1210 Ga0068858_100044220
1211 Ga0068858_100056752
1212 Ga0068858_100217016
1213 Ga0068860_100001686
1214 Ga0068860_100004579
1215 Ga0068860_100030822
1216 Ga0068860_100117249
1217 Ga0068860_100311570
1218 Ga0068862_100008684
1219 Ga0068862_100116929
1220 Ga0068862_100141871
1221 Ga0068862_100156094
1222 Ga0081539_10017913
1223 Ga0070712_100036377
1224 Ga0097621_100263660
1225 Ga0068871_100033208
1226 Ga0068871_100043797
1227 Ga0075428_100003038
1228 Ga0075428_100035786
1229 Ga0075430_100000051
1230 Ga0075430_100001778
1231 Ga0075431_100001402
1232 Ga0075431_100004328
1233 Ga0075433_10004091
1234 Ga0075433_10084909
1235 Ga0075434_100038613
1236 Ga0075429_100000587
1237 Ga0068865_100006108
1238 Ga0068865_100007421
1239 Ga0068865_100050532
1240 Ga0068865_100120223
1241 Ga0097620_100000778
1242 Ga0097620_100006927
1243 Ga0097620_100055150
1244 Ga0097620_100058512
1245 Ga0097620_100117089
1246 Ga0097620_100159839
1247 Ga0075435_100035579
1248 Ga0105240_10136953
1249 Ga0111539_10043101
1250 Ga0105245_10000326
1251 Ga0105245_10009842
1252 Ga0105247_10145959
1253 Ga0114129_10003334
1254 Ga0114129_10338243
1255 Ga0105243_10023495
1256 Ga0105243_10059854
1257 Ga0105241_10033347
1258 Ga0105241_10147963
1259 Ga0105242_10377160
1260 Ga0105248_10000159
1261 Ga0105248_10008781
1262 Ga0105248_10019159
1263 Ga0105248_10071059
1264 Ga0105248_10206710
1265 Ga0105248_10539493
1266 Ga0105237_10021454
1267 Ga0105237_10092943
1268 Ga0105238_10030087
1269 Ga0105238_10152582
1270 Ga0105249_10008541
1271 Ga0105239_10020658
1272 Ga0105239_10056048
1273 Ga0105239_10188401
1274 Ga0105246_10058328
1275 Ga0157373_10002218
1276 Ga0157373_10002590
1277 Ga0157373_10013488
1278 Ga0157373_10022296
1279 Ga0157373_10033010
1280 Ga0157373_10063464
1281 Ga0157371_10001589
1282 Ga0157371_10025211
1283 Ga0157371_10065197
1284 Ga0157371_10104530
1285 Ga0157370_10020584
1286 Ga0157370_10025173
1287 Ga0157370_10027636
1288 Ga0157370_10090908
1289 Ga0157370_10317414
1290 Ga0157369_10001821
1291 Ga0157369_10068122
1292 Ga0157369_10129558
1293 Ga0157374_10003309
1294 Ga0157378_10002474
1295 Ga0157378_10249728
1296 Ga0163162_10000839
1297 Ga0163162_10016620
1298 Ga0163162_10131605
1299 Ga0163162_10134720
1300 Ga0163162_10250401
1301 Ga0163162_10304817
1302 Ga0157372_10148357
1303 Ga0157372_10282826
1304 Ga0157375_10002246
1305 Ga0157375_10110275
1306 Ga0163163_10000338
1307 Ga0163163_10061718
1308 Ga0157380_10003748
1309 Ga0157380_10012637
1310 Ga0157380_10035058
1311 Ga0157380_10046903
1312 Ga0157379_10017162
1313 Ga0157379_10064317
1314 Ga0157376_10148706
1315 Ga0163161_10038874
1316 Ga0163161_10072139
1317 Ga0163161_10136466
1318 Ga0206354_11145685
1319 Ga0206353_10127208
1320 Ga0207697_10000664
1321 Ga0207697_10009612
1322 Ga0207697_10022713
1323 Ga0207656_10002673
1324 Ga0207682_10019136
1325 Ga0207688_10000730
1326 Ga0207688_10003567
1327 Ga0207688_10084428
1328 Ga0207688_10139543
1329 Ga0207680_10001430
1330 Ga0207680_10012172
1331 Ga0207680_10013220
1332 Ga0207680_10019376
1333 Ga0207647_10000232
1334 Ga0207647_10001671
1335 Ga0207647_10002581
1336 Ga0207647_10006556
1337 Ga0207647_10014490
1338 Ga0207647_10050037
1339 Ga0207699_10015306
1340 Ga0207645_10000418
1341 Ga0207645_10015378
1342 Ga0207645_10026959
1343 Ga0207645_10078126
1344 Ga0207645_10122381
1345 Ga0207643_10033452
1346 Ga0207705_10000260
1347 Ga0207705_10001202
1348 Ga0207705_10001212
1349 Ga0207705_10002824
1350 Ga0207705_10017643
1351 Ga0207705_10028556
1352 Ga0207705_10058310
1353 Ga0207654_10138858
1354 Ga0207707_10024583
1355 Ga0207707_10060102
1356 Ga0207707_10109491
1357 Ga0207707_10261972
1358 Ga0207695_10293876
1359 Ga0207671_10020914
1360 Ga0207671_10028185
1361 Ga0207660_10000428
1362 Ga0207660_10004722
1363 Ga0207660_10006807
1364 Ga0207660_10007440
1365 Ga0207660_10014482
1366 Ga0207657_10000031
1367 Ga0207657_10001025
1368 Ga0207657_10002385
1369 Ga0207657_10002400
1370 Ga0207657_10006951
1371 Ga0207657_10007667
1372 Ga0207657_10014192
1373 Ga0207657_10026790
1374 Ga0207657_10028941
1375 Ga0207657_10057554
1376 Ga0207657_10065289
1377 Ga0207649_10000148
1378 Ga0207649_10003558
1379 Ga0207649_10005898
1380 Ga0207649_10021412
1381 Ga0207649_10021728
1382 Ga0207649_10027624
1383 Ga0207649_10082091
1384 Ga0207649_10104801
1385 Ga0207649_10126366
1386 Ga0207652_10007304
1387 Ga0207652_10019490
1388 Ga0207652_10118836
1389 Ga0207652_10187576
1390 Ga0207681_10001054
1391 Ga0207681_10014078
1392 Ga0207681_10046640
1393 Ga0207681_10052396
1394 Ga0207694_10000526
1395 Ga0207650_10010360
1396 Ga0207650_10054625
1397 Ga0207650_10080742
1398 Ga0207650_10114582
1399 Ga0207650_10277162
1400 Ga0207659_10002591
1401 Ga0207659_10041692
1402 Ga0207659_10053944
1403 Ga0207687_10011622
1404 Ga0207687_10072944
1405 Ga0207700_10079890
1406 Ga0207700_10084051
1407 Ga0207664_10053292
1408 Ga0207664_10085865
1409 Ga0207664_10108152
1410 Ga0207664_10125595
1411 Ga0207644_10003944
1412 Ga0207644_10007023
1413 Ga0207644_10010565
1414 Ga0207644_10011535
1415 Ga0207644_10014161
1416 Ga0207644_10019388
1417 Ga0207644_10024679
1418 Ga0207644_10025193
1419 Ga0207644_10038199
1420 Ga0207644_10129143
1421 Ga0207644_10130884
1422 Ga0207690_10000185
1423 Ga0207690_10005791
1424 Ga0207690_10006190
1425 Ga0207690_10013540
1426 Ga0207690_10018913
1427 Ga0207690_10041251
1428 Ga0207690_10042100
1429 Ga0207690_10044325
1430 Ga0207690_10056195
1431 Ga0207690_10059623
1432 Ga0207690_10062785
1433 Ga0207690_10090443
1434 Ga0207706_10000028
1435 Ga0207706_10000171
1436 Ga0207706_10000285
1437 Ga0207706_10001955
1438 Ga0207706_10004522
1439 Ga0207706_10010342
1440 Ga0207706_10010714
1441 Ga0207706_10048133
1442 Ga0207706_10058189
1443 Ga0207706_10063787
1444 Ga0207706_10067453
1445 Ga0207706_10069464
1446 Ga0207706_10093706
1447 Ga0207706_10119175
1448 Ga0207706_10145074
1449 Ga0207706_10147728
1450 Ga0207669_10005747
1451 Ga0207669_10007663
1452 Ga0207669_10007970
1453 Ga0207669_10008080
1454 Ga0207704_10008679
1455 Ga0207704_10019395
1456 Ga0207704_10388205
1457 Ga0207691_10001864
1458 Ga0207691_10002244
1459 Ga0207691_10019764
1460 Ga0207691_10037523
1461 Ga0207691_10058360
1462 Ga0207691_10216903
1463 Ga0207711_10000829
1464 Ga0207711_10002458
1465 Ga0207711_10009134
1466 Ga0207711_10017453
1467 Ga0207711_10032851
1468 Ga0207711_10095490
1469 Ga0207711_10191705
1470 Ga0207689_10000092
1471 Ga0207689_10147210
1472 Ga0207661_10000261
1473 Ga0207661_10008508
1474 Ga0207661_10020152
1475 Ga0207661_10041737
1476 Ga0207661_10198087
1477 Ga0207679_10000129
1478 Ga0207679_10006872
1479 Ga0207679_10010870
1480 Ga0207679_10061703
1481 Ga0207679_10145769
1482 Ga0207679_10294465
1483 Ga0207679_10349071
1484 Ga0207667_10000357
1485 Ga0207667_10005746
1486 Ga0207667_10013242
1487 Ga0207667_10016701
1488 Ga0207667_10018799
1489 Ga0207667_10039899
1490 Ga0207667_10045671
1491 Ga0207667_10111587
1492 Ga0207667_10125740
1493 Ga0207667_10128750
1494 Ga0207667_10507129
1495 Ga0207651_10000521
1496 Ga0207651_10001044
1497 Ga0207651_10005094
1498 Ga0207651_10066663
1499 Ga0207712_10000269
1500 Ga0207668_10000080
1501 Ga0207668_10010968
1502 Ga0207668_10037769
1503 Ga0207668_10169808
1504 Ga0207640_10012200
1505 Ga0207640_10014993
1506 Ga0207640_10016048
1507 Ga0207640_10031129
1508 Ga0207640_10045081
1509 Ga0207640_10058906
1510 Ga0207640_10102231
1511 Ga0207658_10002199
1512 Ga0207658_10036886
1513 Ga0207658_10174007
1514 Ga0207677_10114933
1515 Ga0207677_10143164
1516 Ga0207703_10002403
1517 Ga0207703_10076330
1518 Ga0207639_10000131
1519 Ga0207639_10002585
1520 Ga0207639_10007251
1521 Ga0207639_10030514
1522 Ga0207639_10113682
1523 Ga0207678_10000198
1524 Ga0207678_10000385
1525 Ga0207678_10000732
1526 Ga0207678_10001415
1527 Ga0207678_10001794
1528 Ga0207678_10100554
1529 Ga0207678_10118315
1530 Ga0207702_10000247
1531 Ga0207702_10008747
1532 Ga0207702_10015384
1533 Ga0207702_10015948
1534 Ga0207702_10057919
1535 Ga0207702_10295773
1536 Ga0207702_10369139
1537 Ga0207641_10002549
1538 Ga0207641_10038269
1539 Ga0207641_10074536
1540 Ga0207641_10248900
1541 Ga0207641_10282634
1542 Ga0207648_10000317
1543 Ga0207648_10007723
1544 Ga0207676_10000908
1545 Ga0207676_10001355
1546 Ga0207676_10020931
1547 Ga0207676_10022076
1548 Ga0207676_10030692
1549 Ga0207676_10061608
1550 Ga0207676_10134492
1551 Ga0207674_10000289
1552 Ga0207674_10002023
1553 Ga0207674_10012074
1554 Ga0207674_10019458
1555 Ga0207674_10021794
1556 Ga0207674_10025013
1557 Ga0207674_10041598
1558 Ga0207674_10061115
1559 Ga0207683_10001680
1560 Ga0207683_10040385
1561 Ga0207698_10000125
1562 Ga0207698_10002361
1563 Ga0207698_10002697
1564 Ga0207698_10003972
1565 Ga0207698_10007716
1566 Ga0207698_10019393
1567 Ga0207698_10044264
1568 Ga0207698_10147579
1569 Ga0207698_10212865
1570 Ga0268266_10000433
1571 Ga0268266_10004212
1572 Ga0268266_10005862
1573 Ga0268266_10023589
1574 Ga0268266_10023805
1575 Ga0268266_10047507
1576 Ga0268265_10075874
1577 Ga0268265_10078944
1578 Ga0268265_10083031
1579 Ga0268264_10010718
1580 Ga0268264_10017640
1581 Ga0268264_10048046
1582 Ga0268264_10305030
1583 Ga0307408_100027036
1584 Ga0307408_100189580
1585 Ga0307408_100197536
1586 Ga0307405_10031957
1587 Ga0307405_10033665
1588 Ga0307405_10114906
1589 Ga0307405_10321536
1590 Ga0307413_10013794
1591 Ga0307410_10007253
1592 Ga0307410_10013692
1593 Ga0307410_10023600
1594 Ga0307410_10026779
1595 Ga0307410_10055893
1596 Ga0307406_10016813
1597 Ga0307406_10057918
1598 Ga0307406_10211311
1599 Ga0307406_10294758
1600 Ga0307407_10034555
1601 Ga0307407_10050287
1602 Ga0307407_10062771
1603 Ga0307407_10093148
1604 Ga0307407_10147471
1605 Ga0307407_10204211
1606 Ga0307412_10023898
1607 Ga0307412_10175236
1608 Ga0307409_100011712
1609 Ga0307409_100022838
1610 Ga0307409_100039663
1611 Ga0307409_100052322
1612 Ga0307409_100064658
1613 Ga0307409_100162037
1614 Ga0307409_100268647
1615 Ga0307416_100006841
1616 Ga0307416_100009490
1617 Ga0307416_100013849
1618 Ga0307416_100031747
1619 Ga0307416_100041366
1620 Ga0307416_100047800
1621 Ga0307416_100055853
1622 Ga0307416_100093250
1623 Ga0307416_100124402
1624 Ga0307416_100181069
1625 Ga0307416_100249778
1626 Ga0307414_10002384
1627 Ga0307414_10012920
1628 Ga0307414_10013759
1629 Ga0307414_10095759
1630 Ga0307414_10141089
1631 Ga0307414_10184258
1632 Ga0307414_10324239
1633 Ga0307411_10001217
1634 Ga0307411_10003270
1635 Ga0307411_10014798
1636 Ga0307411_10033889
1637 Ga0307411_10041638
1638 Ga0307411_10053936
1639 Ga0307411_10086775
1640 Ga0307411_10111128
1641 Ga0307411_10114986
1642 Ga0307411_10117370
1643 Ga0307411_10161588
1644 Ga0307411_10200955
1645 Ga0307415_100007011
1646 Ga0307415_100028455
1647 Ga0307415_100036008
1648 Ga0373941_0011627
1649 Ga0373943_0080471
1650 Ga0373946_0007177
1651 Ga0373931_0006642
1652 Ga0373931_0032214
1653 Ga0373935_0007020
1654 Ga0373937_0009398
1655 Ga0373925_0007643
1656 Ga0395899_0000881
1657 Ga0395899_0005689
1658 Ga0395899_0014823
1659 Ga0395899_0016947
1660 Ga0395899_0034965
1661 Ga0395899_0074895
1662 Ga0395899_0141920
1663 Ga0395899_0149653
1664 Ga0395899_0171647
1665 Ga0395899_0191839
1666 Ga0395900_0000564
1667 Ga0395900_0005731
1668 Ga0395900_0012280
1669 Ga0395900_0020262
1670 Ga0395900_0022463
1671 Ga0395900_0027265
1672 Ga0395900_0030897
1673 Ga0395900_0034408
1674 Ga0395900_0035752
1675 Ga0395900_0067301
1676 Ga0395900_0094506
1677 Ga0395900_0094958
1678 Ga0395900_0129626
1679 Ga0395900_0133684
1680 Ga0395900_0133930
1681 Ga0395900_0180632
1682 Ga0395900_0186192
1683 Ga0395900_0309377
1684 Ga0395900_0381093
1685 Ga0395900_0518421
1686 Ga0395898_0000941
1687 Ga0395898_0003841
1688 Ga0395898_0006833
1689 Ga0395898_0022292
1690 Ga0395898_0022488
1691 Ga0395898_0081950
1692 Ga0395898_0118217
1693 Ga0395898_0122808
1694 Ga0395898_0165616
1695 Ga0395898_0244811
1696 Ga0395898_0274615
1697 Ga0395898_0402549
1698 Ga0395898_0409016
1699 Ga0395898_0416532
1700 Ga0395905_0000104
1701 Ga0395905_0000926
1702 Ga0395905_0002062
1703 Ga0395905_0004632
1704 Ga0395905_0004757
1705 Ga0395905_0007779
1706 Ga0395905_0008521
1707 Ga0395905_0013490
1708 Ga0395905_0020376
1709 Ga0395905_0031926
1710 Ga0395905_0033983
1711 Ga0395905_0036765
1712 Ga0395905_0042133
1713 Ga0395905_0057881
1714 Ga0395905_0103487
1715 Ga0395905_0109731
1716 Ga0395905_0112860
1717 Ga0395905_0116009
1718 Ga0395905_0122546
1719 Ga0395905_0127249
1720 Ga0395905_0147118
1721 Ga0395905_0183164
1722 Ga0395901_0000276
1723 Ga0395901_0001094
1724 Ga0395901_0001229
1725 Ga0395901_0001482
1726 Ga0395901_0006023
1727 Ga0395901_0026549
1728 Ga0395901_0029685
1729 Ga0395901_0039088
1730 Ga0395901_0040400
1731 Ga0395901_0044924
1732 Ga0395901_0048158
1733 Ga0395901_0065389
1734 Ga0395901_0134340
1735 Ga0395901_0200020
1736 Ga0395901_0278762
1737 Ga0395901_0293880
1738 Ga0395901_0385160
1739 Ga0436365_0970995
1740 Ga0439448_0013952
1741 Ga0439432_014402
1742 Ga0439432_016998
1743 Ga0439449_0063145
1744 Ga0439452_024182
1745 Ga0439464_0001906
1746 Ga0466969_0005422
1747 Ga0466969_0023182
1748 Ga0466966_0000004
1749 Ga0466966_0010501
1750 Ga0466966_0019739
1751 Ga0466966_0042876
1752 Ga0466961_0010917
1753 Ga0466961_0015585
1754 Ga0466961_0027095
1755 Ga0466961_0045613
1756 Ga0466961_0105574
1757 Ga0466963_0001967
1758 Ga0466963_0016274
1759 Ga0466963_0026962
1760 Ga0466963_0077383
1761 Ga0466971_0001327
1762 Ga0466971_0002026
1763 Ga0466970_0015736
1764 Ga0466970_0040285
1765 Ga0466970_0046496
1766 Ga0466970_0096670
1767 Ga0466957_0004237
1768 Ga0466957_0014050
1769 Ga0466957_0016598
1770 Ga0466957_0035470
1771 Ga0466959_0017246
1772 Ga0466959_0035546
1773 Ga0466959_0116506
1774 Ga0466958_0001495
1775 Ga0466958_0026679
1776 Ga0466958_0096860
1777 Ga0466967_0011537
1778 Ga0466967_0011679
1779 Ga0466967_0059273
1780 Ga0466967_0074735
1781 Ga0466967_0077302
1782 Ga0466967_0137134
1783 Ga0466967_0388264
1784 Ga0495629_0180772
1785 Ga0495663_0002774
1786 Ga0495663_0039928
1787 Ga0495598_0000608
1788 Ga0495621_0000022
1789 Ga0495621_0000916
1790 Ga0495621_0020264
1791 Ga0495668_0010329
1792 Ga0495668_0090708
1793 Ga0495659_0005488
1794 Ga0495659_0006947
1795 Ga0495623_0036479
1796 Ga0495669_0000720
1797 Ga0495669_0014285
1798 Ga0495669_0036191
1799 Ga0495602_0121921
1800 Ga0496100_0133010
1801 Ga0496101_0030190
1802 Ga0496101_0091714
1803 Ga0496102_0011422
1804 Ga0496102_0021292
1805 Ga0496102_0324649
1806 Ga0496103_0106096
1807 Ga0496104_0092125
1808 Ga0496105_0050426
1809 Ga0496106_0186524
1810 Ga0496107_0019286
1811 Ga0496107_0025147
1812 Ga0496107_0032250
1813 Ga0496107_0069487
1814 Ga0496108_0004923
1815 Ga0496108_0014595
1816 Ga0496108_0058526
1817 Ga0496108_0063070
1818 Ga0496109_0001378
1819 Ga0496109_0013835
1820 Ga0496109_0027709
1821 Ga0496109_0091700
1822 Ga0496109_0251166
1823 Ga0496110_0026796
1824 Ga0496110_0139843
1825 Ga0496110_0328936
1826 Ga0496111_0003302
1827 Ga0496111_0004431
1828 Ga0496111_0010752
1829 Ga0496111_0029199
1830 Ga0496111_0069794
1831 Ga0496112_0006510
1832 Ga0496112_0011278
1833 Ga0496112_0020604
1834 Ga0496112_0072366
1835 Ga0496112_0129421
1836 Ga0496113_0007500
1837 Ga0496113_0038080
1838 Ga0496113_0210305
1839 Ga0496113_0244487
1840 Ga0496114_0000109
1841 Ga0496114_0164964
1842 Ga0501046_0134308
1843 Ga0501048_0115655
1844 Ga0501069_0101942
1845 Ga0501071_0199717
1846 Ga0501072_0099289
1847 Ga0501075_0285468
1848 Ga0501076_0102939
1849 Ga0501217_041500
1850 Ga0501079_0276885
1851 Ga0501080_0042295
1852 Ga0501081_0232065
1853 Ga0501268_000278
1854 Ga0501268_003940
1855 Ga0501268_009934
1856 nmdc:mga05p37_78844_c1
1857 nmdc:mga09592_15357_c1
1858 nmdc:mga0qj67_1071_c1
1859 nmdc:mga0qj67_14629_c1
1860 nmdc:mga0qj67_173779_c1
1861 nmdc:mga06r32_12592_c1
1862 nmdc:mga06r32_6029_c1
1863 nmdc:mga08y16_22841_c1
1864 nmdc:mga0rr50_28035_c1
1865 nmdc:mga0a205_201229_c1
1866 Ga0501082_0160464
1867 Ga0466962_0010660
1868 Ga0466962_0012080
1869 2885429509
1870 2896432048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13484

Fer4_16

4Fe-4S double cluster binding domain

195

259

0.99

PF08331

QueG_DUF1730

Epoxyqueuosine reductase QueG, DUF1730

65

141

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwd-assembly1.cif.gz_H tubulin:iih5 alpharep complex 0.9622 282 327
6gx7-assembly2.cif.gz_F tubulin-copn-alpharep complex 0.9572 283 327
7p0h-assembly2.cif.gz_B crystal structure of helicobacter pylori comf fused to an artificial alpharep crystallization helper(named b2) 0.9164 256 327
3ltm-assembly1.cif.gz_B structure of a new family of artificial alpha helicoidal repeat proteins (alpha-rep) based on thermostable heat-like repeats 0.8972 256 327
4zv6-assembly1.cif.gz_A crystal structure of the artificial alpharep-7 octarellinv.1 complex 0.8577 256 334
ID Description Score Start End Superfamily
af_Q5EB20_819_972_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9252 256 327 1.25.10.10
af_P33892_1324_1637_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8899 281 327 1.25.10.10
af_Q8I701_33_189_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8703 256 326 1.25.10.10
af_Q4E1T6_362_466_1.25.40.150 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;V-type ATPase, subunit H, C-terminal domain 0.867 284 326 1.25.40.150
af_Q2FX88_260_379_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8665 254 335 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7G2LUN1-F1-model_v4 Epoxyqueuosine reductase 0.9702 256 326
AF-A0A7C7UY35-F1-model_v4 Epoxyqueuosine reductase 0.963 248 326
AF-A0A2R7JFX1-F1-model_v4 Epoxyqueuosine reductase 0.9278 1 134 GO:0008033
GO:0008616
GO:0051539
GO:0052693
AF-A0A836VFR8-F1-model_v4 DUF1730 domain-containing protein 0.9157 5 149 GO:0008033
GO:0008616
GO:0051539
GO:0052693
AF-A0A2R7JFX1-F1-model_v4 Epoxyqueuosine reductase 0.9149 1 134 GO:0008033
GO:0008616
GO:0051539
GO:0052693

Map