F486166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 343 | 1870 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0004773|Ga0466972_0004773_5349_6422 |
| Length | 357 |
| Sequence | MDCSESLNNPPGIRKATMDKLQAMEVFVQVVDAGSFTRAADNMKLPKATVSTLISNLEAALTVKLLNRTTRALSVTADGAAYYERCRAILADVQDAEDSLSKTRSSASGRLRVDVPSAIGRDLLVPALPDFFKRYPDITLELGCSDRPVDLIEEGVDCVVRGGSLADSSVLVARRIGALHFMTCAAPSYLAVHGRPTHPEDLLRHLCVNYFSAKTGKVYEWDFFRDGERIQLQVPGYLAVNDSTAYHAAALSGIGIVQMPLYTARPHLDAGTLEAVLEDWCSEPVALHVMYPQNRHLSAKVRAFVEWVAELFAGHPSLQLDAVRCKDVQAAEPGTSSKEVKSKRGQRDAEAVRARAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 56 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 129 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 130 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 131 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 149 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 150 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 151 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 152 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 153 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 154 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 285 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 287 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 288 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 291 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 292 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 295 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 296 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 298 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 300 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 301 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 304 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 305 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 306 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 307 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 308 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 309 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 310 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 311 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 312 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 313 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 314 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 315 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 316 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 317 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 318 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 319 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 320 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 321 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 322 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 323 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 324 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 325 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 326 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 327 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 328 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 329 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 330 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 331 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 332 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 333 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 334 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 335 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 336 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 337 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 338 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 339 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 340 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 341 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 342 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 343 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.97 |
| Metatranscriptomes | 0.53 |
| Isolates | 4.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.43 |
| Nodule | 0.53 |
| Rhizoplane | 3.96 |
| Rhizosphere | 70.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466972_0004773 | 3300044658 | Bacteria | 6791 |
| 2 | JGI24740J21852_10000908 | 3300001979 | Bacteria | 13122 |
| 3 | JGI24740J21852_10005306 | 3300001979 | Bacteria | 5468 |
| 4 | JGI25156J39149_1009127 | 3300002705 | Bacteria | 2437 |
| 5 | JGI25154J39366_1000317 | 3300002738 | Bacteria | 27993 |
| 6 | JGI25154J39366_1001547 | 3300002738 | Bacteria | 7974 |
| 7 | JGI25152J39213_1005631 | 3300002773 | Bacteria | 3596 |
| 8 | JGI25150J39212_1000956 | 3300002774 | Bacteria | 9182 |
| 9 | JGI25150J39212_1005653 | 3300002774 | Plasmid | 2651 |
| 10 | JGI25159J45721_1001022 | 3300002987 | Bacteria | 12014 |
| 11 | JGI25159J45721_1001312 | 3300002987 | Bacteria | 10492 |
| 12 | JGI25159J45721_1019022 | 3300002987 | Unclassified | 1365 |
| 13 | JGI25151J46595_10000616 | 3300003187 | Bacteria | 31174 |
| 14 | JGI25153J46596_10002329 | 3300003215 | Bacteria | 11017 |
| 15 | JGI25153J46596_10006454 | 3300003215 | Bacteria | 5919 |
| 16 | JGI25153J46596_10008710 | 3300003215 | Bacteria | 4810 |
| 17 | rootL2_10031388 | 3300003322 | Unclassified | 1894 |
| 18 | rootL2_10056599 | 3300003322 | Bacteria | 1613 |
| 19 | JGI25160J50197_1013594 | 3300003354 | Unclassified | 2766 |
| 20 | JGI25161J50226_1000930 | 3300003374 | Bacteria | 10500 |
| 21 | JGI25161J50226_1009594 | 3300003374 | Unclassified | 1365 |
| 22 | Ga0055539_1000079 | 3300003752 | Bacteria | 126504 |
| 23 | Ga0055533_1000470 | 3300003756 | Bacteria | 15223 |
| 24 | Ga0055532_1000075 | 3300003758 | Bacteria | 124604 |
| 25 | Ga0055532_1000112 | 3300003758 | Bacteria | 86782 |
| 26 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 27 | Ga0055525_1000581 | 3300003759 | Bacteria | 15994 |
| 28 | Ga0055527_1000733 | 3300003760 | Bacteria | 9280 |
| 29 | Ga0055535_1000013 | 3300003761 | Bacteria | 299614 |
| 30 | Ga0055529_1000068 | 3300003763 | Bacteria | 163911 |
| 31 | Ga0055529_1000085 | 3300003763 | Bacteria | 140832 |
| 32 | Ga0055526_1000050 | 3300003771 | Bacteria | 117283 |
| 33 | Ga0055526_1000266 | 3300003771 | Bacteria | 44005 |
| 34 | Ga0055526_1000416 | 3300003771 | Bacteria | 34343 |
| 35 | Ga0055526_1001745 | 3300003771 | Bacteria | 15109 |
| 36 | Ga0055526_1010244 | 3300003771 | Bacteria | 4385 |
| 37 | Ga0055537_1000039 | 3300003773 | Bacteria | 92151 |
| 38 | Ga0055524_1000008 | 3300003775 | Bacteria | 297761 |
| 39 | Ga0055524_1000148 | 3300003775 | Bacteria | 83128 |
| 40 | Ga0055524_1001481 | 3300003775 | Bacteria | 13408 |
| 41 | Ga0055524_1001704 | 3300003775 | Bacteria | 12256 |
| 42 | Ga0055524_1001922 | 3300003775 | Bacteria | 11208 |
| 43 | Ga0055524_1002138 | 3300003775 | Bacteria | 10395 |
| 44 | Ga0055534_1000174 | 3300003784 | Bacteria | 47983 |
| 45 | Ga0055534_1011729 | 3300003784 | Unclassified | 1766 |
| 46 | Ga0055528_1000119 | 3300003790 | Bacteria | 62428 |
| 47 | Ga0055530_10001765 | 3300003791 | Bacteria | 15111 |
| 48 | Ga0055530_10005235 | 3300003791 | Bacteria | 6266 |
| 49 | Ga0055530_10007483 | 3300003791 | Unclassified | 4587 |
| 50 | Ga0055530_10007706 | 3300003791 | Unclassified | 4480 |
| 51 | Ga0055530_10013932 | 3300003791 | Bacteria | 2712 |
| 52 | Ga0055540_1000018 | 3300003792 | Bacteria | 218360 |
| 53 | Ga0055531_10007672 | 3300003794 | Bacteria | 5834 |
| 54 | Ga0055531_10009270 | 3300003794 | Bacteria | 5055 |
| 55 | Ga0055541_1000476 | 3300003841 | Bacteria | 11492 |
| 56 | Ga0055543_1001067 | 3300004625 | Bacteria | 12099 |
| 57 | Ga0055543_1001373 | 3300004625 | Bacteria | 9792 |
| 58 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 59 | Ga0065165_1003335 | 3300005262 | Bacteria | 11451 |
| 60 | Ga0065165_1006284 | 3300005262 | Bacteria | 6299 |
| 61 | Ga0065165_1019452 | 3300005262 | Bacteria | 2423 |
| 62 | Ga0065715_10158456 | 3300005293 | Bacteria | 1653 |
| 63 | Ga0070658_10049875 | 3300005327 | Bacteria | 3392 |
| 64 | Ga0070670_100245772 | 3300005331 | Bacteria | 1558 |
| 65 | Ga0070680_100250438 | 3300005336 | Bacteria | 1498 |
| 66 | Ga0070660_100151901 | 3300005339 | Bacteria | 1862 |
| 67 | Ga0070661_100000007 | 3300005344 | Bacteria | 202433 |
| 68 | Ga0070661_100035543 | 3300005344 | Bacteria | 3618 |
| 69 | Ga0070661_100210153 | 3300005344 | Bacteria | 1489 |
| 70 | Ga0070659_100002470 | 3300005366 | Bacteria | 13123 |
| 71 | Ga0070659_100045745 | 3300005366 | Bacteria | 3429 |
| 72 | Ga0070711_100059058 | 3300005439 | Bacteria | 2661 |
| 73 | Ga0070663_100000002 | 3300005455 | Bacteria | 298075 |
| 74 | Ga0068855_100125378 | 3300005563 | Bacteria | 2936 |
| 75 | Ga0070664_100000004 | 3300005564 | Bacteria | 298075 |
| 76 | Ga0068857_100004834 | 3300005577 | Bacteria | 11416 |
| 77 | Ga0068854_100000034 | 3300005578 | Bacteria | 102389 |
| 78 | Ga0068856_100000051 | 3300005614 | Bacteria | 107551 |
| 79 | Ga0081539_10005567 | 3300005985 | Bacteria | 12752 |
| 80 | Ga0081539_10062725 | 3300005985 | Bacteria | 2030 |
| 81 | Ga0070717_10158188 | 3300006028 | Bacteria | 1964 |
| 82 | Ga0075363_100079316 | 3300006048 | Bacteria | 1793 |
| 83 | Ga0075364_10069062 | 3300006051 | Bacteria | 2325 |
| 84 | Ga0070716_100069902 | 3300006173 | Bacteria | 2059 |
| 85 | Ga0070716_100076877 | 3300006173 | Unclassified | 1980 |
| 86 | Ga0075362_10015690 | 3300006177 | Bacteria | 3086 |
| 87 | Ga0075369_10028666 | 3300006186 | Bacteria | 2335 |
| 88 | Ga0075366_10030880 | 3300006195 | Bacteria | 3151 |
| 89 | Ga0075370_10010558 | 3300006353 | Bacteria | 4833 |
| 90 | Ga0068865_100078895 | 3300006881 | Bacteria | 2357 |
| 91 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 92 | Ga0079104_1007845 | 3300006946 | Bacteria | 3808 |
| 93 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 94 | Ga0105244_10003629 | 3300009036 | Bacteria | 10935 |
| 95 | Ga0105244_10007709 | 3300009036 | Bacteria | 6818 |
| 96 | Ga0105244_10097393 | 3300009036 | Bacteria | 1442 |
| 97 | Ga0105240_10018967 | 3300009093 | Bacteria | 9211 |
| 98 | Ga0105240_10230511 | 3300009093 | Bacteria | 2153 |
| 99 | Ga0105245_10160701 | 3300009098 | Bacteria | 2132 |
| 100 | Ga0114129_10032299 | 3300009147 | Bacteria | 7398 |
| 101 | Ga0105243_10020972 | 3300009148 | Bacteria | 4958 |
| 102 | Ga0105242_10118988 | 3300009176 | Bacteria | 2263 |
| 103 | Ga0105249_10335597 | 3300009553 | Unclassified | 1527 |
| 104 | Ga0099796_10004632 | 3300010159 | Bacteria | 3351 |
| 105 | Ga0157373_10006916 | 3300013100 | Bacteria | 8444 |
| 106 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 107 | Ga0157371_10000270 | 3300013102 | Bacteria | 70773 |
| 108 | Ga0157370_10000014 | 3300013104 | Bacteria | 194894 |
| 109 | Ga0157369_10005917 | 3300013105 | Bacteria | 14202 |
| 110 | Ga0157372_10000032 | 3300013307 | Bacteria | 178666 |
| 111 | Ga0182008_10000245 | 3300014497 | Bacteria | 42026 |
| 112 | Ga0182008_10013723 | 3300014497 | Bacteria | 4256 |
| 113 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 114 | Ga0182006_1000029 | 3300015261 | Bacteria | 247579 |
| 115 | Ga0182006_1001626 | 3300015261 | Bacteria | 13287 |
| 116 | Ga0182006_1003399 | 3300015261 | Bacteria | 8145 |
| 117 | Ga0182007_10000085 | 3300015262 | Bacteria | 70105 |
| 118 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 119 | Ga0182005_1000012 | 3300015265 | Bacteria | 396944 |
| 120 | Ga0206351_10676099 | 3300020077 | Bacteria | 2045 |
| 121 | Ga0154015_1662132 | 3300020610 | Bacteria | 7083 |
| 122 | Ga0213872_10000032 | 3300021361 | Bacteria | 138939 |
| 123 | Ga0213872_10003325 | 3300021361 | Bacteria | 8961 |
| 124 | Ga0213872_10006281 | 3300021361 | Bacteria | 5994 |
| 125 | Ga0224712_10049331 | 3300022467 | Bacteria | 1630 |
| 126 | Ga0209436_100559 | 3300025208 | Bacteria | 16062 |
| 127 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 128 | Ga0209784_100398 | 3300025224 | Bacteria | 19803 |
| 129 | Ga0209784_100604 | 3300025224 | Bacteria | 11602 |
| 130 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 131 | Ga0209566_100383 | 3300025225 | Bacteria | 35898 |
| 132 | Ga0209566_101077 | 3300025225 | Bacteria | 10725 |
| 133 | Ga0209674_100083 | 3300025226 | Bacteria | 197744 |
| 134 | Ga0209674_100142 | 3300025226 | Bacteria | 107750 |
| 135 | Ga0209672_100419 | 3300025228 | Bacteria | 24911 |
| 136 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 137 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 138 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 139 | Ga0209563_111169 | 3300025230 | Bacteria | 1277 |
| 140 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 141 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 142 | Ga0207425_1000130 | 3300025245 | Bacteria | 70791 |
| 143 | Ga0207425_1000158 | 3300025245 | Bacteria | 57310 |
| 144 | Ga0207425_1017058 | 3300025245 | Bacteria | 1602 |
| 145 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 146 | Ga0209646_1000016 | 3300025246 | Bacteria | 501688 |
| 147 | Ga0209026_1002022 | 3300025250 | Bacteria | 8038 |
| 148 | Ga0209026_1012928 | 3300025250 | Bacteria | 1436 |
| 149 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 150 | Ga0209677_105001 | 3300025253 | Bacteria | 3605 |
| 151 | Ga0209148_1000051 | 3300025254 | Bacteria | 401000 |
| 152 | Ga0209759_1003975 | 3300025256 | Bacteria | 5672 |
| 153 | Ga0209759_1006274 | 3300025256 | Bacteria | 4021 |
| 154 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 155 | Ga0209129_1000169 | 3300025258 | Bacteria | 96253 |
| 156 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 157 | Ga0209565_1000162 | 3300025263 | Bacteria | 89049 |
| 158 | Ga0209565_1000383 | 3300025263 | Bacteria | 37599 |
| 159 | Ga0209565_1003444 | 3300025263 | Bacteria | 5110 |
| 160 | Ga0209565_1009939 | 3300025263 | Bacteria | 2382 |
| 161 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 162 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 163 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 164 | Ga0209673_1005650 | 3300025273 | Bacteria | 6242 |
| 165 | Ga0209673_1015149 | 3300025273 | Bacteria | 2945 |
| 166 | Ga0209673_1016237 | 3300025273 | Bacteria | 2793 |
| 167 | Ga0209130_1000084 | 3300025284 | Bacteria | 160070 |
| 168 | Ga0209130_1000438 | 3300025284 | Bacteria | 44389 |
| 169 | Ga0209130_1006830 | 3300025284 | Bacteria | 3634 |
| 170 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 171 | Ga0209675_1000621 | 3300025291 | Bacteria | 25338 |
| 172 | Ga0209675_1004929 | 3300025291 | Bacteria | 5760 |
| 173 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 174 | Ga0209025_1011738 | 3300025294 | Bacteria | 5718 |
| 175 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 176 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 177 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 178 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 179 | Ga0209564_1000311 | 3300025295 | Bacteria | 95587 |
| 180 | Ga0209564_1002802 | 3300025295 | Bacteria | 12975 |
| 181 | Ga0209564_1003059 | 3300025295 | Bacteria | 11886 |
| 182 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 183 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 184 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 185 | Ga0209758_1000950 | 3300025297 | Bacteria | 39087 |
| 186 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 187 | Ga0209050_1000138 | 3300025298 | Bacteria | 173923 |
| 188 | Ga0209050_1000248 | 3300025298 | Bacteria | 116319 |
| 189 | Ga0209050_1001215 | 3300025298 | Bacteria | 30104 |
| 190 | Ga0209050_1004162 | 3300025298 | Bacteria | 10019 |
| 191 | Ga0209050_1009360 | 3300025298 | Bacteria | 5024 |
| 192 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 193 | Ga0209256_1000068 | 3300025299 | Bacteria | 246064 |
| 194 | Ga0209256_1000255 | 3300025299 | Bacteria | 94783 |
| 195 | Ga0209256_1000271 | 3300025299 | Bacteria | 90540 |
| 196 | Ga0209256_1000295 | 3300025299 | Bacteria | 87239 |
| 197 | Ga0209256_1000957 | 3300025299 | Bacteria | 34943 |
| 198 | Ga0207426_1006138 | 3300025302 | Bacteria | 5291 |
| 199 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 200 | Ga0209051_1013404 | 3300025303 | Bacteria | 3903 |
| 201 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 202 | Ga0209257_1000360 | 3300025304 | Bacteria | 92894 |
| 203 | Ga0209257_1005836 | 3300025304 | Bacteria | 8348 |
| 204 | Ga0207655_1014025 | 3300025728 | Bacteria | 4560 |
| 205 | Ga0207655_1030673 | 3300025728 | Bacteria | 2495 |
| 206 | Ga0207705_10005829 | 3300025909 | Bacteria | 9176 |
| 207 | Ga0207654_10004484 | 3300025911 | Bacteria | 7049 |
| 208 | Ga0207654_10236255 | 3300025911 | Bacteria | 1219 |
| 209 | Ga0207695_10003419 | 3300025913 | Bacteria | 22406 |
| 210 | Ga0207695_10041245 | 3300025913 | Bacteria | 4941 |
| 211 | Ga0207657_10010492 | 3300025919 | Bacteria | 9240 |
| 212 | Ga0207657_10043211 | 3300025919 | Bacteria | 3972 |
| 213 | Ga0207657_10155165 | 3300025919 | Bacteria | 1862 |
| 214 | Ga0207649_10000131 | 3300025920 | Bacteria | 63801 |
| 215 | Ga0207690_10020173 | 3300025932 | Bacteria | 4114 |
| 216 | Ga0207706_10238402 | 3300025933 | Bacteria | 1590 |
| 217 | Ga0207686_10084299 | 3300025934 | Bacteria | 2082 |
| 218 | Ga0207709_10009729 | 3300025935 | Bacteria | 5297 |
| 219 | Ga0207704_10124672 | 3300025938 | Bacteria | 1771 |
| 220 | Ga0207665_10040684 | 3300025939 | Bacteria | 3102 |
| 221 | Ga0207665_10188651 | 3300025939 | Unclassified | 1497 |
| 222 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 223 | Ga0207679_10010718 | 3300025945 | Bacteria | 5912 |
| 224 | Ga0207679_10048717 | 3300025945 | Bacteria | 3086 |
| 225 | Ga0207679_10085841 | 3300025945 | Bacteria | 2419 |
| 226 | Ga0207667_10059113 | 3300025949 | Bacteria | 4017 |
| 227 | Ga0207667_10112262 | 3300025949 | Bacteria | 2811 |
| 228 | Ga0207640_10000121 | 3300025981 | Bacteria | 59308 |
| 229 | Ga0207640_10206926 | 3300025981 | Bacteria | 1491 |
| 230 | Ga0207678_10000003 | 3300026067 | Bacteria | 282716 |
| 231 | Ga0207702_10000010 | 3300026078 | Bacteria | 292789 |
| 232 | Ga0207674_10017674 | 3300026116 | Bacteria | 7774 |
| 233 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 234 | Ga0209281_1008607 | 3300027111 | Bacteria | 2461 |
| 235 | Ga0209179_1013680 | 3300027512 | Bacteria | 1478 |
| 236 | Ga0209974_10003986 | 3300027876 | Bacteria | 5281 |
| 237 | Ga0265323_10011065 | 3300028653 | Bacteria | 3647 |
| 238 | Ga0316177_1166234 | 3300030731 | Bacteria | 3330 |
| 239 | Ga0316177_1182650 | 3300030731 | Bacteria | 1209 |
| 240 | Ga0316180_1007102 | 3300030736 | Bacteria | 1842 |
| 241 | Ga0316181_1223875 | 3300030744 | Bacteria | 1573 |
| 242 | Ga0265760_10022582 | 3300031090 | Bacteria | 1823 |
| 243 | Ga0265328_10026794 | 3300031239 | Bacteria | 2165 |
| 244 | Ga0265327_10000056 | 3300031251 | Bacteria | 243974 |
| 245 | Ga0307513_10054483 | 3300031456 | Bacteria | 4288 |
| 246 | Ga0307408_100001935 | 3300031548 | Bacteria | 15022 |
| 247 | Ga0307408_100002737 | 3300031548 | Bacteria | 12237 |
| 248 | Ga0307408_100025215 | 3300031548 | Bacteria | 4071 |
| 249 | Ga0307416_100122759 | 3300032002 | Bacteria | 2319 |
| 250 | Ga0307411_10218573 | 3300032005 | Bacteria | 1477 |
| 251 | Ga0373939_0051271 | 3300035114 | Bacteria | 1282 |
| 252 | Ga0395899_0000581 | 3300037312 | Bacteria | 38482 |
| 253 | Ga0395899_0001454 | 3300037312 | Bacteria | 20187 |
| 254 | Ga0395899_0004791 | 3300037312 | Bacteria | 10544 |
| 255 | Ga0395899_0117705 | 3300037312 | Bacteria | 1906 |
| 256 | Ga0395899_0196432 | 3300037312 | Bacteria | 1409 |
| 257 | Ga0395899_0219252 | 3300037312 | Bacteria | 1318 |
| 258 | Ga0395900_0000484 | 3300037418 | Bacteria | 56481 |
| 259 | Ga0395900_0002244 | 3300037418 | Bacteria | 21506 |
| 260 | Ga0395900_0003719 | 3300037418 | Bacteria | 16391 |
| 261 | Ga0395900_0014843 | 3300037418 | Bacteria | 7938 |
| 262 | Ga0395900_0016378 | 3300037418 | Bacteria | 7557 |
| 263 | Ga0395900_0048346 | 3300037418 | Bacteria | 4382 |
| 264 | Ga0395900_0132620 | 3300037418 | Bacteria | 2552 |
| 265 | Ga0395900_0171483 | 3300037418 | Bacteria | 2208 |
| 266 | Ga0395900_0251514 | 3300037418 | Bacteria | 1768 |
| 267 | Ga0395900_0314438 | 3300037418 | Bacteria | 1548 |
| 268 | Ga0395900_0320813 | 3300037418 | Bacteria | 1529 |
| 269 | Ga0395900_0364622 | 3300037418 | Bacteria | 1415 |
| 270 | Ga0395900_0382854 | 3300037418 | Bacteria | 1374 |
| 271 | Ga0395898_0031471 | 3300037466 | Bacteria | 5300 |
| 272 | Ga0395898_0170026 | 3300037466 | Bacteria | 2083 |
| 273 | Ga0395898_0241073 | 3300037466 | Bacteria | 1724 |
| 274 | Ga0395898_0274951 | 3300037466 | Bacteria | 1606 |
| 275 | Ga0395898_0398923 | 3300037466 | Bacteria | 1311 |
| 276 | Ga0395905_0000111 | 3300037471 | Bacteria | 136345 |
| 277 | Ga0395905_0036606 | 3300037471 | Bacteria | 4609 |
| 278 | Ga0395905_0086248 | 3300037471 | Bacteria | 2942 |
| 279 | Ga0395905_0121640 | 3300037471 | Bacteria | 2454 |
| 280 | Ga0395905_0214715 | 3300037471 | Bacteria | 1802 |
| 281 | Ga0395905_0366561 | 3300037471 | Bacteria | 1333 |
| 282 | Ga0395905_0514437 | 3300037471 | Bacteria | 1097 |
| 283 | Ga0395901_0182347 | 3300038443 | Bacteria | 2202 |
| 284 | Ga0395901_0308645 | 3300038443 | Bacteria | 1639 |
| 285 | Ga0395901_0397330 | 3300038443 | Bacteria | 1416 |
| 286 | Ga0395901_0519091 | 3300038443 | Bacteria | 1210 |
| 287 | Ga0436361_0377150 | 3300039447 | Bacteria | 4975 |
| 288 | Ga0436361_0482460 | 3300039447 | Bacteria | 27559 |
| 289 | Ga0436361_0604829 | 3300039447 | Bacteria | 7063 |
| 290 | Ga0451795_0749222 | 3300041456 | Bacteria | 1335 |
| 291 | Ga0451798_0885868 | 3300041458 | Bacteria | 2018 |
| 292 | Ga0451804_0963191 | 3300041463 | Bacteria | 2161 |
| 293 | Ga0451807_1511311 | 3300041486 | Bacteria | 2532 |
| 294 | Ga0439448_0000681 | 3300042005 | Bacteria | 8114 |
| 295 | Ga0439455_0010427 | 3300042012 | Bacteria | 2043 |
| 296 | Ga0450919_000532 | 3300042121 | Bacteria | 4782 |
| 297 | Ga0450904_000226 | 3300042139 | Bacteria | 12285 |
| 298 | Ga0439458_0009509 | 3300042157 | Bacteria | 2164 |
| 299 | Ga0450918_000948 | 3300042531 | Bacteria | 6063 |
| 300 | Ga0466969_0013941 | 3300044656 | Bacteria | 4232 |
| 301 | Ga0466969_0025166 | 3300044656 | Bacteria | 3062 |
| 302 | Ga0466972_0000018 | 3300044658 | Bacteria | 199161 |
| 303 | Ga0466972_0029272 | 3300044658 | Bacteria | 2711 |
| 304 | Ga0466972_0048500 | 3300044658 | Bacteria | 2051 |
| 305 | Ga0466978_0039971 | 3300044671 | Bacteria | 2901 |
| 306 | Ga0466965_0008358 | 3300044683 | Bacteria | 4787 |
| 307 | Ga0466965_0015432 | 3300044683 | Bacteria | 3629 |
| 308 | Ga0466965_0021746 | 3300044683 | Bacteria | 3090 |
| 309 | Ga0466966_0004557 | 3300044684 | Bacteria | 9131 |
| 310 | Ga0466966_0033361 | 3300044684 | Bacteria | 3333 |
| 311 | Ga0466966_0074032 | 3300044684 | Bacteria | 2129 |
| 312 | Ga0466961_0000035 | 3300044693 | Bacteria | 82931 |
| 313 | Ga0466961_0057316 | 3300044693 | Bacteria | 2480 |
| 314 | Ga0466963_0010873 | 3300044694 | Bacteria | 5526 |
| 315 | Ga0466964_0000193 | 3300044706 | Bacteria | 16911 |
| 316 | Ga0466964_0002262 | 3300044706 | Bacteria | 6822 |
| 317 | Ga0466964_0015269 | 3300044706 | Bacteria | 2922 |
| 318 | Ga0466964_0021363 | 3300044706 | Bacteria | 2503 |
| 319 | Ga0466964_0103584 | 3300044706 | Bacteria | 1258 |
| 320 | Ga0453684_0040621 | 3300044712 | Bacteria | 6312 |
| 321 | Ga0466968_0001597 | 3300044735 | Bacteria | 8177 |
| 322 | Ga0466968_0016900 | 3300044735 | Bacteria | 2909 |
| 323 | Ga0466970_0021182 | 3300044765 | Bacteria | 3385 |
| 324 | Ga0466970_0023409 | 3300044765 | Bacteria | 3225 |
| 325 | Ga0466957_0006525 | 3300044842 | Bacteria | 6589 |
| 326 | Ga0466957_0009421 | 3300044842 | Bacteria | 5577 |
| 327 | Ga0466957_0037607 | 3300044842 | Bacteria | 2914 |
| 328 | Ga0466967_0018036 | 3300045976 | Bacteria | 5628 |
| 329 | Ga0466967_0148083 | 3300045976 | Bacteria | 2191 |
| 330 | Ga0495617_002808 | 3300046452 | Bacteria | 6712 |
| 331 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 332 | Ga0495627_001166 | 3300046453 | Bacteria | 16847 |
| 333 | Ga0495627_005942 | 3300046453 | Bacteria | 4850 |
| 334 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 335 | Ga0495590_0000215 | 3300046457 | Bacteria | 31491 |
| 336 | Ga0495590_0038070 | 3300046457 | Bacteria | 1676 |
| 337 | Ga0495591_003250 | 3300046458 | Bacteria | 8536 |
| 338 | Ga0495591_040443 | 3300046458 | Bacteria | 1329 |
| 339 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 340 | Ga0495638_0000035 | 3300046460 | Bacteria | 276385 |
| 341 | Ga0495638_0007617 | 3300046460 | Bacteria | 7740 |
| 342 | Ga0495638_0018090 | 3300046460 | Bacteria | 4686 |
| 343 | Ga0495638_0018384 | 3300046460 | Bacteria | 4642 |
| 344 | Ga0495638_0200143 | 3300046460 | Bacteria | 1128 |
| 345 | Ga0495638_0242980 | 3300046460 | Bacteria | 996 |
| 346 | Ga0495653_0006487 | 3300046463 | Bacteria | 9593 |
| 347 | Ga0495653_0130992 | 3300046463 | Bacteria | 1775 |
| 348 | Ga0495653_0148055 | 3300046463 | Bacteria | 1643 |
| 349 | Ga0495650_0000044 | 3300046471 | Bacteria | 355139 |
| 350 | Ga0495650_0000066 | 3300046471 | Bacteria | 272883 |
| 351 | Ga0495650_0000159 | 3300046471 | Bacteria | 152501 |
| 352 | Ga0495650_0000299 | 3300046471 | Bacteria | 90064 |
| 353 | Ga0495650_0000376 | 3300046471 | Bacteria | 77893 |
| 354 | Ga0495650_0000762 | 3300046471 | Bacteria | 39837 |
| 355 | Ga0495650_0002387 | 3300046471 | Bacteria | 15378 |
| 356 | Ga0495650_0008054 | 3300046471 | Bacteria | 6222 |
| 357 | Ga0495650_0011738 | 3300046471 | Bacteria | 4767 |
| 358 | Ga0495580_0071871 | 3300046472 | Bacteria | 2417 |
| 359 | Ga0495582_0012187 | 3300046473 | Bacteria | 4736 |
| 360 | Ga0495605_0000027 | 3300046474 | Bacteria | 220680 |
| 361 | Ga0495605_0000081 | 3300046474 | Bacteria | 125302 |
| 362 | Ga0495605_0000087 | 3300046474 | Bacteria | 120256 |
| 363 | Ga0495605_0006810 | 3300046474 | Bacteria | 6529 |
| 364 | Ga0495605_0012102 | 3300046474 | Bacteria | 4795 |
| 365 | Ga0495605_0012366 | 3300046474 | Bacteria | 4738 |
| 366 | Ga0495605_0021237 | 3300046474 | Bacteria | 3441 |
| 367 | Ga0495605_0022354 | 3300046474 | Bacteria | 3340 |
| 368 | Ga0495605_0053317 | 3300046474 | Bacteria | 1962 |
| 369 | Ga0495639_0064868 | 3300046475 | Bacteria | 1679 |
| 370 | Ga0495584_0000284 | 3300046491 | Bacteria | 35747 |
| 371 | Ga0495584_0000656 | 3300046491 | Bacteria | 23083 |
| 372 | Ga0495584_0001086 | 3300046491 | Bacteria | 16890 |
| 373 | Ga0495584_0002251 | 3300046491 | Bacteria | 11006 |
| 374 | Ga0495584_0008430 | 3300046491 | Bacteria | 5340 |
| 375 | Ga0495584_0018670 | 3300046491 | Bacteria | 3525 |
| 376 | Ga0495584_0026465 | 3300046491 | Bacteria | 2938 |
| 377 | Ga0495584_0061937 | 3300046491 | Bacteria | 1880 |
| 378 | Ga0495585_0002659 | 3300046492 | Bacteria | 12544 |
| 379 | Ga0495585_0004022 | 3300046492 | Bacteria | 9681 |
| 380 | Ga0495585_0005099 | 3300046492 | Bacteria | 8357 |
| 381 | Ga0495585_0005608 | 3300046492 | Bacteria | 7883 |
| 382 | Ga0495585_0006411 | 3300046492 | Bacteria | 7307 |
| 383 | Ga0495585_0009675 | 3300046492 | Bacteria | 5771 |
| 384 | Ga0495585_0017246 | 3300046492 | Bacteria | 4174 |
| 385 | Ga0495585_0062429 | 3300046492 | Bacteria | 2046 |
| 386 | Ga0495585_0097775 | 3300046492 | Bacteria | 1574 |
| 387 | Ga0495585_0124613 | 3300046492 | Bacteria | 1360 |
| 388 | Ga0495594_0013361 | 3300046499 | Bacteria | 4286 |
| 389 | Ga0495594_0017430 | 3300046499 | Bacteria | 3795 |
| 390 | Ga0495594_0020311 | 3300046499 | Bacteria | 3537 |
| 391 | Ga0495594_0020960 | 3300046499 | Bacteria | 3486 |
| 392 | Ga0495596_0001025 | 3300046500 | Bacteria | 16597 |
| 393 | Ga0495596_0001303 | 3300046500 | Bacteria | 14388 |
| 394 | Ga0495596_0005349 | 3300046500 | Bacteria | 6078 |
| 395 | Ga0495596_0006643 | 3300046500 | Bacteria | 5299 |
| 396 | Ga0495596_0018016 | 3300046500 | Bacteria | 2915 |
| 397 | Ga0495596_0028655 | 3300046500 | Bacteria | 2234 |
| 398 | Ga0495596_0031312 | 3300046500 | Bacteria | 2125 |
| 399 | Ga0495607_0002642 | 3300046501 | Bacteria | 14388 |
| 400 | Ga0495607_0003259 | 3300046501 | Bacteria | 12483 |
| 401 | Ga0495607_0005410 | 3300046501 | Bacteria | 9144 |
| 402 | Ga0495607_0006251 | 3300046501 | Bacteria | 8401 |
| 403 | Ga0495607_0011211 | 3300046501 | Bacteria | 5979 |
| 404 | Ga0495607_0012494 | 3300046501 | Bacteria | 5602 |
| 405 | Ga0495607_0020085 | 3300046501 | Bacteria | 4229 |
| 406 | Ga0495607_0023228 | 3300046501 | Bacteria | 3882 |
| 407 | Ga0495607_0024157 | 3300046501 | Bacteria | 3793 |
| 408 | Ga0495607_0073202 | 3300046501 | Bacteria | 1905 |
| 409 | Ga0495607_0093533 | 3300046501 | Bacteria | 1623 |
| 410 | Ga0495607_0133937 | 3300046501 | Bacteria | 1285 |
| 411 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 412 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 413 | Ga0495583_0000021 | 3300046506 | Bacteria | 287046 |
| 414 | Ga0495583_0000241 | 3300046506 | Bacteria | 90735 |
| 415 | Ga0495583_0000889 | 3300046506 | Bacteria | 35812 |
| 416 | Ga0495583_0002552 | 3300046506 | Bacteria | 15377 |
| 417 | Ga0495583_0003576 | 3300046506 | Bacteria | 11685 |
| 418 | Ga0495583_0005082 | 3300046506 | Bacteria | 9078 |
| 419 | Ga0495583_0018529 | 3300046506 | Bacteria | 3661 |
| 420 | Ga0495583_0042030 | 3300046506 | Bacteria | 2137 |
| 421 | Ga0495583_0049299 | 3300046506 | Bacteria | 1929 |
| 422 | Ga0495583_0102905 | 3300046506 | Bacteria | 1217 |
| 423 | Ga0495583_0108587 | 3300046506 | Bacteria | 1177 |
| 424 | Ga0495606_0000015 | 3300046507 | Bacteria | 288808 |
| 425 | Ga0495606_0000103 | 3300046507 | Bacteria | 145893 |
| 426 | Ga0495606_0000132 | 3300046507 | Bacteria | 126919 |
| 427 | Ga0495606_0001376 | 3300046507 | Bacteria | 32882 |
| 428 | Ga0495606_0002672 | 3300046507 | Bacteria | 20226 |
| 429 | Ga0495606_0003996 | 3300046507 | Bacteria | 15065 |
| 430 | Ga0495606_0011112 | 3300046507 | Bacteria | 7383 |
| 431 | Ga0495606_0020832 | 3300046507 | Bacteria | 4819 |
| 432 | Ga0495606_0032198 | 3300046507 | Bacteria | 3635 |
| 433 | Ga0495606_0042741 | 3300046507 | Bacteria | 3028 |
| 434 | Ga0495606_0048860 | 3300046507 | Bacteria | 2779 |
| 435 | Ga0495606_0097559 | 3300046507 | Bacteria | 1795 |
| 436 | Ga0495606_0115159 | 3300046507 | Bacteria | 1616 |
| 437 | Ga0495606_0170628 | 3300046507 | Bacteria | 1262 |
| 438 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 439 | Ga0495610_0001892 | 3300046512 | Bacteria | 18088 |
| 440 | Ga0495610_0002550 | 3300046512 | Bacteria | 15164 |
| 441 | Ga0495610_0011619 | 3300046512 | Bacteria | 5367 |
| 442 | Ga0495610_0019698 | 3300046512 | Bacteria | 3765 |
| 443 | Ga0495610_0020090 | 3300046512 | Bacteria | 3716 |
| 444 | Ga0495610_0023194 | 3300046512 | Bacteria | 3378 |
| 445 | Ga0495610_0090544 | 3300046512 | Bacteria | 1387 |
| 446 | Ga0495616_0000262 | 3300046513 | Bacteria | 42459 |
| 447 | Ga0495616_0000814 | 3300046513 | Bacteria | 22764 |
| 448 | Ga0495616_0005469 | 3300046513 | Bacteria | 7814 |
| 449 | Ga0495616_0011598 | 3300046513 | Bacteria | 5042 |
| 450 | Ga0495616_0012089 | 3300046513 | Bacteria | 4913 |
| 451 | Ga0495616_0019243 | 3300046513 | Bacteria | 3728 |
| 452 | Ga0495616_0063574 | 3300046513 | Bacteria | 1803 |
| 453 | Ga0495616_0095234 | 3300046513 | Bacteria | 1403 |
| 454 | Ga0495630_0041577 | 3300046517 | Bacteria | 3433 |
| 455 | Ga0495631_0000612 | 3300046518 | Bacteria | 23546 |
| 456 | Ga0495631_0002259 | 3300046518 | Bacteria | 11041 |
| 457 | Ga0495631_0007858 | 3300046518 | Bacteria | 5407 |
| 458 | Ga0495631_0010695 | 3300046518 | Bacteria | 4535 |
| 459 | Ga0495631_0014433 | 3300046518 | Bacteria | 3814 |
| 460 | Ga0495631_0028193 | 3300046518 | Bacteria | 2562 |
| 461 | Ga0495631_0029324 | 3300046518 | Bacteria | 2503 |
| 462 | Ga0495632_0000040 | 3300046519 | Bacteria | 149644 |
| 463 | Ga0495632_0002350 | 3300046519 | Bacteria | 14503 |
| 464 | Ga0495632_0002654 | 3300046519 | Bacteria | 13424 |
| 465 | Ga0495632_0003323 | 3300046519 | Bacteria | 11470 |
| 466 | Ga0495632_0009849 | 3300046519 | Bacteria | 5716 |
| 467 | Ga0495632_0022738 | 3300046519 | Bacteria | 3356 |
| 468 | Ga0495632_0025628 | 3300046519 | Bacteria | 3117 |
| 469 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 470 | Ga0495637_0000524 | 3300046520 | Bacteria | 27917 |
| 471 | Ga0495637_0002085 | 3300046520 | Bacteria | 11246 |
| 472 | Ga0495637_0083141 | 3300046520 | Bacteria | 1273 |
| 473 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 474 | Ga0495643_0000117 | 3300046522 | Bacteria | 129698 |
| 475 | Ga0495643_0000192 | 3300046522 | Bacteria | 96511 |
| 476 | Ga0495643_0001148 | 3300046522 | Bacteria | 25919 |
| 477 | Ga0495643_0004686 | 3300046522 | Bacteria | 9495 |
| 478 | Ga0495643_0007442 | 3300046522 | Bacteria | 7057 |
| 479 | Ga0495643_0009654 | 3300046522 | Bacteria | 5978 |
| 480 | Ga0495643_0014817 | 3300046522 | Bacteria | 4629 |
| 481 | Ga0495643_0014957 | 3300046522 | Bacteria | 4601 |
| 482 | Ga0495643_0037964 | 3300046522 | Bacteria | 2640 |
| 483 | Ga0495643_0088116 | 3300046522 | Bacteria | 1605 |
| 484 | Ga0495643_0112784 | 3300046522 | Bacteria | 1380 |
| 485 | Ga0495644_0001210 | 3300046523 | Bacteria | 10561 |
| 486 | Ga0495644_0002559 | 3300046523 | Bacteria | 7231 |
| 487 | Ga0495644_0003758 | 3300046523 | Bacteria | 5974 |
| 488 | Ga0495644_0007894 | 3300046523 | Bacteria | 4098 |
| 489 | Ga0495644_0008115 | 3300046523 | Bacteria | 4039 |
| 490 | Ga0495644_0010949 | 3300046523 | Bacteria | 3495 |
| 491 | Ga0495644_0012012 | 3300046523 | Bacteria | 3327 |
| 492 | Ga0495648_0000571 | 3300046524 | Bacteria | 39432 |
| 493 | Ga0495648_0000719 | 3300046524 | Bacteria | 35255 |
| 494 | Ga0495648_0000875 | 3300046524 | Bacteria | 31749 |
| 495 | Ga0495648_0002832 | 3300046524 | Bacteria | 15609 |
| 496 | Ga0495648_0005134 | 3300046524 | Bacteria | 10958 |
| 497 | Ga0495648_0011418 | 3300046524 | Bacteria | 6691 |
| 498 | Ga0495648_0025099 | 3300046524 | Bacteria | 4042 |
| 499 | Ga0495648_0039003 | 3300046524 | Bacteria | 3029 |
| 500 | Ga0495648_0042043 | 3300046524 | Bacteria | 2879 |
| 501 | Ga0495648_0067721 | 3300046524 | Bacteria | 2086 |
| 502 | Ga0495648_0074753 | 3300046524 | Bacteria | 1951 |
| 503 | Ga0495663_0041722 | 3300046525 | Bacteria | 1396 |
| 504 | Ga0495666_0000268 | 3300046526 | Bacteria | 22520 |
| 505 | Ga0495666_0023693 | 3300046526 | Bacteria | 3035 |
| 506 | Ga0495666_0037333 | 3300046526 | Bacteria | 2363 |
| 507 | Ga0495666_0050727 | 3300046526 | Bacteria | 1994 |
| 508 | Ga0495642_0000057 | 3300046528 | Bacteria | 66980 |
| 509 | Ga0495642_0001072 | 3300046528 | Bacteria | 12654 |
| 510 | Ga0495642_0001279 | 3300046528 | Bacteria | 11358 |
| 511 | Ga0495642_0003386 | 3300046528 | Bacteria | 6295 |
| 512 | Ga0495642_0005390 | 3300046528 | Bacteria | 4908 |
| 513 | Ga0495642_0012173 | 3300046528 | Bacteria | 3314 |
| 514 | Ga0495642_0012459 | 3300046528 | Bacteria | 3278 |
| 515 | Ga0495642_0017136 | 3300046528 | Bacteria | 2829 |
| 516 | Ga0495642_0018026 | 3300046528 | Bacteria | 2760 |
| 517 | Ga0495642_0019849 | 3300046528 | Bacteria | 2635 |
| 518 | Ga0495642_0022708 | 3300046528 | Bacteria | 2473 |
| 519 | Ga0495642_0028351 | 3300046528 | Bacteria | 2230 |
| 520 | Ga0495642_0033201 | 3300046528 | Bacteria | 2074 |
| 521 | Ga0495642_0053633 | 3300046528 | Bacteria | 1662 |
| 522 | Ga0495652_0013194 | 3300046529 | Bacteria | 7438 |
| 523 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 524 | Ga0495654_0012228 | 3300046530 | Bacteria | 4616 |
| 525 | Ga0495654_0013859 | 3300046530 | Bacteria | 4303 |
| 526 | Ga0495654_0026607 | 3300046530 | Bacteria | 2972 |
| 527 | Ga0495654_0050495 | 3300046530 | Bacteria | 2032 |
| 528 | Ga0495654_0058003 | 3300046530 | Bacteria | 1869 |
| 529 | Ga0495665_0002647 | 3300046531 | Bacteria | 9661 |
| 530 | Ga0495665_0005143 | 3300046531 | Bacteria | 7055 |
| 531 | Ga0495665_0030522 | 3300046531 | Bacteria | 2885 |
| 532 | Ga0495640_0017995 | 3300046533 | Bacteria | 5254 |
| 533 | Ga0495640_0108935 | 3300046533 | Bacteria | 1812 |
| 534 | Ga0495586_0019673 | 3300046535 | Bacteria | 3596 |
| 535 | Ga0495586_0049651 | 3300046535 | Bacteria | 2268 |
| 536 | Ga0495586_0110386 | 3300046535 | Bacteria | 1530 |
| 537 | Ga0495587_0041172 | 3300046536 | Bacteria | 2757 |
| 538 | Ga0495609_0000096 | 3300046538 | Bacteria | 104135 |
| 539 | Ga0495609_0000607 | 3300046538 | Bacteria | 28034 |
| 540 | Ga0495609_0001057 | 3300046538 | Bacteria | 19309 |
| 541 | Ga0495609_0001889 | 3300046538 | Bacteria | 13364 |
| 542 | Ga0495609_0002159 | 3300046538 | Bacteria | 12358 |
| 543 | Ga0495609_0003723 | 3300046538 | Bacteria | 8611 |
| 544 | Ga0495609_0005033 | 3300046538 | Bacteria | 7068 |
| 545 | Ga0495609_0008527 | 3300046538 | Bacteria | 5018 |
| 546 | Ga0495609_0009819 | 3300046538 | Bacteria | 4615 |
| 547 | Ga0495609_0019233 | 3300046538 | Bacteria | 3162 |
| 548 | Ga0495609_0028945 | 3300046538 | Bacteria | 2525 |
| 549 | Ga0495609_0036056 | 3300046538 | Bacteria | 2235 |
| 550 | Ga0495609_0043056 | 3300046538 | Bacteria | 2027 |
| 551 | Ga0495597_0000146 | 3300046542 | Bacteria | 62336 |
| 552 | Ga0495597_0000357 | 3300046542 | Bacteria | 40721 |
| 553 | Ga0495597_0000447 | 3300046542 | Bacteria | 35347 |
| 554 | Ga0495597_0001332 | 3300046542 | Bacteria | 18000 |
| 555 | Ga0495597_0002318 | 3300046542 | Bacteria | 12345 |
| 556 | Ga0495597_0013016 | 3300046542 | Bacteria | 3995 |
| 557 | Ga0495597_0023419 | 3300046542 | Bacteria | 2855 |
| 558 | Ga0495597_0063989 | 3300046542 | Bacteria | 1598 |
| 559 | Ga0495622_0000012 | 3300046557 | Bacteria | 189011 |
| 560 | Ga0495622_0000281 | 3300046557 | Bacteria | 38709 |
| 561 | Ga0495622_0008632 | 3300046557 | Bacteria | 4723 |
| 562 | Ga0495622_0126300 | 3300046557 | Bacteria | 1166 |
| 563 | Ga0495633_0000375 | 3300046558 | Bacteria | 47710 |
| 564 | Ga0495633_0000377 | 3300046558 | Bacteria | 47490 |
| 565 | Ga0495633_0002006 | 3300046558 | Bacteria | 14734 |
| 566 | Ga0495633_0002910 | 3300046558 | Bacteria | 11743 |
| 567 | Ga0495633_0003466 | 3300046558 | Bacteria | 10490 |
| 568 | Ga0495633_0004824 | 3300046558 | Bacteria | 8453 |
| 569 | Ga0495633_0006501 | 3300046558 | Bacteria | 6918 |
| 570 | Ga0495633_0006512 | 3300046558 | Bacteria | 6904 |
| 571 | Ga0495633_0017132 | 3300046558 | Bacteria | 3713 |
| 572 | Ga0495633_0046218 | 3300046558 | Bacteria | 2060 |
| 573 | Ga0495633_0078927 | 3300046558 | Bacteria | 1532 |
| 574 | Ga0495656_0003512 | 3300046615 | Bacteria | 5304 |
| 575 | Ga0495656_0014365 | 3300046615 | Bacteria | 2968 |
| 576 | Ga0495656_0031351 | 3300046615 | Bacteria | 2156 |
| 577 | Ga0495656_0126376 | 3300046615 | Bacteria | 1212 |
| 578 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 579 | Ga0495668_0000038 | 3300046616 | Bacteria | 232122 |
| 580 | Ga0495668_0000394 | 3300046616 | Bacteria | 57677 |
| 581 | Ga0495668_0000606 | 3300046616 | Bacteria | 43443 |
| 582 | Ga0495668_0001536 | 3300046616 | Bacteria | 21899 |
| 583 | Ga0495668_0001656 | 3300046616 | Bacteria | 20772 |
| 584 | Ga0495668_0002352 | 3300046616 | Bacteria | 15728 |
| 585 | Ga0495668_0004518 | 3300046616 | Bacteria | 9844 |
| 586 | Ga0495668_0006974 | 3300046616 | Bacteria | 7302 |
| 587 | Ga0495668_0015959 | 3300046616 | Bacteria | 4374 |
| 588 | Ga0495668_0016325 | 3300046616 | Bacteria | 4315 |
| 589 | Ga0495668_0073873 | 3300046616 | Bacteria | 1872 |
| 590 | Ga0495668_0079666 | 3300046616 | Bacteria | 1797 |
| 591 | Ga0495668_0086846 | 3300046616 | Bacteria | 1715 |
| 592 | Ga0495668_0115725 | 3300046616 | Bacteria | 1466 |
| 593 | Ga0495634_0055594 | 3300046642 | Bacteria | 2646 |
| 594 | Ga0495611_0004070 | 3300046648 | Bacteria | 6361 |
| 595 | Ga0495611_0004871 | 3300046648 | Bacteria | 5762 |
| 596 | Ga0495611_0006178 | 3300046648 | Bacteria | 5111 |
| 597 | Ga0495611_0007082 | 3300046648 | Bacteria | 4762 |
| 598 | Ga0495611_0020589 | 3300046648 | Bacteria | 2840 |
| 599 | Ga0495611_0084447 | 3300046648 | Bacteria | 1463 |
| 600 | Ga0495625_0000488 | 3300046660 | Bacteria | 59464 |
| 601 | Ga0495625_0000516 | 3300046660 | Bacteria | 56935 |
| 602 | Ga0495625_0001664 | 3300046660 | Bacteria | 26021 |
| 603 | Ga0495625_0007421 | 3300046660 | Bacteria | 9544 |
| 604 | Ga0495625_0013188 | 3300046660 | Bacteria | 6655 |
| 605 | Ga0495625_0019224 | 3300046660 | Bacteria | 5306 |
| 606 | Ga0495625_0027778 | 3300046660 | Bacteria | 4253 |
| 607 | Ga0495625_0039967 | 3300046660 | Bacteria | 3424 |
| 608 | Ga0495625_0108500 | 3300046660 | Bacteria | 1899 |
| 609 | Ga0495625_0150652 | 3300046660 | Bacteria | 1564 |
| 610 | Ga0495625_0183528 | 3300046660 | Bacteria | 1390 |
| 611 | Ga0495659_0000008 | 3300046664 | Bacteria | 102082 |
| 612 | Ga0495659_0001397 | 3300046664 | Bacteria | 8231 |
| 613 | Ga0495659_0002919 | 3300046664 | Bacteria | 5491 |
| 614 | Ga0495659_0031699 | 3300046664 | Bacteria | 1846 |
| 615 | Ga0495661_0000252 | 3300046665 | Bacteria | 61493 |
| 616 | Ga0495661_0001204 | 3300046665 | Bacteria | 22455 |
| 617 | Ga0495661_0001940 | 3300046665 | Bacteria | 16437 |
| 618 | Ga0495661_0001951 | 3300046665 | Bacteria | 16359 |
| 619 | Ga0495661_0009650 | 3300046665 | Bacteria | 6613 |
| 620 | Ga0495661_0011326 | 3300046665 | Bacteria | 6051 |
| 621 | Ga0495661_0017639 | 3300046665 | Bacteria | 4710 |
| 622 | Ga0495661_0041429 | 3300046665 | Bacteria | 2849 |
| 623 | Ga0495661_0044131 | 3300046665 | Bacteria | 2735 |
| 624 | Ga0495661_0046118 | 3300046665 | Bacteria | 2662 |
| 625 | Ga0495661_0057901 | 3300046665 | Bacteria | 2311 |
| 626 | Ga0495661_0058159 | 3300046665 | Bacteria | 2305 |
| 627 | Ga0495661_0060729 | 3300046665 | Bacteria | 2245 |
| 628 | Ga0495661_0085590 | 3300046665 | Bacteria | 1806 |
| 629 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 630 | Ga0495588_0009321 | 3300046674 | Bacteria | 4533 |
| 631 | Ga0495588_0011957 | 3300046674 | Bacteria | 4088 |
| 632 | Ga0495588_0018467 | 3300046674 | Bacteria | 3401 |
| 633 | Ga0495588_0093430 | 3300046674 | Bacteria | 1576 |
| 634 | Ga0495588_0117422 | 3300046674 | Bacteria | 1402 |
| 635 | Ga0495623_0006925 | 3300046679 | Bacteria | 7368 |
| 636 | Ga0495623_0043564 | 3300046679 | Bacteria | 2855 |
| 637 | Ga0495623_0058165 | 3300046679 | Bacteria | 2431 |
| 638 | Ga0495669_0000117 | 3300046684 | Bacteria | 51712 |
| 639 | Ga0495669_0003025 | 3300046684 | Bacteria | 6911 |
| 640 | Ga0495669_0005350 | 3300046684 | Bacteria | 5349 |
| 641 | Ga0495669_0024815 | 3300046684 | Bacteria | 2611 |
| 642 | Ga0495669_0031443 | 3300046684 | Bacteria | 2331 |
| 643 | Ga0495669_0036339 | 3300046684 | Bacteria | 2177 |
| 644 | Ga0495669_0079492 | 3300046684 | Bacteria | 1503 |
| 645 | Ga0495613_0015998 | 3300046689 | Bacteria | 5584 |
| 646 | Ga0495670_0007099 | 3300046691 | Bacteria | 5515 |
| 647 | Ga0495670_0012121 | 3300046691 | Bacteria | 4240 |
| 648 | Ga0495670_0012732 | 3300046691 | Bacteria | 4136 |
| 649 | Ga0495670_0023725 | 3300046691 | Bacteria | 3028 |
| 650 | Ga0495670_0030116 | 3300046691 | Bacteria | 2696 |
| 651 | Ga0495670_0039099 | 3300046691 | Bacteria | 2366 |
| 652 | Ga0495670_0059741 | 3300046691 | Bacteria | 1914 |
| 653 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 654 | Ga0495671_0000080 | 3300046692 | Bacteria | 92649 |
| 655 | Ga0495671_0000181 | 3300046692 | Bacteria | 56009 |
| 656 | Ga0495671_0014707 | 3300046692 | Bacteria | 4205 |
| 657 | Ga0495671_0018306 | 3300046692 | Bacteria | 3719 |
| 658 | Ga0495671_0044539 | 3300046692 | Bacteria | 2224 |
| 659 | Ga0495671_0058739 | 3300046692 | Bacteria | 1902 |
| 660 | Ga0495671_0077783 | 3300046692 | Bacteria | 1626 |
| 661 | Ga0495671_0090874 | 3300046692 | Bacteria | 1494 |
| 662 | Ga0495649_0000236 | 3300046694 | Bacteria | 48689 |
| 663 | Ga0495649_0000427 | 3300046694 | Bacteria | 36486 |
| 664 | Ga0495649_0010742 | 3300046694 | Bacteria | 5393 |
| 665 | Ga0495649_0013362 | 3300046694 | Bacteria | 4737 |
| 666 | Ga0495649_0036911 | 3300046694 | Bacteria | 2684 |
| 667 | Ga0495649_0074611 | 3300046694 | Bacteria | 1817 |
| 668 | Ga0495589_0000036 | 3300046794 | Bacteria | 153299 |
| 669 | Ga0495589_0000216 | 3300046794 | Bacteria | 48762 |
| 670 | Ga0495589_0001075 | 3300046794 | Bacteria | 16343 |
| 671 | Ga0495589_0006669 | 3300046794 | Bacteria | 6081 |
| 672 | Ga0495589_0022474 | 3300046794 | Bacteria | 3218 |
| 673 | Ga0495589_0023668 | 3300046794 | Bacteria | 3127 |
| 674 | Ga0495589_0082011 | 3300046794 | Bacteria | 1568 |
| 675 | Ga0495660_0000816 | 3300046810 | Bacteria | 23275 |
| 676 | Ga0495660_0001684 | 3300046810 | Bacteria | 14806 |
| 677 | Ga0495660_0002482 | 3300046810 | Bacteria | 11760 |
| 678 | Ga0495660_0003435 | 3300046810 | Bacteria | 9796 |
| 679 | Ga0495660_0004868 | 3300046810 | Bacteria | 8085 |
| 680 | Ga0495660_0007317 | 3300046810 | Bacteria | 6488 |
| 681 | Ga0495660_0009142 | 3300046810 | Bacteria | 5786 |
| 682 | Ga0495660_0010489 | 3300046810 | Bacteria | 5389 |
| 683 | Ga0495660_0015568 | 3300046810 | Bacteria | 4393 |
| 684 | Ga0495660_0078012 | 3300046810 | Bacteria | 1742 |
| 685 | Ga0495660_0150918 | 3300046810 | Bacteria | 1147 |
| 686 | Ga0495581_0034275 | 3300047315 | Bacteria | 2937 |
| 687 | Ga0495604_0050480 | 3300047317 | Bacteria | 3229 |
| 688 | Ga0495604_0075673 | 3300047317 | Bacteria | 2534 |
| 689 | Ga0495604_0189388 | 3300047317 | Bacteria | 1434 |
| 690 | Ga0495636_0000238 | 3300047318 | Bacteria | 21775 |
| 691 | Ga0495636_0006514 | 3300047318 | Bacteria | 4590 |
| 692 | Ga0495636_0016569 | 3300047318 | Bacteria | 2945 |
| 693 | Ga0495636_0098264 | 3300047318 | Bacteria | 1277 |
| 694 | Ga0495672_0000022 | 3300047320 | Bacteria | 420632 |
| 695 | Ga0495672_0000095 | 3300047320 | Bacteria | 143883 |
| 696 | Ga0495672_0000337 | 3300047320 | Bacteria | 60563 |
| 697 | Ga0495672_0000602 | 3300047320 | Bacteria | 40520 |
| 698 | Ga0495672_0000621 | 3300047320 | Bacteria | 39604 |
| 699 | Ga0495672_0001813 | 3300047320 | Bacteria | 20439 |
| 700 | Ga0495672_0006978 | 3300047320 | Bacteria | 8584 |
| 701 | Ga0495672_0008498 | 3300047320 | Bacteria | 7562 |
| 702 | Ga0495672_0035785 | 3300047320 | Bacteria | 3055 |
| 703 | Ga0495672_0080746 | 3300047320 | Bacteria | 1813 |
| 704 | Ga0495676_0000035 | 3300047321 | Bacteria | 120519 |
| 705 | Ga0495676_0068685 | 3300047321 | Bacteria | 2737 |
| 706 | Ga0495680_0003304 | 3300047322 | Bacteria | 15971 |
| 707 | Ga0495680_0030531 | 3300047322 | Bacteria | 4400 |
| 708 | Ga0495683_0000758 | 3300047323 | Bacteria | 23276 |
| 709 | Ga0495683_0004529 | 3300047323 | Bacteria | 7873 |
| 710 | Ga0495683_0006758 | 3300047323 | Bacteria | 6241 |
| 711 | Ga0495683_0007411 | 3300047323 | Bacteria | 5939 |
| 712 | Ga0495683_0013472 | 3300047323 | Bacteria | 4276 |
| 713 | Ga0495683_0024659 | 3300047323 | Bacteria | 3086 |
| 714 | Ga0495683_0067578 | 3300047323 | Bacteria | 1759 |
| 715 | Ga0495683_0067963 | 3300047323 | Bacteria | 1754 |
| 716 | Ga0495683_0126914 | 3300047323 | Bacteria | 1206 |
| 717 | Ga0495687_000074 | 3300047443 | Bacteria | 153464 |
| 718 | Ga0495687_000154 | 3300047443 | Bacteria | 104740 |
| 719 | Ga0495687_000245 | 3300047443 | Bacteria | 73990 |
| 720 | Ga0495687_003388 | 3300047443 | Bacteria | 11611 |
| 721 | Ga0495687_023322 | 3300047443 | Bacteria | 2956 |
| 722 | Ga0495687_077333 | 3300047443 | Bacteria | 1314 |
| 723 | Ga0495675_0007255 | 3300047444 | Bacteria | 6828 |
| 724 | Ga0495675_0010943 | 3300047444 | Bacteria | 5684 |
| 725 | Ga0495677_0000042 | 3300047445 | Bacteria | 75189 |
| 726 | Ga0495677_0000815 | 3300047445 | Bacteria | 12607 |
| 727 | Ga0495677_0000891 | 3300047445 | Bacteria | 12019 |
| 728 | Ga0495677_0005914 | 3300047445 | Bacteria | 4634 |
| 729 | Ga0495677_0007524 | 3300047445 | Bacteria | 4066 |
| 730 | Ga0495677_0015431 | 3300047445 | Bacteria | 2774 |
| 731 | Ga0495677_0030097 | 3300047445 | Bacteria | 1975 |
| 732 | Ga0495677_0046929 | 3300047445 | Bacteria | 1585 |
| 733 | Ga0495679_009956 | 3300047446 | Bacteria | 3766 |
| 734 | Ga0495679_010228 | 3300047446 | Bacteria | 3696 |
| 735 | Ga0495679_011386 | 3300047446 | Bacteria | 3435 |
| 736 | Ga0495679_029590 | 3300047446 | Bacteria | 1785 |
| 737 | Ga0495685_000069 | 3300047447 | Bacteria | 38803 |
| 738 | Ga0495685_002279 | 3300047447 | Bacteria | 5984 |
| 739 | Ga0495685_006837 | 3300047447 | Bacteria | 3753 |
| 740 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 741 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 742 | Ga0495673_0000064 | 3300047469 | Bacteria | 225793 |
| 743 | Ga0495673_0000109 | 3300047469 | Bacteria | 166877 |
| 744 | Ga0495673_0007915 | 3300047469 | Bacteria | 6035 |
| 745 | Ga0495673_0010826 | 3300047469 | Bacteria | 4937 |
| 746 | Ga0495681_0001793 | 3300047470 | Bacteria | 15822 |
| 747 | Ga0495681_0002624 | 3300047470 | Bacteria | 12773 |
| 748 | Ga0495681_0004966 | 3300047470 | Bacteria | 8975 |
| 749 | Ga0495681_0009395 | 3300047470 | Bacteria | 6030 |
| 750 | Ga0495681_0011083 | 3300047470 | Bacteria | 5402 |
| 751 | Ga0495681_0022579 | 3300047470 | Bacteria | 3363 |
| 752 | Ga0495681_0025803 | 3300047470 | Bacteria | 3070 |
| 753 | Ga0495681_0026586 | 3300047470 | Bacteria | 3008 |
| 754 | Ga0495681_0038437 | 3300047470 | Bacteria | 2346 |
| 755 | Ga0495681_0066821 | 3300047470 | Bacteria | 1640 |
| 756 | Ga0495686_0000462 | 3300047472 | Bacteria | 61070 |
| 757 | Ga0495686_0000573 | 3300047472 | Bacteria | 52364 |
| 758 | Ga0495686_0000651 | 3300047472 | Bacteria | 47444 |
| 759 | Ga0495686_0001478 | 3300047472 | Bacteria | 25551 |
| 760 | Ga0495686_0005039 | 3300047472 | Bacteria | 10601 |
| 761 | Ga0495686_0051664 | 3300047472 | Bacteria | 2579 |
| 762 | Ga0495686_0115000 | 3300047472 | Bacteria | 1609 |
| 763 | Ga0495593_0020091 | 3300047673 | Bacteria | 3740 |
| 764 | Ga0495602_0004054 | 3300048088 | Bacteria | 15255 |
| 765 | Ga0495602_0196278 | 3300048088 | Bacteria | 1543 |
| 766 | Ga0495614_0027849 | 3300048089 | Bacteria | 2436 |
| 767 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 768 | Ga0495626_0000030 | 3300048091 | Bacteria | 202562 |
| 769 | Ga0495626_0003060 | 3300048091 | Bacteria | 10978 |
| 770 | Ga0495626_0007164 | 3300048091 | Bacteria | 6236 |
| 771 | Ga0495626_0009545 | 3300048091 | Bacteria | 5241 |
| 772 | Ga0495626_0012157 | 3300048091 | Bacteria | 4525 |
| 773 | Ga0495626_0012405 | 3300048091 | Bacteria | 4468 |
| 774 | Ga0495626_0015090 | 3300048091 | Bacteria | 3960 |
| 775 | Ga0495626_0026006 | 3300048091 | Bacteria | 2856 |
| 776 | Ga0495626_0030871 | 3300048091 | Bacteria | 2582 |
| 777 | Ga0495626_0085933 | 3300048091 | Bacteria | 1390 |
| 778 | Ga0496100_0055428 | 3300048903 | Bacteria | 2590 |
| 779 | Ga0496100_0115200 | 3300048903 | Bacteria | 1874 |
| 780 | Ga0496101_0171985 | 3300048904 | Bacteria | 1665 |
| 781 | Ga0496101_0283550 | 3300048904 | Bacteria | 1295 |
| 782 | Ga0496102_0002947 | 3300048905 | Bacteria | 14439 |
| 783 | Ga0496102_0009747 | 3300048905 | Bacteria | 8260 |
| 784 | Ga0496102_0022369 | 3300048905 | Bacteria | 5601 |
| 785 | Ga0496102_0059217 | 3300048905 | Bacteria | 3502 |
| 786 | Ga0496102_0075042 | 3300048905 | Bacteria | 3108 |
| 787 | Ga0496102_0075874 | 3300048905 | Bacteria | 3091 |
| 788 | Ga0496102_0164950 | 3300048905 | Bacteria | 2084 |
| 789 | Ga0496103_0000716 | 3300048906 | Bacteria | 24534 |
| 790 | Ga0496103_0010783 | 3300048906 | Bacteria | 5407 |
| 791 | Ga0496104_0047124 | 3300048907 | Bacteria | 4062 |
| 792 | Ga0496105_0112297 | 3300048908 | Bacteria | 2249 |
| 793 | Ga0496105_0159699 | 3300048908 | Bacteria | 1851 |
| 794 | Ga0496106_0007989 | 3300048909 | Bacteria | 7817 |
| 795 | Ga0496107_0018431 | 3300048910 | Bacteria | 4915 |
| 796 | Ga0496107_0049152 | 3300048910 | Bacteria | 3039 |
| 797 | Ga0496108_0064868 | 3300048911 | Bacteria | 3077 |
| 798 | Ga0496109_0008975 | 3300048912 | Bacteria | 8515 |
| 799 | Ga0496110_0000137 | 3300048913 | Bacteria | 42167 |
| 800 | Ga0496110_0032962 | 3300048913 | Bacteria | 4478 |
| 801 | Ga0496111_0060893 | 3300048914 | Bacteria | 2736 |
| 802 | Ga0496111_0111824 | 3300048914 | Bacteria | 2012 |
| 803 | Ga0496112_0543379 | 3300048915 | Bacteria | 1096 |
| 804 | Ga0496113_0007534 | 3300048916 | Bacteria | 7015 |
| 805 | Ga0496113_0040210 | 3300048916 | Bacteria | 3445 |
| 806 | Ga0496114_0001264 | 3300048917 | Bacteria | 19117 |
| 807 | Ga0496114_0054488 | 3300048917 | Bacteria | 3335 |
| 808 | Ga0496115_0067787 | 3300048918 | Bacteria | 2887 |
| 809 | Ga0496116_0013163 | 3300048919 | Bacteria | 6694 |
| 810 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 811 | Ga0496117_0089849 | 3300048920 | Bacteria | 1982 |
| 812 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 813 | Ga0496121_0001968 | 3300048924 | Bacteria | 32687 |
| 814 | Ga0496121_0007789 | 3300048924 | Bacteria | 12827 |
| 815 | Ga0496121_0154528 | 3300048924 | Bacteria | 1685 |
| 816 | Ga0496122_0000942 | 3300048925 | Bacteria | 52834 |
| 817 | Ga0496122_0008838 | 3300048925 | Bacteria | 10753 |
| 818 | Ga0496122_0012563 | 3300048925 | Bacteria | 8408 |
| 819 | Ga0496122_0013411 | 3300048925 | Bacteria | 8024 |
| 820 | Ga0496122_0018115 | 3300048925 | Bacteria | 6525 |
| 821 | Ga0496122_0033660 | 3300048925 | Bacteria | 4210 |
| 822 | Ga0496123_0001138 | 3300048926 | Bacteria | 39752 |
| 823 | Ga0496123_0001815 | 3300048926 | Bacteria | 28098 |
| 824 | Ga0496123_0002145 | 3300048926 | Bacteria | 25215 |
| 825 | Ga0496123_0004199 | 3300048926 | Bacteria | 15390 |
| 826 | Ga0496123_0004633 | 3300048926 | Bacteria | 14287 |
| 827 | Ga0496124_0025513 | 3300048927 | Bacteria | 5353 |
| 828 | Ga0496124_0049672 | 3300048927 | Bacteria | 3577 |
| 829 | Ga0496124_0054203 | 3300048927 | Bacteria | 3395 |
| 830 | Ga0496124_0105848 | 3300048927 | Bacteria | 2272 |
| 831 | Ga0496125_0000911 | 3300048928 | Bacteria | 46657 |
| 832 | Ga0496125_0105057 | 3300048928 | Bacteria | 2066 |
| 833 | Ga0496126_0021538 | 3300048929 | Bacteria | 6294 |
| 834 | Ga0496126_0207547 | 3300048929 | Bacteria | 1651 |
| 835 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 836 | Ga0495678_000064 | 3300049459 | Bacteria | 138380 |
| 837 | Ga0495678_000450 | 3300049459 | Bacteria | 40797 |
| 838 | Ga0495678_000467 | 3300049459 | Bacteria | 40162 |
| 839 | Ga0495678_000497 | 3300049459 | Bacteria | 38848 |
| 840 | Ga0495678_000748 | 3300049459 | Bacteria | 29493 |
| 841 | Ga0495678_000980 | 3300049459 | Bacteria | 24522 |
| 842 | Ga0495678_001036 | 3300049459 | Bacteria | 23573 |
| 843 | Ga0495678_011129 | 3300049459 | Bacteria | 4323 |
| 844 | Ga0495682_0001180 | 3300049460 | Bacteria | 14899 |
| 845 | Ga0495682_0001711 | 3300049460 | Bacteria | 11145 |
| 846 | Ga0495682_0003180 | 3300049460 | Bacteria | 7382 |
| 847 | Ga0495682_0010773 | 3300049460 | Bacteria | 3528 |
| 848 | Ga0495682_0011989 | 3300049460 | Bacteria | 3331 |
| 849 | Ga0495682_0025948 | 3300049460 | Bacteria | 2178 |
| 850 | Ga0495682_0029887 | 3300049460 | Bacteria | 2018 |
| 851 | Ga0495682_0039942 | 3300049460 | Bacteria | 1721 |
| 852 | Ga0501034_0087899 | 3300049571 | Bacteria | 3107 |
| 853 | Ga0501034_0134402 | 3300049571 | Bacteria | 2455 |
| 854 | Ga0501249_001271 | 3300049679 | Bacteria | 5282 |
| 855 | Ga0501252_001330 | 3300049682 | Bacteria | 2248 |
| 856 | Ga0501269_000239 | 3300049766 | Bacteria | 16053 |
| 857 | Ga0501035_0001227 | 3300049822 | Bacteria | 26707 |
| 858 | nmdc:mga03n38_27215_c1 | 3300050490 | Bacteria | 2370 |
| 859 | nmdc:mga0k408_101832_c1 | 3300050493 | Bacteria | 1694 |
| 860 | nmdc:mga07m45_10132_c1 | 3300050496 | Bacteria | 4913 |
| 861 | nmdc:mga05p37_161714_c1 | 3300050507 | Bacteria | 2734 |
| 862 | Ga0500578_0002290 | 3300053086 | Bacteria | 16436 |
| 863 | Ga0500643_019787 | 3300053087 | Bacteria | 2211 |
| 864 | Ga0500644_0013727 | 3300053088 | Bacteria | 2268 |
| 865 | Ga0500646_0001741 | 3300053090 | Bacteria | 5719 |
| 866 | Ga0500646_0004847 | 3300053090 | Bacteria | 3407 |
| 867 | Ga0500583_0173880 | 3300053092 | Bacteria | 1072 |
| 868 | Ga0500651_0035082 | 3300053093 | Bacteria | 3161 |
| 869 | Ga0500651_0047912 | 3300053093 | Bacteria | 2686 |
| 870 | Ga0500650_0119029 | 3300053098 | Bacteria | 1231 |
| 871 | Ga0500555_014048 | 3300053103 | Bacteria | 2309 |
| 872 | Ga0500569_026107 | 3300053109 | Bacteria | 1597 |
| 873 | Ga0500594_0001255 | 3300053118 | Bacteria | 5497 |
| 874 | Ga0500618_000032 | 3300053125 | Bacteria | 126990 |
| 875 | Ga0500618_000889 | 3300053125 | Bacteria | 15807 |
| 876 | Ga0500642_0012981 | 3300053130 | Bacteria | 3043 |
| 877 | Ga0500642_0115290 | 3300053130 | Bacteria | 1255 |
| 878 | Ga0500652_001359 | 3300053131 | Bacteria | 7657 |
| 879 | Ga0500655_001143 | 3300053133 | Bacteria | 5056 |
| 880 | Ga0500658_0073117 | 3300053134 | Bacteria | 1451 |
| 881 | Ga0500568_0053703 | 3300053139 | Bacteria | 1578 |
| 882 | Ga0500586_000758 | 3300053145 | Bacteria | 6627 |
| 883 | Ga0500586_020582 | 3300053145 | Bacteria | 2068 |
| 884 | Ga0500588_0032352 | 3300053146 | Bacteria | 1516 |
| 885 | Ga0500604_0000804 | 3300053151 | Bacteria | 8664 |
| 886 | Ga0500604_0006863 | 3300053151 | Bacteria | 3012 |
| 887 | Ga0500622_0001393 | 3300053156 | Bacteria | 19473 |
| 888 | Ga0500584_083664 | 3300053726 | Bacteria | 1359 |
| 889 | Ga0500625_035098 | 3300053729 | Bacteria | 2376 |
| 890 | Ga0500645_015144 | 3300053730 | Bacteria | 2447 |
| 891 | Ga0587072_000288 | 3300059643 | Bacteria | 4696 |
| 892 | Ga0466962_0012603 | 3300061719 | Bacteria | 4067 |
| 893 | Ga0466962_0014302 | 3300061719 | Bacteria | 3824 |
| 894 | 2587727787 | 2585428057 | Bacteria | 6737412 |
| 895 | 2587733897 | 2585428058 | Bacteria | 6853932 |
| 896 | 2588292321 | 2588253510 | Bacteria | 6901809 |
| 897 | 2597030966 | 2596583598 | Bacteria | 5251611 |
| 898 | 2599445957 | 2599185178 | Bacteria | 5365746 |
| 899 | 2601667822 | 2600255292 | Bacteria | 6300551 |
| 900 | 2643787952 | 2643221554 | Bacteria | 6603920 |
| 901 | 2643797661 | 2643221556 | Bacteria | 7251154 |
| 902 | 2643972596 | 2643221592 | Bacteria | 6608788 |
| 903 | 2644026203 | 2643221603 | Bacteria | 6147767 |
| 904 | 2644138396 | 2643221625 | Bacteria | 6512927 |
| 905 | 2644212079 | 2643221638 | Bacteria | 6579467 |
| 906 | 2644253242 | 2643221645 | Bacteria | 7207331 |
| 907 | 2644273104 | 2643221648 | Bacteria | 6521465 |
| 908 | 2644355718 | 2643221664 | Bacteria | 7272945 |
| 909 | 2644470557 | 2643221684 | Bacteria | 7145183 |
| 910 | 2738742215 | 2738541280 | Bacteria | 6630198 |
| 911 | 2738828639 | 2738541297 | Bacteria | 6549566 |
| 912 | 2738841387 | 2738541300 | Bacteria | 6675882 |
| 913 | 2739152435 | 2738541357 | Bacteria | 6549408 |
| 914 | 2739194355 | 2738543003 | Bacteria | 6549560 |
| 915 | 2739272257 | 2738543018 | Bacteria | 6718814 |
| 916 | 2739320831 | 2738543026 | Bacteria | 6549408 |
| 917 | 2739339072 | 2738543029 | Bacteria | 6549249 |
| 918 | 2739341301 | 2738543030 | Bacteria | 6719714 |
| 919 | 2765571170 | 2765235838 | Bacteria | 5445269 |
| 920 | 2809144158 | 2808606418 | Bacteria | 6724496 |
| 921 | 2821132881 | 2821131069 | Bacteria | 6108407 |
| 922 | 2821135077 | 2821131069 | Bacteria | 6108407 |
| 923 | 2842714555 | 2842711865 | Bacteria | 7155354 |
| 924 | 2857550148 | 2857547612 | Bacteria | 6179999 |
| 925 | 2857558477 | 2857553236 | Bacteria | 6166726 |
| 926 | 2857563550 | 2857558681 | Bacteria | 6617694 |
| 927 | 2857568789 | 2857564685 | Bacteria | 6290584 |
| 928 | 2885082507 | 2885080285 | Bacteria | 6355622 |
| 929 | 2904427070 | 2904424332 | Bacteria | 7633521 |
| 930 | 2904542716 | 2904541872 | Bacteria | 8915136 |
| 931 | 2919480148 | 2919476304 | Bacteria | 5888696 |
| 932 | 2928059108 | 2928058823 | Bacteria | 5520022 |
| 933 | 2932411435 | 2932410948 | Bacteria | 6312192 |
| 934 | 2932418998 | 2932416698 | Bacteria | 6315112 |
| 935 | 8047678965 | 8047673197 | Bacteria | 7395230 |
| 936 | Ga0466972_0004773 | |||
| 937 | JGI24740J21852_10000908 | |||
| 938 | JGI24740J21852_10005306 | |||
| 939 | JGI25156J39149_1009127 | |||
| 940 | JGI25154J39366_1000317 | |||
| 941 | JGI25154J39366_1001547 | |||
| 942 | JGI25152J39213_1005631 | |||
| 943 | JGI25150J39212_1000956 | |||
| 944 | JGI25150J39212_1005653 | |||
| 945 | JGI25159J45721_1001022 | |||
| 946 | JGI25159J45721_1001312 | |||
| 947 | JGI25159J45721_1019022 | |||
| 948 | JGI25151J46595_10000616 | |||
| 949 | JGI25153J46596_10002329 | |||
| 950 | JGI25153J46596_10006454 | |||
| 951 | JGI25153J46596_10008710 | |||
| 952 | rootL2_10031388 | |||
| 953 | rootL2_10056599 | |||
| 954 | JGI25160J50197_1013594 | |||
| 955 | JGI25161J50226_1000930 | |||
| 956 | JGI25161J50226_1009594 | |||
| 957 | Ga0055539_1000079 | |||
| 958 | Ga0055533_1000470 | |||
| 959 | Ga0055532_1000075 | |||
| 960 | Ga0055532_1000112 | |||
| 961 | Ga0055525_1000009 | |||
| 962 | Ga0055525_1000581 | |||
| 963 | Ga0055527_1000733 | |||
| 964 | Ga0055535_1000013 | |||
| 965 | Ga0055529_1000068 | |||
| 966 | Ga0055529_1000085 | |||
| 967 | Ga0055526_1000050 | |||
| 968 | Ga0055526_1000266 | |||
| 969 | Ga0055526_1000416 | |||
| 970 | Ga0055526_1001745 | |||
| 971 | Ga0055526_1010244 | |||
| 972 | Ga0055537_1000039 | |||
| 973 | Ga0055524_1000008 | |||
| 974 | Ga0055524_1000148 | |||
| 975 | Ga0055524_1001481 | |||
| 976 | Ga0055524_1001704 | |||
| 977 | Ga0055524_1001922 | |||
| 978 | Ga0055524_1002138 | |||
| 979 | Ga0055534_1000174 | |||
| 980 | Ga0055534_1011729 | |||
| 981 | Ga0055528_1000119 | |||
| 982 | Ga0055530_10001765 | |||
| 983 | Ga0055530_10005235 | |||
| 984 | Ga0055530_10007483 | |||
| 985 | Ga0055530_10007706 | |||
| 986 | Ga0055530_10013932 | |||
| 987 | Ga0055540_1000018 | |||
| 988 | Ga0055531_10007672 | |||
| 989 | Ga0055531_10009270 | |||
| 990 | Ga0055541_1000476 | |||
| 991 | Ga0055543_1001067 | |||
| 992 | Ga0055543_1001373 | |||
| 993 | Ga0065165_1000005 | |||
| 994 | Ga0065165_1003335 | |||
| 995 | Ga0065165_1006284 | |||
| 996 | Ga0065165_1019452 | |||
| 997 | Ga0065715_10158456 | |||
| 998 | Ga0070658_10049875 | |||
| 999 | Ga0070670_100245772 | |||
| 1000 | Ga0070680_100250438 | |||
| 1001 | Ga0070660_100151901 | |||
| 1002 | Ga0070661_100000007 | |||
| 1003 | Ga0070661_100035543 | |||
| 1004 | Ga0070661_100210153 | |||
| 1005 | Ga0070659_100002470 | |||
| 1006 | Ga0070659_100045745 | |||
| 1007 | Ga0070711_100059058 | |||
| 1008 | Ga0070663_100000002 | |||
| 1009 | Ga0068855_100125378 | |||
| 1010 | Ga0070664_100000004 | |||
| 1011 | Ga0068857_100004834 | |||
| 1012 | Ga0068854_100000034 | |||
| 1013 | Ga0068856_100000051 | |||
| 1014 | Ga0081539_10005567 | |||
| 1015 | Ga0081539_10062725 | |||
| 1016 | Ga0070717_10158188 | |||
| 1017 | Ga0075363_100079316 | |||
| 1018 | Ga0075364_10069062 | |||
| 1019 | Ga0070716_100069902 | |||
| 1020 | Ga0070716_100076877 | |||
| 1021 | Ga0075362_10015690 | |||
| 1022 | Ga0075369_10028666 | |||
| 1023 | Ga0075366_10030880 | |||
| 1024 | Ga0075370_10010558 | |||
| 1025 | Ga0068865_100078895 | |||
| 1026 | Ga0079104_1000012 | |||
| 1027 | Ga0079104_1007845 | |||
| 1028 | Ga0099826_10000001 | |||
| 1029 | Ga0105244_10003629 | |||
| 1030 | Ga0105244_10007709 | |||
| 1031 | Ga0105244_10097393 | |||
| 1032 | Ga0105240_10018967 | |||
| 1033 | Ga0105240_10230511 | |||
| 1034 | Ga0105245_10160701 | |||
| 1035 | Ga0114129_10032299 | |||
| 1036 | Ga0105243_10020972 | |||
| 1037 | Ga0105242_10118988 | |||
| 1038 | Ga0105249_10335597 | |||
| 1039 | Ga0099796_10004632 | |||
| 1040 | Ga0157373_10006916 | |||
| 1041 | Ga0157371_10000001 | |||
| 1042 | Ga0157371_10000270 | |||
| 1043 | Ga0157370_10000014 | |||
| 1044 | Ga0157369_10005917 | |||
| 1045 | Ga0157372_10000032 | |||
| 1046 | Ga0182008_10000245 | |||
| 1047 | Ga0182008_10013723 | |||
| 1048 | Ga0182006_1000002 | |||
| 1049 | Ga0182006_1000029 | |||
| 1050 | Ga0182006_1001626 | |||
| 1051 | Ga0182006_1003399 | |||
| 1052 | Ga0182007_10000085 | |||
| 1053 | Ga0182005_1000002 | |||
| 1054 | Ga0182005_1000012 | |||
| 1055 | Ga0206351_10676099 | |||
| 1056 | Ga0154015_1662132 | |||
| 1057 | Ga0213872_10000032 | |||
| 1058 | Ga0213872_10003325 | |||
| 1059 | Ga0213872_10006281 | |||
| 1060 | Ga0224712_10049331 | |||
| 1061 | Ga0209436_100559 | |||
| 1062 | Ga0209784_100008 | |||
| 1063 | Ga0209784_100398 | |||
| 1064 | Ga0209784_100604 | |||
| 1065 | Ga0209566_100006 | |||
| 1066 | Ga0209566_100383 | |||
| 1067 | Ga0209566_101077 | |||
| 1068 | Ga0209674_100083 | |||
| 1069 | Ga0209674_100142 | |||
| 1070 | Ga0209672_100419 | |||
| 1071 | Ga0209147_100005 | |||
| 1072 | Ga0209563_100015 | |||
| 1073 | Ga0209563_100016 | |||
| 1074 | Ga0209563_111169 | |||
| 1075 | Ga0209258_100007 | |||
| 1076 | Ga0207425_1000001 | |||
| 1077 | Ga0207425_1000130 | |||
| 1078 | Ga0207425_1000158 | |||
| 1079 | Ga0207425_1017058 | |||
| 1080 | Ga0209646_1000007 | |||
| 1081 | Ga0209646_1000016 | |||
| 1082 | Ga0209026_1002022 | |||
| 1083 | Ga0209026_1012928 | |||
| 1084 | Ga0209677_100008 | |||
| 1085 | Ga0209677_105001 | |||
| 1086 | Ga0209148_1000051 | |||
| 1087 | Ga0209759_1003975 | |||
| 1088 | Ga0209759_1006274 | |||
| 1089 | Ga0209129_1000003 | |||
| 1090 | Ga0209129_1000169 | |||
| 1091 | Ga0209565_1000003 | |||
| 1092 | Ga0209565_1000162 | |||
| 1093 | Ga0209565_1000383 | |||
| 1094 | Ga0209565_1003444 | |||
| 1095 | Ga0209565_1009939 | |||
| 1096 | Ga0209455_1000011 | |||
| 1097 | Ga0209455_1000026 | |||
| 1098 | Ga0209673_1000003 | |||
| 1099 | Ga0209673_1005650 | |||
| 1100 | Ga0209673_1015149 | |||
| 1101 | Ga0209673_1016237 | |||
| 1102 | Ga0209130_1000084 | |||
| 1103 | Ga0209130_1000438 | |||
| 1104 | Ga0209130_1006830 | |||
| 1105 | Ga0209675_1000003 | |||
| 1106 | Ga0209675_1000621 | |||
| 1107 | Ga0209675_1004929 | |||
| 1108 | Ga0209025_1000029 | |||
| 1109 | Ga0209025_1011738 | |||
| 1110 | Ga0209564_1000002 | |||
| 1111 | Ga0209564_1000007 | |||
| 1112 | Ga0209564_1000012 | |||
| 1113 | Ga0209564_1000057 | |||
| 1114 | Ga0209564_1000311 | |||
| 1115 | Ga0209564_1002802 | |||
| 1116 | Ga0209564_1003059 | |||
| 1117 | Ga0209758_1000041 | |||
| 1118 | Ga0209758_1000214 | |||
| 1119 | Ga0209758_1000232 | |||
| 1120 | Ga0209758_1000950 | |||
| 1121 | Ga0209050_1000011 | |||
| 1122 | Ga0209050_1000138 | |||
| 1123 | Ga0209050_1000248 | |||
| 1124 | Ga0209050_1001215 | |||
| 1125 | Ga0209050_1004162 | |||
| 1126 | Ga0209050_1009360 | |||
| 1127 | Ga0209256_1000005 | |||
| 1128 | Ga0209256_1000068 | |||
| 1129 | Ga0209256_1000255 | |||
| 1130 | Ga0209256_1000271 | |||
| 1131 | Ga0209256_1000295 | |||
| 1132 | Ga0209256_1000957 | |||
| 1133 | Ga0207426_1006138 | |||
| 1134 | Ga0209051_1000004 | |||
| 1135 | Ga0209051_1013404 | |||
| 1136 | Ga0209257_1000003 | |||
| 1137 | Ga0209257_1000360 | |||
| 1138 | Ga0209257_1005836 | |||
| 1139 | Ga0207655_1014025 | |||
| 1140 | Ga0207655_1030673 | |||
| 1141 | Ga0207705_10005829 | |||
| 1142 | Ga0207654_10004484 | |||
| 1143 | Ga0207654_10236255 | |||
| 1144 | Ga0207695_10003419 | |||
| 1145 | Ga0207695_10041245 | |||
| 1146 | Ga0207657_10010492 | |||
| 1147 | Ga0207657_10043211 | |||
| 1148 | Ga0207657_10155165 | |||
| 1149 | Ga0207649_10000131 | |||
| 1150 | Ga0207690_10020173 | |||
| 1151 | Ga0207706_10238402 | |||
| 1152 | Ga0207686_10084299 | |||
| 1153 | Ga0207709_10009729 | |||
| 1154 | Ga0207704_10124672 | |||
| 1155 | Ga0207665_10040684 | |||
| 1156 | Ga0207665_10188651 | |||
| 1157 | Ga0207679_10000002 | |||
| 1158 | Ga0207679_10010718 | |||
| 1159 | Ga0207679_10048717 | |||
| 1160 | Ga0207679_10085841 | |||
| 1161 | Ga0207667_10059113 | |||
| 1162 | Ga0207667_10112262 | |||
| 1163 | Ga0207640_10000121 | |||
| 1164 | Ga0207640_10206926 | |||
| 1165 | Ga0207678_10000003 | |||
| 1166 | Ga0207702_10000010 | |||
| 1167 | Ga0207674_10017674 | |||
| 1168 | Ga0209281_1000039 | |||
| 1169 | Ga0209281_1008607 | |||
| 1170 | Ga0209179_1013680 | |||
| 1171 | Ga0209974_10003986 | |||
| 1172 | Ga0265323_10011065 | |||
| 1173 | Ga0316177_1166234 | |||
| 1174 | Ga0316177_1182650 | |||
| 1175 | Ga0316180_1007102 | |||
| 1176 | Ga0316181_1223875 | |||
| 1177 | Ga0265760_10022582 | |||
| 1178 | Ga0265328_10026794 | |||
| 1179 | Ga0265327_10000056 | |||
| 1180 | Ga0307513_10054483 | |||
| 1181 | Ga0307408_100001935 | |||
| 1182 | Ga0307408_100002737 | |||
| 1183 | Ga0307408_100025215 | |||
| 1184 | Ga0307416_100122759 | |||
| 1185 | Ga0307411_10218573 | |||
| 1186 | Ga0373939_0051271 | |||
| 1187 | Ga0395899_0000581 | |||
| 1188 | Ga0395899_0001454 | |||
| 1189 | Ga0395899_0004791 | |||
| 1190 | Ga0395899_0117705 | |||
| 1191 | Ga0395899_0196432 | |||
| 1192 | Ga0395899_0219252 | |||
| 1193 | Ga0395900_0000484 | |||
| 1194 | Ga0395900_0002244 | |||
| 1195 | Ga0395900_0003719 | |||
| 1196 | Ga0395900_0014843 | |||
| 1197 | Ga0395900_0016378 | |||
| 1198 | Ga0395900_0048346 | |||
| 1199 | Ga0395900_0132620 | |||
| 1200 | Ga0395900_0171483 | |||
| 1201 | Ga0395900_0251514 | |||
| 1202 | Ga0395900_0314438 | |||
| 1203 | Ga0395900_0320813 | |||
| 1204 | Ga0395900_0364622 | |||
| 1205 | Ga0395900_0382854 | |||
| 1206 | Ga0395898_0031471 | |||
| 1207 | Ga0395898_0170026 | |||
| 1208 | Ga0395898_0241073 | |||
| 1209 | Ga0395898_0274951 | |||
| 1210 | Ga0395898_0398923 | |||
| 1211 | Ga0395905_0000111 | |||
| 1212 | Ga0395905_0036606 | |||
| 1213 | Ga0395905_0086248 | |||
| 1214 | Ga0395905_0121640 | |||
| 1215 | Ga0395905_0214715 | |||
| 1216 | Ga0395905_0366561 | |||
| 1217 | Ga0395905_0514437 | |||
| 1218 | Ga0395901_0182347 | |||
| 1219 | Ga0395901_0308645 | |||
| 1220 | Ga0395901_0397330 | |||
| 1221 | Ga0395901_0519091 | |||
| 1222 | Ga0436361_0377150 | |||
| 1223 | Ga0436361_0482460 | |||
| 1224 | Ga0436361_0604829 | |||
| 1225 | Ga0451795_0749222 | |||
| 1226 | Ga0451798_0885868 | |||
| 1227 | Ga0451804_0963191 | |||
| 1228 | Ga0451807_1511311 | |||
| 1229 | Ga0439448_0000681 | |||
| 1230 | Ga0439455_0010427 | |||
| 1231 | Ga0450919_000532 | |||
| 1232 | Ga0450904_000226 | |||
| 1233 | Ga0439458_0009509 | |||
| 1234 | Ga0450918_000948 | |||
| 1235 | Ga0466969_0013941 | |||
| 1236 | Ga0466969_0025166 | |||
| 1237 | Ga0466972_0000018 | |||
| 1238 | Ga0466972_0029272 | |||
| 1239 | Ga0466972_0048500 | |||
| 1240 | Ga0466978_0039971 | |||
| 1241 | Ga0466965_0008358 | |||
| 1242 | Ga0466965_0015432 | |||
| 1243 | Ga0466965_0021746 | |||
| 1244 | Ga0466966_0004557 | |||
| 1245 | Ga0466966_0033361 | |||
| 1246 | Ga0466966_0074032 | |||
| 1247 | Ga0466961_0000035 | |||
| 1248 | Ga0466961_0057316 | |||
| 1249 | Ga0466963_0010873 | |||
| 1250 | Ga0466964_0000193 | |||
| 1251 | Ga0466964_0002262 | |||
| 1252 | Ga0466964_0015269 | |||
| 1253 | Ga0466964_0021363 | |||
| 1254 | Ga0466964_0103584 | |||
| 1255 | Ga0453684_0040621 | |||
| 1256 | Ga0466968_0001597 | |||
| 1257 | Ga0466968_0016900 | |||
| 1258 | Ga0466970_0021182 | |||
| 1259 | Ga0466970_0023409 | |||
| 1260 | Ga0466957_0006525 | |||
| 1261 | Ga0466957_0009421 | |||
| 1262 | Ga0466957_0037607 | |||
| 1263 | Ga0466967_0018036 | |||
| 1264 | Ga0466967_0148083 | |||
| 1265 | Ga0495617_002808 | |||
| 1266 | Ga0495627_000007 | |||
| 1267 | Ga0495627_001166 | |||
| 1268 | Ga0495627_005942 | |||
| 1269 | Ga0495590_0000010 | |||
| 1270 | Ga0495590_0000215 | |||
| 1271 | Ga0495590_0038070 | |||
| 1272 | Ga0495591_003250 | |||
| 1273 | Ga0495591_040443 | |||
| 1274 | Ga0495638_0000027 | |||
| 1275 | Ga0495638_0000035 | |||
| 1276 | Ga0495638_0007617 | |||
| 1277 | Ga0495638_0018090 | |||
| 1278 | Ga0495638_0018384 | |||
| 1279 | Ga0495638_0200143 | |||
| 1280 | Ga0495638_0242980 | |||
| 1281 | Ga0495653_0006487 | |||
| 1282 | Ga0495653_0130992 | |||
| 1283 | Ga0495653_0148055 | |||
| 1284 | Ga0495650_0000044 | |||
| 1285 | Ga0495650_0000066 | |||
| 1286 | Ga0495650_0000159 | |||
| 1287 | Ga0495650_0000299 | |||
| 1288 | Ga0495650_0000376 | |||
| 1289 | Ga0495650_0000762 | |||
| 1290 | Ga0495650_0002387 | |||
| 1291 | Ga0495650_0008054 | |||
| 1292 | Ga0495650_0011738 | |||
| 1293 | Ga0495580_0071871 | |||
| 1294 | Ga0495582_0012187 | |||
| 1295 | Ga0495605_0000027 | |||
| 1296 | Ga0495605_0000081 | |||
| 1297 | Ga0495605_0000087 | |||
| 1298 | Ga0495605_0006810 | |||
| 1299 | Ga0495605_0012102 | |||
| 1300 | Ga0495605_0012366 | |||
| 1301 | Ga0495605_0021237 | |||
| 1302 | Ga0495605_0022354 | |||
| 1303 | Ga0495605_0053317 | |||
| 1304 | Ga0495639_0064868 | |||
| 1305 | Ga0495584_0000284 | |||
| 1306 | Ga0495584_0000656 | |||
| 1307 | Ga0495584_0001086 | |||
| 1308 | Ga0495584_0002251 | |||
| 1309 | Ga0495584_0008430 | |||
| 1310 | Ga0495584_0018670 | |||
| 1311 | Ga0495584_0026465 | |||
| 1312 | Ga0495584_0061937 | |||
| 1313 | Ga0495585_0002659 | |||
| 1314 | Ga0495585_0004022 | |||
| 1315 | Ga0495585_0005099 | |||
| 1316 | Ga0495585_0005608 | |||
| 1317 | Ga0495585_0006411 | |||
| 1318 | Ga0495585_0009675 | |||
| 1319 | Ga0495585_0017246 | |||
| 1320 | Ga0495585_0062429 | |||
| 1321 | Ga0495585_0097775 | |||
| 1322 | Ga0495585_0124613 | |||
| 1323 | Ga0495594_0013361 | |||
| 1324 | Ga0495594_0017430 | |||
| 1325 | Ga0495594_0020311 | |||
| 1326 | Ga0495594_0020960 | |||
| 1327 | Ga0495596_0001025 | |||
| 1328 | Ga0495596_0001303 | |||
| 1329 | Ga0495596_0005349 | |||
| 1330 | Ga0495596_0006643 | |||
| 1331 | Ga0495596_0018016 | |||
| 1332 | Ga0495596_0028655 | |||
| 1333 | Ga0495596_0031312 | |||
| 1334 | Ga0495607_0002642 | |||
| 1335 | Ga0495607_0003259 | |||
| 1336 | Ga0495607_0005410 | |||
| 1337 | Ga0495607_0006251 | |||
| 1338 | Ga0495607_0011211 | |||
| 1339 | Ga0495607_0012494 | |||
| 1340 | Ga0495607_0020085 | |||
| 1341 | Ga0495607_0023228 | |||
| 1342 | Ga0495607_0024157 | |||
| 1343 | Ga0495607_0073202 | |||
| 1344 | Ga0495607_0093533 | |||
| 1345 | Ga0495607_0133937 | |||
| 1346 | Ga0495583_0000006 | |||
| 1347 | Ga0495583_0000008 | |||
| 1348 | Ga0495583_0000021 | |||
| 1349 | Ga0495583_0000241 | |||
| 1350 | Ga0495583_0000889 | |||
| 1351 | Ga0495583_0002552 | |||
| 1352 | Ga0495583_0003576 | |||
| 1353 | Ga0495583_0005082 | |||
| 1354 | Ga0495583_0018529 | |||
| 1355 | Ga0495583_0042030 | |||
| 1356 | Ga0495583_0049299 | |||
| 1357 | Ga0495583_0102905 | |||
| 1358 | Ga0495583_0108587 | |||
| 1359 | Ga0495606_0000015 | |||
| 1360 | Ga0495606_0000103 | |||
| 1361 | Ga0495606_0000132 | |||
| 1362 | Ga0495606_0001376 | |||
| 1363 | Ga0495606_0002672 | |||
| 1364 | Ga0495606_0003996 | |||
| 1365 | Ga0495606_0011112 | |||
| 1366 | Ga0495606_0020832 | |||
| 1367 | Ga0495606_0032198 | |||
| 1368 | Ga0495606_0042741 | |||
| 1369 | Ga0495606_0048860 | |||
| 1370 | Ga0495606_0097559 | |||
| 1371 | Ga0495606_0115159 | |||
| 1372 | Ga0495606_0170628 | |||
| 1373 | Ga0495610_0000008 | |||
| 1374 | Ga0495610_0001892 | |||
| 1375 | Ga0495610_0002550 | |||
| 1376 | Ga0495610_0011619 | |||
| 1377 | Ga0495610_0019698 | |||
| 1378 | Ga0495610_0020090 | |||
| 1379 | Ga0495610_0023194 | |||
| 1380 | Ga0495610_0090544 | |||
| 1381 | Ga0495616_0000262 | |||
| 1382 | Ga0495616_0000814 | |||
| 1383 | Ga0495616_0005469 | |||
| 1384 | Ga0495616_0011598 | |||
| 1385 | Ga0495616_0012089 | |||
| 1386 | Ga0495616_0019243 | |||
| 1387 | Ga0495616_0063574 | |||
| 1388 | Ga0495616_0095234 | |||
| 1389 | Ga0495630_0041577 | |||
| 1390 | Ga0495631_0000612 | |||
| 1391 | Ga0495631_0002259 | |||
| 1392 | Ga0495631_0007858 | |||
| 1393 | Ga0495631_0010695 | |||
| 1394 | Ga0495631_0014433 | |||
| 1395 | Ga0495631_0028193 | |||
| 1396 | Ga0495631_0029324 | |||
| 1397 | Ga0495632_0000040 | |||
| 1398 | Ga0495632_0002350 | |||
| 1399 | Ga0495632_0002654 | |||
| 1400 | Ga0495632_0003323 | |||
| 1401 | Ga0495632_0009849 | |||
| 1402 | Ga0495632_0022738 | |||
| 1403 | Ga0495632_0025628 | |||
| 1404 | Ga0495637_0000006 | |||
| 1405 | Ga0495637_0000524 | |||
| 1406 | Ga0495637_0002085 | |||
| 1407 | Ga0495637_0083141 | |||
| 1408 | Ga0495643_0000022 | |||
| 1409 | Ga0495643_0000117 | |||
| 1410 | Ga0495643_0000192 | |||
| 1411 | Ga0495643_0001148 | |||
| 1412 | Ga0495643_0004686 | |||
| 1413 | Ga0495643_0007442 | |||
| 1414 | Ga0495643_0009654 | |||
| 1415 | Ga0495643_0014817 | |||
| 1416 | Ga0495643_0014957 | |||
| 1417 | Ga0495643_0037964 | |||
| 1418 | Ga0495643_0088116 | |||
| 1419 | Ga0495643_0112784 | |||
| 1420 | Ga0495644_0001210 | |||
| 1421 | Ga0495644_0002559 | |||
| 1422 | Ga0495644_0003758 | |||
| 1423 | Ga0495644_0007894 | |||
| 1424 | Ga0495644_0008115 | |||
| 1425 | Ga0495644_0010949 | |||
| 1426 | Ga0495644_0012012 | |||
| 1427 | Ga0495648_0000571 | |||
| 1428 | Ga0495648_0000719 | |||
| 1429 | Ga0495648_0000875 | |||
| 1430 | Ga0495648_0002832 | |||
| 1431 | Ga0495648_0005134 | |||
| 1432 | Ga0495648_0011418 | |||
| 1433 | Ga0495648_0025099 | |||
| 1434 | Ga0495648_0039003 | |||
| 1435 | Ga0495648_0042043 | |||
| 1436 | Ga0495648_0067721 | |||
| 1437 | Ga0495648_0074753 | |||
| 1438 | Ga0495663_0041722 | |||
| 1439 | Ga0495666_0000268 | |||
| 1440 | Ga0495666_0023693 | |||
| 1441 | Ga0495666_0037333 | |||
| 1442 | Ga0495666_0050727 | |||
| 1443 | Ga0495642_0000057 | |||
| 1444 | Ga0495642_0001072 | |||
| 1445 | Ga0495642_0001279 | |||
| 1446 | Ga0495642_0003386 | |||
| 1447 | Ga0495642_0005390 | |||
| 1448 | Ga0495642_0012173 | |||
| 1449 | Ga0495642_0012459 | |||
| 1450 | Ga0495642_0017136 | |||
| 1451 | Ga0495642_0018026 | |||
| 1452 | Ga0495642_0019849 | |||
| 1453 | Ga0495642_0022708 | |||
| 1454 | Ga0495642_0028351 | |||
| 1455 | Ga0495642_0033201 | |||
| 1456 | Ga0495642_0053633 | |||
| 1457 | Ga0495652_0013194 | |||
| 1458 | Ga0495654_0000002 | |||
| 1459 | Ga0495654_0012228 | |||
| 1460 | Ga0495654_0013859 | |||
| 1461 | Ga0495654_0026607 | |||
| 1462 | Ga0495654_0050495 | |||
| 1463 | Ga0495654_0058003 | |||
| 1464 | Ga0495665_0002647 | |||
| 1465 | Ga0495665_0005143 | |||
| 1466 | Ga0495665_0030522 | |||
| 1467 | Ga0495640_0017995 | |||
| 1468 | Ga0495640_0108935 | |||
| 1469 | Ga0495586_0019673 | |||
| 1470 | Ga0495586_0049651 | |||
| 1471 | Ga0495586_0110386 | |||
| 1472 | Ga0495587_0041172 | |||
| 1473 | Ga0495609_0000096 | |||
| 1474 | Ga0495609_0000607 | |||
| 1475 | Ga0495609_0001057 | |||
| 1476 | Ga0495609_0001889 | |||
| 1477 | Ga0495609_0002159 | |||
| 1478 | Ga0495609_0003723 | |||
| 1479 | Ga0495609_0005033 | |||
| 1480 | Ga0495609_0008527 | |||
| 1481 | Ga0495609_0009819 | |||
| 1482 | Ga0495609_0019233 | |||
| 1483 | Ga0495609_0028945 | |||
| 1484 | Ga0495609_0036056 | |||
| 1485 | Ga0495609_0043056 | |||
| 1486 | Ga0495597_0000146 | |||
| 1487 | Ga0495597_0000357 | |||
| 1488 | Ga0495597_0000447 | |||
| 1489 | Ga0495597_0001332 | |||
| 1490 | Ga0495597_0002318 | |||
| 1491 | Ga0495597_0013016 | |||
| 1492 | Ga0495597_0023419 | |||
| 1493 | Ga0495597_0063989 | |||
| 1494 | Ga0495622_0000012 | |||
| 1495 | Ga0495622_0000281 | |||
| 1496 | Ga0495622_0008632 | |||
| 1497 | Ga0495622_0126300 | |||
| 1498 | Ga0495633_0000375 | |||
| 1499 | Ga0495633_0000377 | |||
| 1500 | Ga0495633_0002006 | |||
| 1501 | Ga0495633_0002910 | |||
| 1502 | Ga0495633_0003466 | |||
| 1503 | Ga0495633_0004824 | |||
| 1504 | Ga0495633_0006501 | |||
| 1505 | Ga0495633_0006512 | |||
| 1506 | Ga0495633_0017132 | |||
| 1507 | Ga0495633_0046218 | |||
| 1508 | Ga0495633_0078927 | |||
| 1509 | Ga0495656_0003512 | |||
| 1510 | Ga0495656_0014365 | |||
| 1511 | Ga0495656_0031351 | |||
| 1512 | Ga0495656_0126376 | |||
| 1513 | Ga0495668_0000006 | |||
| 1514 | Ga0495668_0000038 | |||
| 1515 | Ga0495668_0000394 | |||
| 1516 | Ga0495668_0000606 | |||
| 1517 | Ga0495668_0001536 | |||
| 1518 | Ga0495668_0001656 | |||
| 1519 | Ga0495668_0002352 | |||
| 1520 | Ga0495668_0004518 | |||
| 1521 | Ga0495668_0006974 | |||
| 1522 | Ga0495668_0015959 | |||
| 1523 | Ga0495668_0016325 | |||
| 1524 | Ga0495668_0073873 | |||
| 1525 | Ga0495668_0079666 | |||
| 1526 | Ga0495668_0086846 | |||
| 1527 | Ga0495668_0115725 | |||
| 1528 | Ga0495634_0055594 | |||
| 1529 | Ga0495611_0004070 | |||
| 1530 | Ga0495611_0004871 | |||
| 1531 | Ga0495611_0006178 | |||
| 1532 | Ga0495611_0007082 | |||
| 1533 | Ga0495611_0020589 | |||
| 1534 | Ga0495611_0084447 | |||
| 1535 | Ga0495625_0000488 | |||
| 1536 | Ga0495625_0000516 | |||
| 1537 | Ga0495625_0001664 | |||
| 1538 | Ga0495625_0007421 | |||
| 1539 | Ga0495625_0013188 | |||
| 1540 | Ga0495625_0019224 | |||
| 1541 | Ga0495625_0027778 | |||
| 1542 | Ga0495625_0039967 | |||
| 1543 | Ga0495625_0108500 | |||
| 1544 | Ga0495625_0150652 | |||
| 1545 | Ga0495625_0183528 | |||
| 1546 | Ga0495659_0000008 | |||
| 1547 | Ga0495659_0001397 | |||
| 1548 | Ga0495659_0002919 | |||
| 1549 | Ga0495659_0031699 | |||
| 1550 | Ga0495661_0000252 | |||
| 1551 | Ga0495661_0001204 | |||
| 1552 | Ga0495661_0001940 | |||
| 1553 | Ga0495661_0001951 | |||
| 1554 | Ga0495661_0009650 | |||
| 1555 | Ga0495661_0011326 | |||
| 1556 | Ga0495661_0017639 | |||
| 1557 | Ga0495661_0041429 | |||
| 1558 | Ga0495661_0044131 | |||
| 1559 | Ga0495661_0046118 | |||
| 1560 | Ga0495661_0057901 | |||
| 1561 | Ga0495661_0058159 | |||
| 1562 | Ga0495661_0060729 | |||
| 1563 | Ga0495661_0085590 | |||
| 1564 | Ga0495588_0000070 | |||
| 1565 | Ga0495588_0009321 | |||
| 1566 | Ga0495588_0011957 | |||
| 1567 | Ga0495588_0018467 | |||
| 1568 | Ga0495588_0093430 | |||
| 1569 | Ga0495588_0117422 | |||
| 1570 | Ga0495623_0006925 | |||
| 1571 | Ga0495623_0043564 | |||
| 1572 | Ga0495623_0058165 | |||
| 1573 | Ga0495669_0000117 | |||
| 1574 | Ga0495669_0003025 | |||
| 1575 | Ga0495669_0005350 | |||
| 1576 | Ga0495669_0024815 | |||
| 1577 | Ga0495669_0031443 | |||
| 1578 | Ga0495669_0036339 | |||
| 1579 | Ga0495669_0079492 | |||
| 1580 | Ga0495613_0015998 | |||
| 1581 | Ga0495670_0007099 | |||
| 1582 | Ga0495670_0012121 | |||
| 1583 | Ga0495670_0012732 | |||
| 1584 | Ga0495670_0023725 | |||
| 1585 | Ga0495670_0030116 | |||
| 1586 | Ga0495670_0039099 | |||
| 1587 | Ga0495670_0059741 | |||
| 1588 | Ga0495671_0000002 | |||
| 1589 | Ga0495671_0000080 | |||
| 1590 | Ga0495671_0000181 | |||
| 1591 | Ga0495671_0014707 | |||
| 1592 | Ga0495671_0018306 | |||
| 1593 | Ga0495671_0044539 | |||
| 1594 | Ga0495671_0058739 | |||
| 1595 | Ga0495671_0077783 | |||
| 1596 | Ga0495671_0090874 | |||
| 1597 | Ga0495649_0000236 | |||
| 1598 | Ga0495649_0000427 | |||
| 1599 | Ga0495649_0010742 | |||
| 1600 | Ga0495649_0013362 | |||
| 1601 | Ga0495649_0036911 | |||
| 1602 | Ga0495649_0074611 | |||
| 1603 | Ga0495589_0000036 | |||
| 1604 | Ga0495589_0000216 | |||
| 1605 | Ga0495589_0001075 | |||
| 1606 | Ga0495589_0006669 | |||
| 1607 | Ga0495589_0022474 | |||
| 1608 | Ga0495589_0023668 | |||
| 1609 | Ga0495589_0082011 | |||
| 1610 | Ga0495660_0000816 | |||
| 1611 | Ga0495660_0001684 | |||
| 1612 | Ga0495660_0002482 | |||
| 1613 | Ga0495660_0003435 | |||
| 1614 | Ga0495660_0004868 | |||
| 1615 | Ga0495660_0007317 | |||
| 1616 | Ga0495660_0009142 | |||
| 1617 | Ga0495660_0010489 | |||
| 1618 | Ga0495660_0015568 | |||
| 1619 | Ga0495660_0078012 | |||
| 1620 | Ga0495660_0150918 | |||
| 1621 | Ga0495581_0034275 | |||
| 1622 | Ga0495604_0050480 | |||
| 1623 | Ga0495604_0075673 | |||
| 1624 | Ga0495604_0189388 | |||
| 1625 | Ga0495636_0000238 | |||
| 1626 | Ga0495636_0006514 | |||
| 1627 | Ga0495636_0016569 | |||
| 1628 | Ga0495636_0098264 | |||
| 1629 | Ga0495672_0000022 | |||
| 1630 | Ga0495672_0000095 | |||
| 1631 | Ga0495672_0000337 | |||
| 1632 | Ga0495672_0000602 | |||
| 1633 | Ga0495672_0000621 | |||
| 1634 | Ga0495672_0001813 | |||
| 1635 | Ga0495672_0006978 | |||
| 1636 | Ga0495672_0008498 | |||
| 1637 | Ga0495672_0035785 | |||
| 1638 | Ga0495672_0080746 | |||
| 1639 | Ga0495676_0000035 | |||
| 1640 | Ga0495676_0068685 | |||
| 1641 | Ga0495680_0003304 | |||
| 1642 | Ga0495680_0030531 | |||
| 1643 | Ga0495683_0000758 | |||
| 1644 | Ga0495683_0004529 | |||
| 1645 | Ga0495683_0006758 | |||
| 1646 | Ga0495683_0007411 | |||
| 1647 | Ga0495683_0013472 | |||
| 1648 | Ga0495683_0024659 | |||
| 1649 | Ga0495683_0067578 | |||
| 1650 | Ga0495683_0067963 | |||
| 1651 | Ga0495683_0126914 | |||
| 1652 | Ga0495687_000074 | |||
| 1653 | Ga0495687_000154 | |||
| 1654 | Ga0495687_000245 | |||
| 1655 | Ga0495687_003388 | |||
| 1656 | Ga0495687_023322 | |||
| 1657 | Ga0495687_077333 | |||
| 1658 | Ga0495675_0007255 | |||
| 1659 | Ga0495675_0010943 | |||
| 1660 | Ga0495677_0000042 | |||
| 1661 | Ga0495677_0000815 | |||
| 1662 | Ga0495677_0000891 | |||
| 1663 | Ga0495677_0005914 | |||
| 1664 | Ga0495677_0007524 | |||
| 1665 | Ga0495677_0015431 | |||
| 1666 | Ga0495677_0030097 | |||
| 1667 | Ga0495677_0046929 | |||
| 1668 | Ga0495679_009956 | |||
| 1669 | Ga0495679_010228 | |||
| 1670 | Ga0495679_011386 | |||
| 1671 | Ga0495679_029590 | |||
| 1672 | Ga0495685_000069 | |||
| 1673 | Ga0495685_002279 | |||
| 1674 | Ga0495685_006837 | |||
| 1675 | Ga0495673_0000005 | |||
| 1676 | Ga0495673_0000012 | |||
| 1677 | Ga0495673_0000064 | |||
| 1678 | Ga0495673_0000109 | |||
| 1679 | Ga0495673_0007915 | |||
| 1680 | Ga0495673_0010826 | |||
| 1681 | Ga0495681_0001793 | |||
| 1682 | Ga0495681_0002624 | |||
| 1683 | Ga0495681_0004966 | |||
| 1684 | Ga0495681_0009395 | |||
| 1685 | Ga0495681_0011083 | |||
| 1686 | Ga0495681_0022579 | |||
| 1687 | Ga0495681_0025803 | |||
| 1688 | Ga0495681_0026586 | |||
| 1689 | Ga0495681_0038437 | |||
| 1690 | Ga0495681_0066821 | |||
| 1691 | Ga0495686_0000462 | |||
| 1692 | Ga0495686_0000573 | |||
| 1693 | Ga0495686_0000651 | |||
| 1694 | Ga0495686_0001478 | |||
| 1695 | Ga0495686_0005039 | |||
| 1696 | Ga0495686_0051664 | |||
| 1697 | Ga0495686_0115000 | |||
| 1698 | Ga0495593_0020091 | |||
| 1699 | Ga0495602_0004054 | |||
| 1700 | Ga0495602_0196278 | |||
| 1701 | Ga0495614_0027849 | |||
| 1702 | Ga0495626_0000006 | |||
| 1703 | Ga0495626_0000030 | |||
| 1704 | Ga0495626_0003060 | |||
| 1705 | Ga0495626_0007164 | |||
| 1706 | Ga0495626_0009545 | |||
| 1707 | Ga0495626_0012157 | |||
| 1708 | Ga0495626_0012405 | |||
| 1709 | Ga0495626_0015090 | |||
| 1710 | Ga0495626_0026006 | |||
| 1711 | Ga0495626_0030871 | |||
| 1712 | Ga0495626_0085933 | |||
| 1713 | Ga0496100_0055428 | |||
| 1714 | Ga0496100_0115200 | |||
| 1715 | Ga0496101_0171985 | |||
| 1716 | Ga0496101_0283550 | |||
| 1717 | Ga0496102_0002947 | |||
| 1718 | Ga0496102_0009747 | |||
| 1719 | Ga0496102_0022369 | |||
| 1720 | Ga0496102_0059217 | |||
| 1721 | Ga0496102_0075042 | |||
| 1722 | Ga0496102_0075874 | |||
| 1723 | Ga0496102_0164950 | |||
| 1724 | Ga0496103_0000716 | |||
| 1725 | Ga0496103_0010783 | |||
| 1726 | Ga0496104_0047124 | |||
| 1727 | Ga0496105_0112297 | |||
| 1728 | Ga0496105_0159699 | |||
| 1729 | Ga0496106_0007989 | |||
| 1730 | Ga0496107_0018431 | |||
| 1731 | Ga0496107_0049152 | |||
| 1732 | Ga0496108_0064868 | |||
| 1733 | Ga0496109_0008975 | |||
| 1734 | Ga0496110_0000137 | |||
| 1735 | Ga0496110_0032962 | |||
| 1736 | Ga0496111_0060893 | |||
| 1737 | Ga0496111_0111824 | |||
| 1738 | Ga0496112_0543379 | |||
| 1739 | Ga0496113_0007534 | |||
| 1740 | Ga0496113_0040210 | |||
| 1741 | Ga0496114_0001264 | |||
| 1742 | Ga0496114_0054488 | |||
| 1743 | Ga0496115_0067787 | |||
| 1744 | Ga0496116_0013163 | |||
| 1745 | Ga0496117_0000001 | |||
| 1746 | Ga0496117_0089849 | |||
| 1747 | Ga0496118_0000002 | |||
| 1748 | Ga0496121_0001968 | |||
| 1749 | Ga0496121_0007789 | |||
| 1750 | Ga0496121_0154528 | |||
| 1751 | Ga0496122_0000942 | |||
| 1752 | Ga0496122_0008838 | |||
| 1753 | Ga0496122_0012563 | |||
| 1754 | Ga0496122_0013411 | |||
| 1755 | Ga0496122_0018115 | |||
| 1756 | Ga0496122_0033660 | |||
| 1757 | Ga0496123_0001138 | |||
| 1758 | Ga0496123_0001815 | |||
| 1759 | Ga0496123_0002145 | |||
| 1760 | Ga0496123_0004199 | |||
| 1761 | Ga0496123_0004633 | |||
| 1762 | Ga0496124_0025513 | |||
| 1763 | Ga0496124_0049672 | |||
| 1764 | Ga0496124_0054203 | |||
| 1765 | Ga0496124_0105848 | |||
| 1766 | Ga0496125_0000911 | |||
| 1767 | Ga0496125_0105057 | |||
| 1768 | Ga0496126_0021538 | |||
| 1769 | Ga0496126_0207547 | |||
| 1770 | Ga0495678_000004 | |||
| 1771 | Ga0495678_000064 | |||
| 1772 | Ga0495678_000450 | |||
| 1773 | Ga0495678_000467 | |||
| 1774 | Ga0495678_000497 | |||
| 1775 | Ga0495678_000748 | |||
| 1776 | Ga0495678_000980 | |||
| 1777 | Ga0495678_001036 | |||
| 1778 | Ga0495678_011129 | |||
| 1779 | Ga0495682_0001180 | |||
| 1780 | Ga0495682_0001711 | |||
| 1781 | Ga0495682_0003180 | |||
| 1782 | Ga0495682_0010773 | |||
| 1783 | Ga0495682_0011989 | |||
| 1784 | Ga0495682_0025948 | |||
| 1785 | Ga0495682_0029887 | |||
| 1786 | Ga0495682_0039942 | |||
| 1787 | Ga0501034_0087899 | |||
| 1788 | Ga0501034_0134402 | |||
| 1789 | Ga0501249_001271 | |||
| 1790 | Ga0501252_001330 | |||
| 1791 | Ga0501269_000239 | |||
| 1792 | Ga0501035_0001227 | |||
| 1793 | nmdc:mga03n38_27215_c1 | |||
| 1794 | nmdc:mga0k408_101832_c1 | |||
| 1795 | nmdc:mga07m45_10132_c1 | |||
| 1796 | nmdc:mga05p37_161714_c1 | |||
| 1797 | Ga0500578_0002290 | |||
| 1798 | Ga0500643_019787 | |||
| 1799 | Ga0500644_0013727 | |||
| 1800 | Ga0500646_0001741 | |||
| 1801 | Ga0500646_0004847 | |||
| 1802 | Ga0500583_0173880 | |||
| 1803 | Ga0500651_0035082 | |||
| 1804 | Ga0500651_0047912 | |||
| 1805 | Ga0500650_0119029 | |||
| 1806 | Ga0500555_014048 | |||
| 1807 | Ga0500569_026107 | |||
| 1808 | Ga0500594_0001255 | |||
| 1809 | Ga0500618_000032 | |||
| 1810 | Ga0500618_000889 | |||
| 1811 | Ga0500642_0012981 | |||
| 1812 | Ga0500642_0115290 | |||
| 1813 | Ga0500652_001359 | |||
| 1814 | Ga0500655_001143 | |||
| 1815 | Ga0500658_0073117 | |||
| 1816 | Ga0500568_0053703 | |||
| 1817 | Ga0500586_000758 | |||
| 1818 | Ga0500586_020582 | |||
| 1819 | Ga0500588_0032352 | |||
| 1820 | Ga0500604_0000804 | |||
| 1821 | Ga0500604_0006863 | |||
| 1822 | Ga0500622_0001393 | |||
| 1823 | Ga0500584_083664 | |||
| 1824 | Ga0500625_035098 | |||
| 1825 | Ga0500645_015144 | |||
| 1826 | Ga0587072_000288 | |||
| 1827 | Ga0466962_0012603 | |||
| 1828 | Ga0466962_0014302 | |||
| 1829 | 2587727787 | |||
| 1830 | 2587733897 | |||
| 1831 | 2588292321 | |||
| 1832 | 2597030966 | |||
| 1833 | 2599445957 | |||
| 1834 | 2601667822 | |||
| 1835 | 2643787952 | |||
| 1836 | 2643797661 | |||
| 1837 | 2643972596 | |||
| 1838 | 2644026203 | |||
| 1839 | 2644138396 | |||
| 1840 | 2644212079 | |||
| 1841 | 2644253242 | |||
| 1842 | 2644273104 | |||
| 1843 | 2644355718 | |||
| 1844 | 2644470557 | |||
| 1845 | 2738742215 | |||
| 1846 | 2738828639 | |||
| 1847 | 2738841387 | |||
| 1848 | 2739152435 | |||
| 1849 | 2739194355 | |||
| 1850 | 2739272257 | |||
| 1851 | 2739320831 | |||
| 1852 | 2739339072 | |||
| 1853 | 2739341301 | |||
| 1854 | 2765571170 | |||
| 1855 | 2809144158 | |||
| 1856 | 2821132881 | |||
| 1857 | 2821135077 | |||
| 1858 | 2842714555 | |||
| 1859 | 2857550148 | |||
| 1860 | 2857558477 | |||
| 1861 | 2857563550 | |||
| 1862 | 2857568789 | |||
| 1863 | 2885082507 | |||
| 1864 | 2904427070 | |||
| 1865 | 2904542716 | |||
| 1866 | 2919480148 | |||
| 1867 | 2928059108 | |||
| 1868 | 2932411435 | |||
| 1869 | 2932418998 | |||
| 1870 | 8047678965 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9598 | 1 | 84 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9523 | 1 | 81 |
| 5z4z-assembly2.cif.gz_C-2 | crystal structure of pacysb ntd domain with space group c2 | 0.9518 | 4 | 84 |
| 5z4y-assembly1.cif.gz_B | crystal structure of pacysb ntd domain with space group p4 | 0.9447 | 4 | 84 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9411 | 1 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACR7_1_84_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9949 | 5 | 79 | 1.10.10.10 |
| af_P52696_4_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9856 | 4 | 84 | 1.10.10.10 |
| af_P77744_4_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9833 | 4 | 83 | 1.10.10.10 |
| af_P37682_6_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9818 | 4 | 84 | 1.10.10.10 |
| af_P30864_1_87_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9805 | 4 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A240B5D6-F1-model_v4 | D-malate degradation protein R | 0.9462 | 99 | 295 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A485CE98-F1-model_v4 | D-malate degradation protein R | 0.9458 | 89 | 292 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-K8CRU7-F1-model_v4 | deleted | 0.9442 | 112 | 292 |
|
| AF-V7DAT4-F1-model_v4 | LysR family transcriptional regulator | 0.9291 | 85 | 296 |
|
| AF-A0A240B5D6-F1-model_v4 | D-malate degradation protein R | 0.9193 | 99 | 295 |
GO:0003700
GO:0006351 GO:0043565 |