F486166

General Info

Members Datasets Scaffolds Average Seq Length
935 343 1870 316

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0004773|Ga0466972_0004773_5349_6422
Length 357
Sequence MDCSESLNNPPGIRKATMDKLQAMEVFVQVVDAGSFTRAADNMKLPKATVSTLISNLEAALTVKLLNRTTRALSVTADGAAYYERCRAILADVQDAEDSLSKTRSSASGRLRVDVPSAIGRDLLVPALPDFFKRYPDITLELGCSDRPVDLIEEGVDCVVRGGSLADSSVLVARRIGALHFMTCAAPSYLAVHGRPTHPEDLLRHLCVNYFSAKTGKVYEWDFFRDGERIQLQVPGYLAVNDSTAYHAAALSGIGIVQMPLYTARPHLDAGTLEAVLEDWCSEPVALHVMYPQNRHLSAKVRAFVEWVAELFAGHPSLQLDAVRCKDVQAAEPGTSSKEVKSKRGQRDAEAVRARAP

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
147 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
152 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
272 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
288 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
299 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
304 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
305 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
306 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
307 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
308 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
309 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
310 2643221556 Massilia sp. Root1485 Isolate Unclassified
311 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
312 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
313 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
314 2643221638 Duganella sp. Root336D2 Isolate Unclassified
315 2643221645 Massilia sp. Root351 Isolate Unclassified
316 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
317 2643221664 Massilia sp. Root418 Isolate Unclassified
318 2643221684 Massilia sp. Root133 Isolate Unclassified
319 2738541280 Massilia sp. GV090 Isolate Unclassified
320 2738541297 Duganella sp. GV083 Isolate Unclassified
321 2738541300 Massilia sp. GV016 Isolate Unclassified
322 2738541357 Duganella sp. GV053 Isolate Unclassified
323 2738543003 Duganella sp. GV066 Isolate Unclassified
324 2738543018 Massilia sp. GV045 Isolate Unclassified
325 2738543026 Duganella sp. GV089 Isolate Unclassified
326 2738543029 Duganella sp. GV039 Isolate Unclassified
327 2738543030 Massilia sp. GV097 Isolate Unclassified
328 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
329 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
330 2821131069 Duganella sp. 1224 Isolate Unclassified
331 2842711865 Duganella sp. R-73148 Isolate Unclassified
332 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
333 2857553236 Duganella sp. R-74557 Isolate Unclassified
334 2857558681 Duganella sp. R-74565 Isolate Unclassified
335 2857564685 Duganella sp. R-74599 Isolate Unclassified
336 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
337 2904424332 Duganella sp. 1411 Isolate Rhizosphere
338 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
339 2919476304 Duganella sp. 3397 Isolate Unclassified
340 2928058823 Ralstonia sp. 1138 Isolate Unclassified
341 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
342 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
343 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.97
Metatranscriptomes 0.53
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 0.53
Rhizoplane 3.96
Rhizosphere 70.7
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0004773 3300044658 Bacteria 6791
2 JGI24740J21852_10000908 3300001979 Bacteria 13122
3 JGI24740J21852_10005306 3300001979 Bacteria 5468
4 JGI25156J39149_1009127 3300002705 Bacteria 2437
5 JGI25154J39366_1000317 3300002738 Bacteria 27993
6 JGI25154J39366_1001547 3300002738 Bacteria 7974
7 JGI25152J39213_1005631 3300002773 Bacteria 3596
8 JGI25150J39212_1000956 3300002774 Bacteria 9182
9 JGI25150J39212_1005653 3300002774 Plasmid 2651
10 JGI25159J45721_1001022 3300002987 Bacteria 12014
11 JGI25159J45721_1001312 3300002987 Bacteria 10492
12 JGI25159J45721_1019022 3300002987 Unclassified 1365
13 JGI25151J46595_10000616 3300003187 Bacteria 31174
14 JGI25153J46596_10002329 3300003215 Bacteria 11017
15 JGI25153J46596_10006454 3300003215 Bacteria 5919
16 JGI25153J46596_10008710 3300003215 Bacteria 4810
17 rootL2_10031388 3300003322 Unclassified 1894
18 rootL2_10056599 3300003322 Bacteria 1613
19 JGI25160J50197_1013594 3300003354 Unclassified 2766
20 JGI25161J50226_1000930 3300003374 Bacteria 10500
21 JGI25161J50226_1009594 3300003374 Unclassified 1365
22 Ga0055539_1000079 3300003752 Bacteria 126504
23 Ga0055533_1000470 3300003756 Bacteria 15223
24 Ga0055532_1000075 3300003758 Bacteria 124604
25 Ga0055532_1000112 3300003758 Bacteria 86782
26 Ga0055525_1000009 3300003759 Bacteria 596899
27 Ga0055525_1000581 3300003759 Bacteria 15994
28 Ga0055527_1000733 3300003760 Bacteria 9280
29 Ga0055535_1000013 3300003761 Bacteria 299614
30 Ga0055529_1000068 3300003763 Bacteria 163911
31 Ga0055529_1000085 3300003763 Bacteria 140832
32 Ga0055526_1000050 3300003771 Bacteria 117283
33 Ga0055526_1000266 3300003771 Bacteria 44005
34 Ga0055526_1000416 3300003771 Bacteria 34343
35 Ga0055526_1001745 3300003771 Bacteria 15109
36 Ga0055526_1010244 3300003771 Bacteria 4385
37 Ga0055537_1000039 3300003773 Bacteria 92151
38 Ga0055524_1000008 3300003775 Bacteria 297761
39 Ga0055524_1000148 3300003775 Bacteria 83128
40 Ga0055524_1001481 3300003775 Bacteria 13408
41 Ga0055524_1001704 3300003775 Bacteria 12256
42 Ga0055524_1001922 3300003775 Bacteria 11208
43 Ga0055524_1002138 3300003775 Bacteria 10395
44 Ga0055534_1000174 3300003784 Bacteria 47983
45 Ga0055534_1011729 3300003784 Unclassified 1766
46 Ga0055528_1000119 3300003790 Bacteria 62428
47 Ga0055530_10001765 3300003791 Bacteria 15111
48 Ga0055530_10005235 3300003791 Bacteria 6266
49 Ga0055530_10007483 3300003791 Unclassified 4587
50 Ga0055530_10007706 3300003791 Unclassified 4480
51 Ga0055530_10013932 3300003791 Bacteria 2712
52 Ga0055540_1000018 3300003792 Bacteria 218360
53 Ga0055531_10007672 3300003794 Bacteria 5834
54 Ga0055531_10009270 3300003794 Bacteria 5055
55 Ga0055541_1000476 3300003841 Bacteria 11492
56 Ga0055543_1001067 3300004625 Bacteria 12099
57 Ga0055543_1001373 3300004625 Bacteria 9792
58 Ga0065165_1000005 3300005262 Bacteria 370361
59 Ga0065165_1003335 3300005262 Bacteria 11451
60 Ga0065165_1006284 3300005262 Bacteria 6299
61 Ga0065165_1019452 3300005262 Bacteria 2423
62 Ga0065715_10158456 3300005293 Bacteria 1653
63 Ga0070658_10049875 3300005327 Bacteria 3392
64 Ga0070670_100245772 3300005331 Bacteria 1558
65 Ga0070680_100250438 3300005336 Bacteria 1498
66 Ga0070660_100151901 3300005339 Bacteria 1862
67 Ga0070661_100000007 3300005344 Bacteria 202433
68 Ga0070661_100035543 3300005344 Bacteria 3618
69 Ga0070661_100210153 3300005344 Bacteria 1489
70 Ga0070659_100002470 3300005366 Bacteria 13123
71 Ga0070659_100045745 3300005366 Bacteria 3429
72 Ga0070711_100059058 3300005439 Bacteria 2661
73 Ga0070663_100000002 3300005455 Bacteria 298075
74 Ga0068855_100125378 3300005563 Bacteria 2936
75 Ga0070664_100000004 3300005564 Bacteria 298075
76 Ga0068857_100004834 3300005577 Bacteria 11416
77 Ga0068854_100000034 3300005578 Bacteria 102389
78 Ga0068856_100000051 3300005614 Bacteria 107551
79 Ga0081539_10005567 3300005985 Bacteria 12752
80 Ga0081539_10062725 3300005985 Bacteria 2030
81 Ga0070717_10158188 3300006028 Bacteria 1964
82 Ga0075363_100079316 3300006048 Bacteria 1793
83 Ga0075364_10069062 3300006051 Bacteria 2325
84 Ga0070716_100069902 3300006173 Bacteria 2059
85 Ga0070716_100076877 3300006173 Unclassified 1980
86 Ga0075362_10015690 3300006177 Bacteria 3086
87 Ga0075369_10028666 3300006186 Bacteria 2335
88 Ga0075366_10030880 3300006195 Bacteria 3151
89 Ga0075370_10010558 3300006353 Bacteria 4833
90 Ga0068865_100078895 3300006881 Bacteria 2357
91 Ga0079104_1000012 3300006946 Bacteria 355143
92 Ga0079104_1007845 3300006946 Bacteria 3808
93 Ga0099826_10000001 3300006948 Bacteria 1155201
94 Ga0105244_10003629 3300009036 Bacteria 10935
95 Ga0105244_10007709 3300009036 Bacteria 6818
96 Ga0105244_10097393 3300009036 Bacteria 1442
97 Ga0105240_10018967 3300009093 Bacteria 9211
98 Ga0105240_10230511 3300009093 Bacteria 2153
99 Ga0105245_10160701 3300009098 Bacteria 2132
100 Ga0114129_10032299 3300009147 Bacteria 7398
101 Ga0105243_10020972 3300009148 Bacteria 4958
102 Ga0105242_10118988 3300009176 Bacteria 2263
103 Ga0105249_10335597 3300009553 Unclassified 1527
104 Ga0099796_10004632 3300010159 Bacteria 3351
105 Ga0157373_10006916 3300013100 Bacteria 8444
106 Ga0157371_10000001 3300013102 Bacteria 1162285
107 Ga0157371_10000270 3300013102 Bacteria 70773
108 Ga0157370_10000014 3300013104 Bacteria 194894
109 Ga0157369_10005917 3300013105 Bacteria 14202
110 Ga0157372_10000032 3300013307 Bacteria 178666
111 Ga0182008_10000245 3300014497 Bacteria 42026
112 Ga0182008_10013723 3300014497 Bacteria 4256
113 Ga0182006_1000002 3300015261 Bacteria 887990
114 Ga0182006_1000029 3300015261 Bacteria 247579
115 Ga0182006_1001626 3300015261 Bacteria 13287
116 Ga0182006_1003399 3300015261 Bacteria 8145
117 Ga0182007_10000085 3300015262 Bacteria 70105
118 Ga0182005_1000002 3300015265 Bacteria 908499
119 Ga0182005_1000012 3300015265 Bacteria 396944
120 Ga0206351_10676099 3300020077 Bacteria 2045
121 Ga0154015_1662132 3300020610 Bacteria 7083
122 Ga0213872_10000032 3300021361 Bacteria 138939
123 Ga0213872_10003325 3300021361 Bacteria 8961
124 Ga0213872_10006281 3300021361 Bacteria 5994
125 Ga0224712_10049331 3300022467 Bacteria 1630
126 Ga0209436_100559 3300025208 Bacteria 16062
127 Ga0209784_100008 3300025224 Bacteria 740293
128 Ga0209784_100398 3300025224 Bacteria 19803
129 Ga0209784_100604 3300025224 Bacteria 11602
130 Ga0209566_100006 3300025225 Bacteria 789272
131 Ga0209566_100383 3300025225 Bacteria 35898
132 Ga0209566_101077 3300025225 Bacteria 10725
133 Ga0209674_100083 3300025226 Bacteria 197744
134 Ga0209674_100142 3300025226 Bacteria 107750
135 Ga0209672_100419 3300025228 Bacteria 24911
136 Ga0209147_100005 3300025229 Bacteria 1036530
137 Ga0209563_100015 3300025230 Bacteria 879901
138 Ga0209563_100016 3300025230 Bacteria 802091
139 Ga0209563_111169 3300025230 Bacteria 1277
140 Ga0209258_100007 3300025242 Bacteria 1036530
141 Ga0207425_1000001 3300025245 Bacteria 2525432
142 Ga0207425_1000130 3300025245 Bacteria 70791
143 Ga0207425_1000158 3300025245 Bacteria 57310
144 Ga0207425_1017058 3300025245 Bacteria 1602
145 Ga0209646_1000007 3300025246 Bacteria 670994
146 Ga0209646_1000016 3300025246 Bacteria 501688
147 Ga0209026_1002022 3300025250 Bacteria 8038
148 Ga0209026_1012928 3300025250 Bacteria 1436
149 Ga0209677_100008 3300025253 Bacteria 802091
150 Ga0209677_105001 3300025253 Bacteria 3605
151 Ga0209148_1000051 3300025254 Bacteria 401000
152 Ga0209759_1003975 3300025256 Bacteria 5672
153 Ga0209759_1006274 3300025256 Bacteria 4021
154 Ga0209129_1000003 3300025258 Bacteria 903689
155 Ga0209129_1000169 3300025258 Bacteria 96253
156 Ga0209565_1000003 3300025263 Bacteria 1099648
157 Ga0209565_1000162 3300025263 Bacteria 89049
158 Ga0209565_1000383 3300025263 Bacteria 37599
159 Ga0209565_1003444 3300025263 Bacteria 5110
160 Ga0209565_1009939 3300025263 Bacteria 2382
161 Ga0209455_1000011 3300025272 Bacteria 947242
162 Ga0209455_1000026 3300025272 Bacteria 653778
163 Ga0209673_1000003 3300025273 Bacteria 980859
164 Ga0209673_1005650 3300025273 Bacteria 6242
165 Ga0209673_1015149 3300025273 Bacteria 2945
166 Ga0209673_1016237 3300025273 Bacteria 2793
167 Ga0209130_1000084 3300025284 Bacteria 160070
168 Ga0209130_1000438 3300025284 Bacteria 44389
169 Ga0209130_1006830 3300025284 Bacteria 3634
170 Ga0209675_1000003 3300025291 Bacteria 1003982
171 Ga0209675_1000621 3300025291 Bacteria 25338
172 Ga0209675_1004929 3300025291 Bacteria 5760
173 Ga0209025_1000029 3300025294 Bacteria 488571
174 Ga0209025_1011738 3300025294 Bacteria 5718
175 Ga0209564_1000002 3300025295 Bacteria 1636803
176 Ga0209564_1000007 3300025295 Bacteria 1028582
177 Ga0209564_1000012 3300025295 Bacteria 792078
178 Ga0209564_1000057 3300025295 Bacteria 340400
179 Ga0209564_1000311 3300025295 Bacteria 95587
180 Ga0209564_1002802 3300025295 Bacteria 12975
181 Ga0209564_1003059 3300025295 Bacteria 11886
182 Ga0209758_1000041 3300025297 Bacteria 410328
183 Ga0209758_1000214 3300025297 Bacteria 126364
184 Ga0209758_1000232 3300025297 Bacteria 117382
185 Ga0209758_1000950 3300025297 Bacteria 39087
186 Ga0209050_1000011 3300025298 Bacteria 914037
187 Ga0209050_1000138 3300025298 Bacteria 173923
188 Ga0209050_1000248 3300025298 Bacteria 116319
189 Ga0209050_1001215 3300025298 Bacteria 30104
190 Ga0209050_1004162 3300025298 Bacteria 10019
191 Ga0209050_1009360 3300025298 Bacteria 5024
192 Ga0209256_1000005 3300025299 Bacteria 1315082
193 Ga0209256_1000068 3300025299 Bacteria 246064
194 Ga0209256_1000255 3300025299 Bacteria 94783
195 Ga0209256_1000271 3300025299 Bacteria 90540
196 Ga0209256_1000295 3300025299 Bacteria 87239
197 Ga0209256_1000957 3300025299 Bacteria 34943
198 Ga0207426_1006138 3300025302 Bacteria 5291
199 Ga0209051_1000004 3300025303 Bacteria 1155596
200 Ga0209051_1013404 3300025303 Bacteria 3903
201 Ga0209257_1000003 3300025304 Bacteria 1702593
202 Ga0209257_1000360 3300025304 Bacteria 92894
203 Ga0209257_1005836 3300025304 Bacteria 8348
204 Ga0207655_1014025 3300025728 Bacteria 4560
205 Ga0207655_1030673 3300025728 Bacteria 2495
206 Ga0207705_10005829 3300025909 Bacteria 9176
207 Ga0207654_10004484 3300025911 Bacteria 7049
208 Ga0207654_10236255 3300025911 Bacteria 1219
209 Ga0207695_10003419 3300025913 Bacteria 22406
210 Ga0207695_10041245 3300025913 Bacteria 4941
211 Ga0207657_10010492 3300025919 Bacteria 9240
212 Ga0207657_10043211 3300025919 Bacteria 3972
213 Ga0207657_10155165 3300025919 Bacteria 1862
214 Ga0207649_10000131 3300025920 Bacteria 63801
215 Ga0207690_10020173 3300025932 Bacteria 4114
216 Ga0207706_10238402 3300025933 Bacteria 1590
217 Ga0207686_10084299 3300025934 Bacteria 2082
218 Ga0207709_10009729 3300025935 Bacteria 5297
219 Ga0207704_10124672 3300025938 Bacteria 1771
220 Ga0207665_10040684 3300025939 Bacteria 3102
221 Ga0207665_10188651 3300025939 Unclassified 1497
222 Ga0207679_10000002 3300025945 Bacteria 634491
223 Ga0207679_10010718 3300025945 Bacteria 5912
224 Ga0207679_10048717 3300025945 Bacteria 3086
225 Ga0207679_10085841 3300025945 Bacteria 2419
226 Ga0207667_10059113 3300025949 Bacteria 4017
227 Ga0207667_10112262 3300025949 Bacteria 2811
228 Ga0207640_10000121 3300025981 Bacteria 59308
229 Ga0207640_10206926 3300025981 Bacteria 1491
230 Ga0207678_10000003 3300026067 Bacteria 282716
231 Ga0207702_10000010 3300026078 Bacteria 292789
232 Ga0207674_10017674 3300026116 Bacteria 7774
233 Ga0209281_1000039 3300027111 Bacteria 355150
234 Ga0209281_1008607 3300027111 Bacteria 2461
235 Ga0209179_1013680 3300027512 Bacteria 1478
236 Ga0209974_10003986 3300027876 Bacteria 5281
237 Ga0265323_10011065 3300028653 Bacteria 3647
238 Ga0316177_1166234 3300030731 Bacteria 3330
239 Ga0316177_1182650 3300030731 Bacteria 1209
240 Ga0316180_1007102 3300030736 Bacteria 1842
241 Ga0316181_1223875 3300030744 Bacteria 1573
242 Ga0265760_10022582 3300031090 Bacteria 1823
243 Ga0265328_10026794 3300031239 Bacteria 2165
244 Ga0265327_10000056 3300031251 Bacteria 243974
245 Ga0307513_10054483 3300031456 Bacteria 4288
246 Ga0307408_100001935 3300031548 Bacteria 15022
247 Ga0307408_100002737 3300031548 Bacteria 12237
248 Ga0307408_100025215 3300031548 Bacteria 4071
249 Ga0307416_100122759 3300032002 Bacteria 2319
250 Ga0307411_10218573 3300032005 Bacteria 1477
251 Ga0373939_0051271 3300035114 Bacteria 1282
252 Ga0395899_0000581 3300037312 Bacteria 38482
253 Ga0395899_0001454 3300037312 Bacteria 20187
254 Ga0395899_0004791 3300037312 Bacteria 10544
255 Ga0395899_0117705 3300037312 Bacteria 1906
256 Ga0395899_0196432 3300037312 Bacteria 1409
257 Ga0395899_0219252 3300037312 Bacteria 1318
258 Ga0395900_0000484 3300037418 Bacteria 56481
259 Ga0395900_0002244 3300037418 Bacteria 21506
260 Ga0395900_0003719 3300037418 Bacteria 16391
261 Ga0395900_0014843 3300037418 Bacteria 7938
262 Ga0395900_0016378 3300037418 Bacteria 7557
263 Ga0395900_0048346 3300037418 Bacteria 4382
264 Ga0395900_0132620 3300037418 Bacteria 2552
265 Ga0395900_0171483 3300037418 Bacteria 2208
266 Ga0395900_0251514 3300037418 Bacteria 1768
267 Ga0395900_0314438 3300037418 Bacteria 1548
268 Ga0395900_0320813 3300037418 Bacteria 1529
269 Ga0395900_0364622 3300037418 Bacteria 1415
270 Ga0395900_0382854 3300037418 Bacteria 1374
271 Ga0395898_0031471 3300037466 Bacteria 5300
272 Ga0395898_0170026 3300037466 Bacteria 2083
273 Ga0395898_0241073 3300037466 Bacteria 1724
274 Ga0395898_0274951 3300037466 Bacteria 1606
275 Ga0395898_0398923 3300037466 Bacteria 1311
276 Ga0395905_0000111 3300037471 Bacteria 136345
277 Ga0395905_0036606 3300037471 Bacteria 4609
278 Ga0395905_0086248 3300037471 Bacteria 2942
279 Ga0395905_0121640 3300037471 Bacteria 2454
280 Ga0395905_0214715 3300037471 Bacteria 1802
281 Ga0395905_0366561 3300037471 Bacteria 1333
282 Ga0395905_0514437 3300037471 Bacteria 1097
283 Ga0395901_0182347 3300038443 Bacteria 2202
284 Ga0395901_0308645 3300038443 Bacteria 1639
285 Ga0395901_0397330 3300038443 Bacteria 1416
286 Ga0395901_0519091 3300038443 Bacteria 1210
287 Ga0436361_0377150 3300039447 Bacteria 4975
288 Ga0436361_0482460 3300039447 Bacteria 27559
289 Ga0436361_0604829 3300039447 Bacteria 7063
290 Ga0451795_0749222 3300041456 Bacteria 1335
291 Ga0451798_0885868 3300041458 Bacteria 2018
292 Ga0451804_0963191 3300041463 Bacteria 2161
293 Ga0451807_1511311 3300041486 Bacteria 2532
294 Ga0439448_0000681 3300042005 Bacteria 8114
295 Ga0439455_0010427 3300042012 Bacteria 2043
296 Ga0450919_000532 3300042121 Bacteria 4782
297 Ga0450904_000226 3300042139 Bacteria 12285
298 Ga0439458_0009509 3300042157 Bacteria 2164
299 Ga0450918_000948 3300042531 Bacteria 6063
300 Ga0466969_0013941 3300044656 Bacteria 4232
301 Ga0466969_0025166 3300044656 Bacteria 3062
302 Ga0466972_0000018 3300044658 Bacteria 199161
303 Ga0466972_0029272 3300044658 Bacteria 2711
304 Ga0466972_0048500 3300044658 Bacteria 2051
305 Ga0466978_0039971 3300044671 Bacteria 2901
306 Ga0466965_0008358 3300044683 Bacteria 4787
307 Ga0466965_0015432 3300044683 Bacteria 3629
308 Ga0466965_0021746 3300044683 Bacteria 3090
309 Ga0466966_0004557 3300044684 Bacteria 9131
310 Ga0466966_0033361 3300044684 Bacteria 3333
311 Ga0466966_0074032 3300044684 Bacteria 2129
312 Ga0466961_0000035 3300044693 Bacteria 82931
313 Ga0466961_0057316 3300044693 Bacteria 2480
314 Ga0466963_0010873 3300044694 Bacteria 5526
315 Ga0466964_0000193 3300044706 Bacteria 16911
316 Ga0466964_0002262 3300044706 Bacteria 6822
317 Ga0466964_0015269 3300044706 Bacteria 2922
318 Ga0466964_0021363 3300044706 Bacteria 2503
319 Ga0466964_0103584 3300044706 Bacteria 1258
320 Ga0453684_0040621 3300044712 Bacteria 6312
321 Ga0466968_0001597 3300044735 Bacteria 8177
322 Ga0466968_0016900 3300044735 Bacteria 2909
323 Ga0466970_0021182 3300044765 Bacteria 3385
324 Ga0466970_0023409 3300044765 Bacteria 3225
325 Ga0466957_0006525 3300044842 Bacteria 6589
326 Ga0466957_0009421 3300044842 Bacteria 5577
327 Ga0466957_0037607 3300044842 Bacteria 2914
328 Ga0466967_0018036 3300045976 Bacteria 5628
329 Ga0466967_0148083 3300045976 Bacteria 2191
330 Ga0495617_002808 3300046452 Bacteria 6712
331 Ga0495627_000007 3300046453 Bacteria 575915
332 Ga0495627_001166 3300046453 Bacteria 16847
333 Ga0495627_005942 3300046453 Bacteria 4850
334 Ga0495590_0000010 3300046457 Bacteria 317890
335 Ga0495590_0000215 3300046457 Bacteria 31491
336 Ga0495590_0038070 3300046457 Bacteria 1676
337 Ga0495591_003250 3300046458 Bacteria 8536
338 Ga0495591_040443 3300046458 Bacteria 1329
339 Ga0495638_0000027 3300046460 Bacteria 337569
340 Ga0495638_0000035 3300046460 Bacteria 276385
341 Ga0495638_0007617 3300046460 Bacteria 7740
342 Ga0495638_0018090 3300046460 Bacteria 4686
343 Ga0495638_0018384 3300046460 Bacteria 4642
344 Ga0495638_0200143 3300046460 Bacteria 1128
345 Ga0495638_0242980 3300046460 Bacteria 996
346 Ga0495653_0006487 3300046463 Bacteria 9593
347 Ga0495653_0130992 3300046463 Bacteria 1775
348 Ga0495653_0148055 3300046463 Bacteria 1643
349 Ga0495650_0000044 3300046471 Bacteria 355139
350 Ga0495650_0000066 3300046471 Bacteria 272883
351 Ga0495650_0000159 3300046471 Bacteria 152501
352 Ga0495650_0000299 3300046471 Bacteria 90064
353 Ga0495650_0000376 3300046471 Bacteria 77893
354 Ga0495650_0000762 3300046471 Bacteria 39837
355 Ga0495650_0002387 3300046471 Bacteria 15378
356 Ga0495650_0008054 3300046471 Bacteria 6222
357 Ga0495650_0011738 3300046471 Bacteria 4767
358 Ga0495580_0071871 3300046472 Bacteria 2417
359 Ga0495582_0012187 3300046473 Bacteria 4736
360 Ga0495605_0000027 3300046474 Bacteria 220680
361 Ga0495605_0000081 3300046474 Bacteria 125302
362 Ga0495605_0000087 3300046474 Bacteria 120256
363 Ga0495605_0006810 3300046474 Bacteria 6529
364 Ga0495605_0012102 3300046474 Bacteria 4795
365 Ga0495605_0012366 3300046474 Bacteria 4738
366 Ga0495605_0021237 3300046474 Bacteria 3441
367 Ga0495605_0022354 3300046474 Bacteria 3340
368 Ga0495605_0053317 3300046474 Bacteria 1962
369 Ga0495639_0064868 3300046475 Bacteria 1679
370 Ga0495584_0000284 3300046491 Bacteria 35747
371 Ga0495584_0000656 3300046491 Bacteria 23083
372 Ga0495584_0001086 3300046491 Bacteria 16890
373 Ga0495584_0002251 3300046491 Bacteria 11006
374 Ga0495584_0008430 3300046491 Bacteria 5340
375 Ga0495584_0018670 3300046491 Bacteria 3525
376 Ga0495584_0026465 3300046491 Bacteria 2938
377 Ga0495584_0061937 3300046491 Bacteria 1880
378 Ga0495585_0002659 3300046492 Bacteria 12544
379 Ga0495585_0004022 3300046492 Bacteria 9681
380 Ga0495585_0005099 3300046492 Bacteria 8357
381 Ga0495585_0005608 3300046492 Bacteria 7883
382 Ga0495585_0006411 3300046492 Bacteria 7307
383 Ga0495585_0009675 3300046492 Bacteria 5771
384 Ga0495585_0017246 3300046492 Bacteria 4174
385 Ga0495585_0062429 3300046492 Bacteria 2046
386 Ga0495585_0097775 3300046492 Bacteria 1574
387 Ga0495585_0124613 3300046492 Bacteria 1360
388 Ga0495594_0013361 3300046499 Bacteria 4286
389 Ga0495594_0017430 3300046499 Bacteria 3795
390 Ga0495594_0020311 3300046499 Bacteria 3537
391 Ga0495594_0020960 3300046499 Bacteria 3486
392 Ga0495596_0001025 3300046500 Bacteria 16597
393 Ga0495596_0001303 3300046500 Bacteria 14388
394 Ga0495596_0005349 3300046500 Bacteria 6078
395 Ga0495596_0006643 3300046500 Bacteria 5299
396 Ga0495596_0018016 3300046500 Bacteria 2915
397 Ga0495596_0028655 3300046500 Bacteria 2234
398 Ga0495596_0031312 3300046500 Bacteria 2125
399 Ga0495607_0002642 3300046501 Bacteria 14388
400 Ga0495607_0003259 3300046501 Bacteria 12483
401 Ga0495607_0005410 3300046501 Bacteria 9144
402 Ga0495607_0006251 3300046501 Bacteria 8401
403 Ga0495607_0011211 3300046501 Bacteria 5979
404 Ga0495607_0012494 3300046501 Bacteria 5602
405 Ga0495607_0020085 3300046501 Bacteria 4229
406 Ga0495607_0023228 3300046501 Bacteria 3882
407 Ga0495607_0024157 3300046501 Bacteria 3793
408 Ga0495607_0073202 3300046501 Bacteria 1905
409 Ga0495607_0093533 3300046501 Bacteria 1623
410 Ga0495607_0133937 3300046501 Bacteria 1285
411 Ga0495583_0000006 3300046506 Bacteria 436893
412 Ga0495583_0000008 3300046506 Bacteria 411092
413 Ga0495583_0000021 3300046506 Bacteria 287046
414 Ga0495583_0000241 3300046506 Bacteria 90735
415 Ga0495583_0000889 3300046506 Bacteria 35812
416 Ga0495583_0002552 3300046506 Bacteria 15377
417 Ga0495583_0003576 3300046506 Bacteria 11685
418 Ga0495583_0005082 3300046506 Bacteria 9078
419 Ga0495583_0018529 3300046506 Bacteria 3661
420 Ga0495583_0042030 3300046506 Bacteria 2137
421 Ga0495583_0049299 3300046506 Bacteria 1929
422 Ga0495583_0102905 3300046506 Bacteria 1217
423 Ga0495583_0108587 3300046506 Bacteria 1177
424 Ga0495606_0000015 3300046507 Bacteria 288808
425 Ga0495606_0000103 3300046507 Bacteria 145893
426 Ga0495606_0000132 3300046507 Bacteria 126919
427 Ga0495606_0001376 3300046507 Bacteria 32882
428 Ga0495606_0002672 3300046507 Bacteria 20226
429 Ga0495606_0003996 3300046507 Bacteria 15065
430 Ga0495606_0011112 3300046507 Bacteria 7383
431 Ga0495606_0020832 3300046507 Bacteria 4819
432 Ga0495606_0032198 3300046507 Bacteria 3635
433 Ga0495606_0042741 3300046507 Bacteria 3028
434 Ga0495606_0048860 3300046507 Bacteria 2779
435 Ga0495606_0097559 3300046507 Bacteria 1795
436 Ga0495606_0115159 3300046507 Bacteria 1616
437 Ga0495606_0170628 3300046507 Bacteria 1262
438 Ga0495610_0000008 3300046512 Bacteria 622732
439 Ga0495610_0001892 3300046512 Bacteria 18088
440 Ga0495610_0002550 3300046512 Bacteria 15164
441 Ga0495610_0011619 3300046512 Bacteria 5367
442 Ga0495610_0019698 3300046512 Bacteria 3765
443 Ga0495610_0020090 3300046512 Bacteria 3716
444 Ga0495610_0023194 3300046512 Bacteria 3378
445 Ga0495610_0090544 3300046512 Bacteria 1387
446 Ga0495616_0000262 3300046513 Bacteria 42459
447 Ga0495616_0000814 3300046513 Bacteria 22764
448 Ga0495616_0005469 3300046513 Bacteria 7814
449 Ga0495616_0011598 3300046513 Bacteria 5042
450 Ga0495616_0012089 3300046513 Bacteria 4913
451 Ga0495616_0019243 3300046513 Bacteria 3728
452 Ga0495616_0063574 3300046513 Bacteria 1803
453 Ga0495616_0095234 3300046513 Bacteria 1403
454 Ga0495630_0041577 3300046517 Bacteria 3433
455 Ga0495631_0000612 3300046518 Bacteria 23546
456 Ga0495631_0002259 3300046518 Bacteria 11041
457 Ga0495631_0007858 3300046518 Bacteria 5407
458 Ga0495631_0010695 3300046518 Bacteria 4535
459 Ga0495631_0014433 3300046518 Bacteria 3814
460 Ga0495631_0028193 3300046518 Bacteria 2562
461 Ga0495631_0029324 3300046518 Bacteria 2503
462 Ga0495632_0000040 3300046519 Bacteria 149644
463 Ga0495632_0002350 3300046519 Bacteria 14503
464 Ga0495632_0002654 3300046519 Bacteria 13424
465 Ga0495632_0003323 3300046519 Bacteria 11470
466 Ga0495632_0009849 3300046519 Bacteria 5716
467 Ga0495632_0022738 3300046519 Bacteria 3356
468 Ga0495632_0025628 3300046519 Bacteria 3117
469 Ga0495637_0000006 3300046520 Bacteria 435763
470 Ga0495637_0000524 3300046520 Bacteria 27917
471 Ga0495637_0002085 3300046520 Bacteria 11246
472 Ga0495637_0083141 3300046520 Bacteria 1273
473 Ga0495643_0000022 3300046522 Bacteria 289691
474 Ga0495643_0000117 3300046522 Bacteria 129698
475 Ga0495643_0000192 3300046522 Bacteria 96511
476 Ga0495643_0001148 3300046522 Bacteria 25919
477 Ga0495643_0004686 3300046522 Bacteria 9495
478 Ga0495643_0007442 3300046522 Bacteria 7057
479 Ga0495643_0009654 3300046522 Bacteria 5978
480 Ga0495643_0014817 3300046522 Bacteria 4629
481 Ga0495643_0014957 3300046522 Bacteria 4601
482 Ga0495643_0037964 3300046522 Bacteria 2640
483 Ga0495643_0088116 3300046522 Bacteria 1605
484 Ga0495643_0112784 3300046522 Bacteria 1380
485 Ga0495644_0001210 3300046523 Bacteria 10561
486 Ga0495644_0002559 3300046523 Bacteria 7231
487 Ga0495644_0003758 3300046523 Bacteria 5974
488 Ga0495644_0007894 3300046523 Bacteria 4098
489 Ga0495644_0008115 3300046523 Bacteria 4039
490 Ga0495644_0010949 3300046523 Bacteria 3495
491 Ga0495644_0012012 3300046523 Bacteria 3327
492 Ga0495648_0000571 3300046524 Bacteria 39432
493 Ga0495648_0000719 3300046524 Bacteria 35255
494 Ga0495648_0000875 3300046524 Bacteria 31749
495 Ga0495648_0002832 3300046524 Bacteria 15609
496 Ga0495648_0005134 3300046524 Bacteria 10958
497 Ga0495648_0011418 3300046524 Bacteria 6691
498 Ga0495648_0025099 3300046524 Bacteria 4042
499 Ga0495648_0039003 3300046524 Bacteria 3029
500 Ga0495648_0042043 3300046524 Bacteria 2879
501 Ga0495648_0067721 3300046524 Bacteria 2086
502 Ga0495648_0074753 3300046524 Bacteria 1951
503 Ga0495663_0041722 3300046525 Bacteria 1396
504 Ga0495666_0000268 3300046526 Bacteria 22520
505 Ga0495666_0023693 3300046526 Bacteria 3035
506 Ga0495666_0037333 3300046526 Bacteria 2363
507 Ga0495666_0050727 3300046526 Bacteria 1994
508 Ga0495642_0000057 3300046528 Bacteria 66980
509 Ga0495642_0001072 3300046528 Bacteria 12654
510 Ga0495642_0001279 3300046528 Bacteria 11358
511 Ga0495642_0003386 3300046528 Bacteria 6295
512 Ga0495642_0005390 3300046528 Bacteria 4908
513 Ga0495642_0012173 3300046528 Bacteria 3314
514 Ga0495642_0012459 3300046528 Bacteria 3278
515 Ga0495642_0017136 3300046528 Bacteria 2829
516 Ga0495642_0018026 3300046528 Bacteria 2760
517 Ga0495642_0019849 3300046528 Bacteria 2635
518 Ga0495642_0022708 3300046528 Bacteria 2473
519 Ga0495642_0028351 3300046528 Bacteria 2230
520 Ga0495642_0033201 3300046528 Bacteria 2074
521 Ga0495642_0053633 3300046528 Bacteria 1662
522 Ga0495652_0013194 3300046529 Bacteria 7438
523 Ga0495654_0000002 3300046530 Bacteria 1021205
524 Ga0495654_0012228 3300046530 Bacteria 4616
525 Ga0495654_0013859 3300046530 Bacteria 4303
526 Ga0495654_0026607 3300046530 Bacteria 2972
527 Ga0495654_0050495 3300046530 Bacteria 2032
528 Ga0495654_0058003 3300046530 Bacteria 1869
529 Ga0495665_0002647 3300046531 Bacteria 9661
530 Ga0495665_0005143 3300046531 Bacteria 7055
531 Ga0495665_0030522 3300046531 Bacteria 2885
532 Ga0495640_0017995 3300046533 Bacteria 5254
533 Ga0495640_0108935 3300046533 Bacteria 1812
534 Ga0495586_0019673 3300046535 Bacteria 3596
535 Ga0495586_0049651 3300046535 Bacteria 2268
536 Ga0495586_0110386 3300046535 Bacteria 1530
537 Ga0495587_0041172 3300046536 Bacteria 2757
538 Ga0495609_0000096 3300046538 Bacteria 104135
539 Ga0495609_0000607 3300046538 Bacteria 28034
540 Ga0495609_0001057 3300046538 Bacteria 19309
541 Ga0495609_0001889 3300046538 Bacteria 13364
542 Ga0495609_0002159 3300046538 Bacteria 12358
543 Ga0495609_0003723 3300046538 Bacteria 8611
544 Ga0495609_0005033 3300046538 Bacteria 7068
545 Ga0495609_0008527 3300046538 Bacteria 5018
546 Ga0495609_0009819 3300046538 Bacteria 4615
547 Ga0495609_0019233 3300046538 Bacteria 3162
548 Ga0495609_0028945 3300046538 Bacteria 2525
549 Ga0495609_0036056 3300046538 Bacteria 2235
550 Ga0495609_0043056 3300046538 Bacteria 2027
551 Ga0495597_0000146 3300046542 Bacteria 62336
552 Ga0495597_0000357 3300046542 Bacteria 40721
553 Ga0495597_0000447 3300046542 Bacteria 35347
554 Ga0495597_0001332 3300046542 Bacteria 18000
555 Ga0495597_0002318 3300046542 Bacteria 12345
556 Ga0495597_0013016 3300046542 Bacteria 3995
557 Ga0495597_0023419 3300046542 Bacteria 2855
558 Ga0495597_0063989 3300046542 Bacteria 1598
559 Ga0495622_0000012 3300046557 Bacteria 189011
560 Ga0495622_0000281 3300046557 Bacteria 38709
561 Ga0495622_0008632 3300046557 Bacteria 4723
562 Ga0495622_0126300 3300046557 Bacteria 1166
563 Ga0495633_0000375 3300046558 Bacteria 47710
564 Ga0495633_0000377 3300046558 Bacteria 47490
565 Ga0495633_0002006 3300046558 Bacteria 14734
566 Ga0495633_0002910 3300046558 Bacteria 11743
567 Ga0495633_0003466 3300046558 Bacteria 10490
568 Ga0495633_0004824 3300046558 Bacteria 8453
569 Ga0495633_0006501 3300046558 Bacteria 6918
570 Ga0495633_0006512 3300046558 Bacteria 6904
571 Ga0495633_0017132 3300046558 Bacteria 3713
572 Ga0495633_0046218 3300046558 Bacteria 2060
573 Ga0495633_0078927 3300046558 Bacteria 1532
574 Ga0495656_0003512 3300046615 Bacteria 5304
575 Ga0495656_0014365 3300046615 Bacteria 2968
576 Ga0495656_0031351 3300046615 Bacteria 2156
577 Ga0495656_0126376 3300046615 Bacteria 1212
578 Ga0495668_0000006 3300046616 Bacteria 553404
579 Ga0495668_0000038 3300046616 Bacteria 232122
580 Ga0495668_0000394 3300046616 Bacteria 57677
581 Ga0495668_0000606 3300046616 Bacteria 43443
582 Ga0495668_0001536 3300046616 Bacteria 21899
583 Ga0495668_0001656 3300046616 Bacteria 20772
584 Ga0495668_0002352 3300046616 Bacteria 15728
585 Ga0495668_0004518 3300046616 Bacteria 9844
586 Ga0495668_0006974 3300046616 Bacteria 7302
587 Ga0495668_0015959 3300046616 Bacteria 4374
588 Ga0495668_0016325 3300046616 Bacteria 4315
589 Ga0495668_0073873 3300046616 Bacteria 1872
590 Ga0495668_0079666 3300046616 Bacteria 1797
591 Ga0495668_0086846 3300046616 Bacteria 1715
592 Ga0495668_0115725 3300046616 Bacteria 1466
593 Ga0495634_0055594 3300046642 Bacteria 2646
594 Ga0495611_0004070 3300046648 Bacteria 6361
595 Ga0495611_0004871 3300046648 Bacteria 5762
596 Ga0495611_0006178 3300046648 Bacteria 5111
597 Ga0495611_0007082 3300046648 Bacteria 4762
598 Ga0495611_0020589 3300046648 Bacteria 2840
599 Ga0495611_0084447 3300046648 Bacteria 1463
600 Ga0495625_0000488 3300046660 Bacteria 59464
601 Ga0495625_0000516 3300046660 Bacteria 56935
602 Ga0495625_0001664 3300046660 Bacteria 26021
603 Ga0495625_0007421 3300046660 Bacteria 9544
604 Ga0495625_0013188 3300046660 Bacteria 6655
605 Ga0495625_0019224 3300046660 Bacteria 5306
606 Ga0495625_0027778 3300046660 Bacteria 4253
607 Ga0495625_0039967 3300046660 Bacteria 3424
608 Ga0495625_0108500 3300046660 Bacteria 1899
609 Ga0495625_0150652 3300046660 Bacteria 1564
610 Ga0495625_0183528 3300046660 Bacteria 1390
611 Ga0495659_0000008 3300046664 Bacteria 102082
612 Ga0495659_0001397 3300046664 Bacteria 8231
613 Ga0495659_0002919 3300046664 Bacteria 5491
614 Ga0495659_0031699 3300046664 Bacteria 1846
615 Ga0495661_0000252 3300046665 Bacteria 61493
616 Ga0495661_0001204 3300046665 Bacteria 22455
617 Ga0495661_0001940 3300046665 Bacteria 16437
618 Ga0495661_0001951 3300046665 Bacteria 16359
619 Ga0495661_0009650 3300046665 Bacteria 6613
620 Ga0495661_0011326 3300046665 Bacteria 6051
621 Ga0495661_0017639 3300046665 Bacteria 4710
622 Ga0495661_0041429 3300046665 Bacteria 2849
623 Ga0495661_0044131 3300046665 Bacteria 2735
624 Ga0495661_0046118 3300046665 Bacteria 2662
625 Ga0495661_0057901 3300046665 Bacteria 2311
626 Ga0495661_0058159 3300046665 Bacteria 2305
627 Ga0495661_0060729 3300046665 Bacteria 2245
628 Ga0495661_0085590 3300046665 Bacteria 1806
629 Ga0495588_0000070 3300046674 Bacteria 227611
630 Ga0495588_0009321 3300046674 Bacteria 4533
631 Ga0495588_0011957 3300046674 Bacteria 4088
632 Ga0495588_0018467 3300046674 Bacteria 3401
633 Ga0495588_0093430 3300046674 Bacteria 1576
634 Ga0495588_0117422 3300046674 Bacteria 1402
635 Ga0495623_0006925 3300046679 Bacteria 7368
636 Ga0495623_0043564 3300046679 Bacteria 2855
637 Ga0495623_0058165 3300046679 Bacteria 2431
638 Ga0495669_0000117 3300046684 Bacteria 51712
639 Ga0495669_0003025 3300046684 Bacteria 6911
640 Ga0495669_0005350 3300046684 Bacteria 5349
641 Ga0495669_0024815 3300046684 Bacteria 2611
642 Ga0495669_0031443 3300046684 Bacteria 2331
643 Ga0495669_0036339 3300046684 Bacteria 2177
644 Ga0495669_0079492 3300046684 Bacteria 1503
645 Ga0495613_0015998 3300046689 Bacteria 5584
646 Ga0495670_0007099 3300046691 Bacteria 5515
647 Ga0495670_0012121 3300046691 Bacteria 4240
648 Ga0495670_0012732 3300046691 Bacteria 4136
649 Ga0495670_0023725 3300046691 Bacteria 3028
650 Ga0495670_0030116 3300046691 Bacteria 2696
651 Ga0495670_0039099 3300046691 Bacteria 2366
652 Ga0495670_0059741 3300046691 Bacteria 1914
653 Ga0495671_0000002 3300046692 Bacteria 1136189
654 Ga0495671_0000080 3300046692 Bacteria 92649
655 Ga0495671_0000181 3300046692 Bacteria 56009
656 Ga0495671_0014707 3300046692 Bacteria 4205
657 Ga0495671_0018306 3300046692 Bacteria 3719
658 Ga0495671_0044539 3300046692 Bacteria 2224
659 Ga0495671_0058739 3300046692 Bacteria 1902
660 Ga0495671_0077783 3300046692 Bacteria 1626
661 Ga0495671_0090874 3300046692 Bacteria 1494
662 Ga0495649_0000236 3300046694 Bacteria 48689
663 Ga0495649_0000427 3300046694 Bacteria 36486
664 Ga0495649_0010742 3300046694 Bacteria 5393
665 Ga0495649_0013362 3300046694 Bacteria 4737
666 Ga0495649_0036911 3300046694 Bacteria 2684
667 Ga0495649_0074611 3300046694 Bacteria 1817
668 Ga0495589_0000036 3300046794 Bacteria 153299
669 Ga0495589_0000216 3300046794 Bacteria 48762
670 Ga0495589_0001075 3300046794 Bacteria 16343
671 Ga0495589_0006669 3300046794 Bacteria 6081
672 Ga0495589_0022474 3300046794 Bacteria 3218
673 Ga0495589_0023668 3300046794 Bacteria 3127
674 Ga0495589_0082011 3300046794 Bacteria 1568
675 Ga0495660_0000816 3300046810 Bacteria 23275
676 Ga0495660_0001684 3300046810 Bacteria 14806
677 Ga0495660_0002482 3300046810 Bacteria 11760
678 Ga0495660_0003435 3300046810 Bacteria 9796
679 Ga0495660_0004868 3300046810 Bacteria 8085
680 Ga0495660_0007317 3300046810 Bacteria 6488
681 Ga0495660_0009142 3300046810 Bacteria 5786
682 Ga0495660_0010489 3300046810 Bacteria 5389
683 Ga0495660_0015568 3300046810 Bacteria 4393
684 Ga0495660_0078012 3300046810 Bacteria 1742
685 Ga0495660_0150918 3300046810 Bacteria 1147
686 Ga0495581_0034275 3300047315 Bacteria 2937
687 Ga0495604_0050480 3300047317 Bacteria 3229
688 Ga0495604_0075673 3300047317 Bacteria 2534
689 Ga0495604_0189388 3300047317 Bacteria 1434
690 Ga0495636_0000238 3300047318 Bacteria 21775
691 Ga0495636_0006514 3300047318 Bacteria 4590
692 Ga0495636_0016569 3300047318 Bacteria 2945
693 Ga0495636_0098264 3300047318 Bacteria 1277
694 Ga0495672_0000022 3300047320 Bacteria 420632
695 Ga0495672_0000095 3300047320 Bacteria 143883
696 Ga0495672_0000337 3300047320 Bacteria 60563
697 Ga0495672_0000602 3300047320 Bacteria 40520
698 Ga0495672_0000621 3300047320 Bacteria 39604
699 Ga0495672_0001813 3300047320 Bacteria 20439
700 Ga0495672_0006978 3300047320 Bacteria 8584
701 Ga0495672_0008498 3300047320 Bacteria 7562
702 Ga0495672_0035785 3300047320 Bacteria 3055
703 Ga0495672_0080746 3300047320 Bacteria 1813
704 Ga0495676_0000035 3300047321 Bacteria 120519
705 Ga0495676_0068685 3300047321 Bacteria 2737
706 Ga0495680_0003304 3300047322 Bacteria 15971
707 Ga0495680_0030531 3300047322 Bacteria 4400
708 Ga0495683_0000758 3300047323 Bacteria 23276
709 Ga0495683_0004529 3300047323 Bacteria 7873
710 Ga0495683_0006758 3300047323 Bacteria 6241
711 Ga0495683_0007411 3300047323 Bacteria 5939
712 Ga0495683_0013472 3300047323 Bacteria 4276
713 Ga0495683_0024659 3300047323 Bacteria 3086
714 Ga0495683_0067578 3300047323 Bacteria 1759
715 Ga0495683_0067963 3300047323 Bacteria 1754
716 Ga0495683_0126914 3300047323 Bacteria 1206
717 Ga0495687_000074 3300047443 Bacteria 153464
718 Ga0495687_000154 3300047443 Bacteria 104740
719 Ga0495687_000245 3300047443 Bacteria 73990
720 Ga0495687_003388 3300047443 Bacteria 11611
721 Ga0495687_023322 3300047443 Bacteria 2956
722 Ga0495687_077333 3300047443 Bacteria 1314
723 Ga0495675_0007255 3300047444 Bacteria 6828
724 Ga0495675_0010943 3300047444 Bacteria 5684
725 Ga0495677_0000042 3300047445 Bacteria 75189
726 Ga0495677_0000815 3300047445 Bacteria 12607
727 Ga0495677_0000891 3300047445 Bacteria 12019
728 Ga0495677_0005914 3300047445 Bacteria 4634
729 Ga0495677_0007524 3300047445 Bacteria 4066
730 Ga0495677_0015431 3300047445 Bacteria 2774
731 Ga0495677_0030097 3300047445 Bacteria 1975
732 Ga0495677_0046929 3300047445 Bacteria 1585
733 Ga0495679_009956 3300047446 Bacteria 3766
734 Ga0495679_010228 3300047446 Bacteria 3696
735 Ga0495679_011386 3300047446 Bacteria 3435
736 Ga0495679_029590 3300047446 Bacteria 1785
737 Ga0495685_000069 3300047447 Bacteria 38803
738 Ga0495685_002279 3300047447 Bacteria 5984
739 Ga0495685_006837 3300047447 Bacteria 3753
740 Ga0495673_0000005 3300047469 Bacteria 943364
741 Ga0495673_0000012 3300047469 Bacteria 656908
742 Ga0495673_0000064 3300047469 Bacteria 225793
743 Ga0495673_0000109 3300047469 Bacteria 166877
744 Ga0495673_0007915 3300047469 Bacteria 6035
745 Ga0495673_0010826 3300047469 Bacteria 4937
746 Ga0495681_0001793 3300047470 Bacteria 15822
747 Ga0495681_0002624 3300047470 Bacteria 12773
748 Ga0495681_0004966 3300047470 Bacteria 8975
749 Ga0495681_0009395 3300047470 Bacteria 6030
750 Ga0495681_0011083 3300047470 Bacteria 5402
751 Ga0495681_0022579 3300047470 Bacteria 3363
752 Ga0495681_0025803 3300047470 Bacteria 3070
753 Ga0495681_0026586 3300047470 Bacteria 3008
754 Ga0495681_0038437 3300047470 Bacteria 2346
755 Ga0495681_0066821 3300047470 Bacteria 1640
756 Ga0495686_0000462 3300047472 Bacteria 61070
757 Ga0495686_0000573 3300047472 Bacteria 52364
758 Ga0495686_0000651 3300047472 Bacteria 47444
759 Ga0495686_0001478 3300047472 Bacteria 25551
760 Ga0495686_0005039 3300047472 Bacteria 10601
761 Ga0495686_0051664 3300047472 Bacteria 2579
762 Ga0495686_0115000 3300047472 Bacteria 1609
763 Ga0495593_0020091 3300047673 Bacteria 3740
764 Ga0495602_0004054 3300048088 Bacteria 15255
765 Ga0495602_0196278 3300048088 Bacteria 1543
766 Ga0495614_0027849 3300048089 Bacteria 2436
767 Ga0495626_0000006 3300048091 Bacteria 284977
768 Ga0495626_0000030 3300048091 Bacteria 202562
769 Ga0495626_0003060 3300048091 Bacteria 10978
770 Ga0495626_0007164 3300048091 Bacteria 6236
771 Ga0495626_0009545 3300048091 Bacteria 5241
772 Ga0495626_0012157 3300048091 Bacteria 4525
773 Ga0495626_0012405 3300048091 Bacteria 4468
774 Ga0495626_0015090 3300048091 Bacteria 3960
775 Ga0495626_0026006 3300048091 Bacteria 2856
776 Ga0495626_0030871 3300048091 Bacteria 2582
777 Ga0495626_0085933 3300048091 Bacteria 1390
778 Ga0496100_0055428 3300048903 Bacteria 2590
779 Ga0496100_0115200 3300048903 Bacteria 1874
780 Ga0496101_0171985 3300048904 Bacteria 1665
781 Ga0496101_0283550 3300048904 Bacteria 1295
782 Ga0496102_0002947 3300048905 Bacteria 14439
783 Ga0496102_0009747 3300048905 Bacteria 8260
784 Ga0496102_0022369 3300048905 Bacteria 5601
785 Ga0496102_0059217 3300048905 Bacteria 3502
786 Ga0496102_0075042 3300048905 Bacteria 3108
787 Ga0496102_0075874 3300048905 Bacteria 3091
788 Ga0496102_0164950 3300048905 Bacteria 2084
789 Ga0496103_0000716 3300048906 Bacteria 24534
790 Ga0496103_0010783 3300048906 Bacteria 5407
791 Ga0496104_0047124 3300048907 Bacteria 4062
792 Ga0496105_0112297 3300048908 Bacteria 2249
793 Ga0496105_0159699 3300048908 Bacteria 1851
794 Ga0496106_0007989 3300048909 Bacteria 7817
795 Ga0496107_0018431 3300048910 Bacteria 4915
796 Ga0496107_0049152 3300048910 Bacteria 3039
797 Ga0496108_0064868 3300048911 Bacteria 3077
798 Ga0496109_0008975 3300048912 Bacteria 8515
799 Ga0496110_0000137 3300048913 Bacteria 42167
800 Ga0496110_0032962 3300048913 Bacteria 4478
801 Ga0496111_0060893 3300048914 Bacteria 2736
802 Ga0496111_0111824 3300048914 Bacteria 2012
803 Ga0496112_0543379 3300048915 Bacteria 1096
804 Ga0496113_0007534 3300048916 Bacteria 7015
805 Ga0496113_0040210 3300048916 Bacteria 3445
806 Ga0496114_0001264 3300048917 Bacteria 19117
807 Ga0496114_0054488 3300048917 Bacteria 3335
808 Ga0496115_0067787 3300048918 Bacteria 2887
809 Ga0496116_0013163 3300048919 Bacteria 6694
810 Ga0496117_0000001 3300048920 Bacteria 2526244
811 Ga0496117_0089849 3300048920 Bacteria 1982
812 Ga0496118_0000002 3300048921 Bacteria 1690764
813 Ga0496121_0001968 3300048924 Bacteria 32687
814 Ga0496121_0007789 3300048924 Bacteria 12827
815 Ga0496121_0154528 3300048924 Bacteria 1685
816 Ga0496122_0000942 3300048925 Bacteria 52834
817 Ga0496122_0008838 3300048925 Bacteria 10753
818 Ga0496122_0012563 3300048925 Bacteria 8408
819 Ga0496122_0013411 3300048925 Bacteria 8024
820 Ga0496122_0018115 3300048925 Bacteria 6525
821 Ga0496122_0033660 3300048925 Bacteria 4210
822 Ga0496123_0001138 3300048926 Bacteria 39752
823 Ga0496123_0001815 3300048926 Bacteria 28098
824 Ga0496123_0002145 3300048926 Bacteria 25215
825 Ga0496123_0004199 3300048926 Bacteria 15390
826 Ga0496123_0004633 3300048926 Bacteria 14287
827 Ga0496124_0025513 3300048927 Bacteria 5353
828 Ga0496124_0049672 3300048927 Bacteria 3577
829 Ga0496124_0054203 3300048927 Bacteria 3395
830 Ga0496124_0105848 3300048927 Bacteria 2272
831 Ga0496125_0000911 3300048928 Bacteria 46657
832 Ga0496125_0105057 3300048928 Bacteria 2066
833 Ga0496126_0021538 3300048929 Bacteria 6294
834 Ga0496126_0207547 3300048929 Bacteria 1651
835 Ga0495678_000004 3300049459 Bacteria 532920
836 Ga0495678_000064 3300049459 Bacteria 138380
837 Ga0495678_000450 3300049459 Bacteria 40797
838 Ga0495678_000467 3300049459 Bacteria 40162
839 Ga0495678_000497 3300049459 Bacteria 38848
840 Ga0495678_000748 3300049459 Bacteria 29493
841 Ga0495678_000980 3300049459 Bacteria 24522
842 Ga0495678_001036 3300049459 Bacteria 23573
843 Ga0495678_011129 3300049459 Bacteria 4323
844 Ga0495682_0001180 3300049460 Bacteria 14899
845 Ga0495682_0001711 3300049460 Bacteria 11145
846 Ga0495682_0003180 3300049460 Bacteria 7382
847 Ga0495682_0010773 3300049460 Bacteria 3528
848 Ga0495682_0011989 3300049460 Bacteria 3331
849 Ga0495682_0025948 3300049460 Bacteria 2178
850 Ga0495682_0029887 3300049460 Bacteria 2018
851 Ga0495682_0039942 3300049460 Bacteria 1721
852 Ga0501034_0087899 3300049571 Bacteria 3107
853 Ga0501034_0134402 3300049571 Bacteria 2455
854 Ga0501249_001271 3300049679 Bacteria 5282
855 Ga0501252_001330 3300049682 Bacteria 2248
856 Ga0501269_000239 3300049766 Bacteria 16053
857 Ga0501035_0001227 3300049822 Bacteria 26707
858 nmdc:mga03n38_27215_c1 3300050490 Bacteria 2370
859 nmdc:mga0k408_101832_c1 3300050493 Bacteria 1694
860 nmdc:mga07m45_10132_c1 3300050496 Bacteria 4913
861 nmdc:mga05p37_161714_c1 3300050507 Bacteria 2734
862 Ga0500578_0002290 3300053086 Bacteria 16436
863 Ga0500643_019787 3300053087 Bacteria 2211
864 Ga0500644_0013727 3300053088 Bacteria 2268
865 Ga0500646_0001741 3300053090 Bacteria 5719
866 Ga0500646_0004847 3300053090 Bacteria 3407
867 Ga0500583_0173880 3300053092 Bacteria 1072
868 Ga0500651_0035082 3300053093 Bacteria 3161
869 Ga0500651_0047912 3300053093 Bacteria 2686
870 Ga0500650_0119029 3300053098 Bacteria 1231
871 Ga0500555_014048 3300053103 Bacteria 2309
872 Ga0500569_026107 3300053109 Bacteria 1597
873 Ga0500594_0001255 3300053118 Bacteria 5497
874 Ga0500618_000032 3300053125 Bacteria 126990
875 Ga0500618_000889 3300053125 Bacteria 15807
876 Ga0500642_0012981 3300053130 Bacteria 3043
877 Ga0500642_0115290 3300053130 Bacteria 1255
878 Ga0500652_001359 3300053131 Bacteria 7657
879 Ga0500655_001143 3300053133 Bacteria 5056
880 Ga0500658_0073117 3300053134 Bacteria 1451
881 Ga0500568_0053703 3300053139 Bacteria 1578
882 Ga0500586_000758 3300053145 Bacteria 6627
883 Ga0500586_020582 3300053145 Bacteria 2068
884 Ga0500588_0032352 3300053146 Bacteria 1516
885 Ga0500604_0000804 3300053151 Bacteria 8664
886 Ga0500604_0006863 3300053151 Bacteria 3012
887 Ga0500622_0001393 3300053156 Bacteria 19473
888 Ga0500584_083664 3300053726 Bacteria 1359
889 Ga0500625_035098 3300053729 Bacteria 2376
890 Ga0500645_015144 3300053730 Bacteria 2447
891 Ga0587072_000288 3300059643 Bacteria 4696
892 Ga0466962_0012603 3300061719 Bacteria 4067
893 Ga0466962_0014302 3300061719 Bacteria 3824
894 2587727787 2585428057 Bacteria 6737412
895 2587733897 2585428058 Bacteria 6853932
896 2588292321 2588253510 Bacteria 6901809
897 2597030966 2596583598 Bacteria 5251611
898 2599445957 2599185178 Bacteria 5365746
899 2601667822 2600255292 Bacteria 6300551
900 2643787952 2643221554 Bacteria 6603920
901 2643797661 2643221556 Bacteria 7251154
902 2643972596 2643221592 Bacteria 6608788
903 2644026203 2643221603 Bacteria 6147767
904 2644138396 2643221625 Bacteria 6512927
905 2644212079 2643221638 Bacteria 6579467
906 2644253242 2643221645 Bacteria 7207331
907 2644273104 2643221648 Bacteria 6521465
908 2644355718 2643221664 Bacteria 7272945
909 2644470557 2643221684 Bacteria 7145183
910 2738742215 2738541280 Bacteria 6630198
911 2738828639 2738541297 Bacteria 6549566
912 2738841387 2738541300 Bacteria 6675882
913 2739152435 2738541357 Bacteria 6549408
914 2739194355 2738543003 Bacteria 6549560
915 2739272257 2738543018 Bacteria 6718814
916 2739320831 2738543026 Bacteria 6549408
917 2739339072 2738543029 Bacteria 6549249
918 2739341301 2738543030 Bacteria 6719714
919 2765571170 2765235838 Bacteria 5445269
920 2809144158 2808606418 Bacteria 6724496
921 2821132881 2821131069 Bacteria 6108407
922 2821135077 2821131069 Bacteria 6108407
923 2842714555 2842711865 Bacteria 7155354
924 2857550148 2857547612 Bacteria 6179999
925 2857558477 2857553236 Bacteria 6166726
926 2857563550 2857558681 Bacteria 6617694
927 2857568789 2857564685 Bacteria 6290584
928 2885082507 2885080285 Bacteria 6355622
929 2904427070 2904424332 Bacteria 7633521
930 2904542716 2904541872 Bacteria 8915136
931 2919480148 2919476304 Bacteria 5888696
932 2928059108 2928058823 Bacteria 5520022
933 2932411435 2932410948 Bacteria 6312192
934 2932418998 2932416698 Bacteria 6315112
935 8047678965 8047673197 Bacteria 7395230
936 Ga0466972_0004773
937 JGI24740J21852_10000908
938 JGI24740J21852_10005306
939 JGI25156J39149_1009127
940 JGI25154J39366_1000317
941 JGI25154J39366_1001547
942 JGI25152J39213_1005631
943 JGI25150J39212_1000956
944 JGI25150J39212_1005653
945 JGI25159J45721_1001022
946 JGI25159J45721_1001312
947 JGI25159J45721_1019022
948 JGI25151J46595_10000616
949 JGI25153J46596_10002329
950 JGI25153J46596_10006454
951 JGI25153J46596_10008710
952 rootL2_10031388
953 rootL2_10056599
954 JGI25160J50197_1013594
955 JGI25161J50226_1000930
956 JGI25161J50226_1009594
957 Ga0055539_1000079
958 Ga0055533_1000470
959 Ga0055532_1000075
960 Ga0055532_1000112
961 Ga0055525_1000009
962 Ga0055525_1000581
963 Ga0055527_1000733
964 Ga0055535_1000013
965 Ga0055529_1000068
966 Ga0055529_1000085
967 Ga0055526_1000050
968 Ga0055526_1000266
969 Ga0055526_1000416
970 Ga0055526_1001745
971 Ga0055526_1010244
972 Ga0055537_1000039
973 Ga0055524_1000008
974 Ga0055524_1000148
975 Ga0055524_1001481
976 Ga0055524_1001704
977 Ga0055524_1001922
978 Ga0055524_1002138
979 Ga0055534_1000174
980 Ga0055534_1011729
981 Ga0055528_1000119
982 Ga0055530_10001765
983 Ga0055530_10005235
984 Ga0055530_10007483
985 Ga0055530_10007706
986 Ga0055530_10013932
987 Ga0055540_1000018
988 Ga0055531_10007672
989 Ga0055531_10009270
990 Ga0055541_1000476
991 Ga0055543_1001067
992 Ga0055543_1001373
993 Ga0065165_1000005
994 Ga0065165_1003335
995 Ga0065165_1006284
996 Ga0065165_1019452
997 Ga0065715_10158456
998 Ga0070658_10049875
999 Ga0070670_100245772
1000 Ga0070680_100250438
1001 Ga0070660_100151901
1002 Ga0070661_100000007
1003 Ga0070661_100035543
1004 Ga0070661_100210153
1005 Ga0070659_100002470
1006 Ga0070659_100045745
1007 Ga0070711_100059058
1008 Ga0070663_100000002
1009 Ga0068855_100125378
1010 Ga0070664_100000004
1011 Ga0068857_100004834
1012 Ga0068854_100000034
1013 Ga0068856_100000051
1014 Ga0081539_10005567
1015 Ga0081539_10062725
1016 Ga0070717_10158188
1017 Ga0075363_100079316
1018 Ga0075364_10069062
1019 Ga0070716_100069902
1020 Ga0070716_100076877
1021 Ga0075362_10015690
1022 Ga0075369_10028666
1023 Ga0075366_10030880
1024 Ga0075370_10010558
1025 Ga0068865_100078895
1026 Ga0079104_1000012
1027 Ga0079104_1007845
1028 Ga0099826_10000001
1029 Ga0105244_10003629
1030 Ga0105244_10007709
1031 Ga0105244_10097393
1032 Ga0105240_10018967
1033 Ga0105240_10230511
1034 Ga0105245_10160701
1035 Ga0114129_10032299
1036 Ga0105243_10020972
1037 Ga0105242_10118988
1038 Ga0105249_10335597
1039 Ga0099796_10004632
1040 Ga0157373_10006916
1041 Ga0157371_10000001
1042 Ga0157371_10000270
1043 Ga0157370_10000014
1044 Ga0157369_10005917
1045 Ga0157372_10000032
1046 Ga0182008_10000245
1047 Ga0182008_10013723
1048 Ga0182006_1000002
1049 Ga0182006_1000029
1050 Ga0182006_1001626
1051 Ga0182006_1003399
1052 Ga0182007_10000085
1053 Ga0182005_1000002
1054 Ga0182005_1000012
1055 Ga0206351_10676099
1056 Ga0154015_1662132
1057 Ga0213872_10000032
1058 Ga0213872_10003325
1059 Ga0213872_10006281
1060 Ga0224712_10049331
1061 Ga0209436_100559
1062 Ga0209784_100008
1063 Ga0209784_100398
1064 Ga0209784_100604
1065 Ga0209566_100006
1066 Ga0209566_100383
1067 Ga0209566_101077
1068 Ga0209674_100083
1069 Ga0209674_100142
1070 Ga0209672_100419
1071 Ga0209147_100005
1072 Ga0209563_100015
1073 Ga0209563_100016
1074 Ga0209563_111169
1075 Ga0209258_100007
1076 Ga0207425_1000001
1077 Ga0207425_1000130
1078 Ga0207425_1000158
1079 Ga0207425_1017058
1080 Ga0209646_1000007
1081 Ga0209646_1000016
1082 Ga0209026_1002022
1083 Ga0209026_1012928
1084 Ga0209677_100008
1085 Ga0209677_105001
1086 Ga0209148_1000051
1087 Ga0209759_1003975
1088 Ga0209759_1006274
1089 Ga0209129_1000003
1090 Ga0209129_1000169
1091 Ga0209565_1000003
1092 Ga0209565_1000162
1093 Ga0209565_1000383
1094 Ga0209565_1003444
1095 Ga0209565_1009939
1096 Ga0209455_1000011
1097 Ga0209455_1000026
1098 Ga0209673_1000003
1099 Ga0209673_1005650
1100 Ga0209673_1015149
1101 Ga0209673_1016237
1102 Ga0209130_1000084
1103 Ga0209130_1000438
1104 Ga0209130_1006830
1105 Ga0209675_1000003
1106 Ga0209675_1000621
1107 Ga0209675_1004929
1108 Ga0209025_1000029
1109 Ga0209025_1011738
1110 Ga0209564_1000002
1111 Ga0209564_1000007
1112 Ga0209564_1000012
1113 Ga0209564_1000057
1114 Ga0209564_1000311
1115 Ga0209564_1002802
1116 Ga0209564_1003059
1117 Ga0209758_1000041
1118 Ga0209758_1000214
1119 Ga0209758_1000232
1120 Ga0209758_1000950
1121 Ga0209050_1000011
1122 Ga0209050_1000138
1123 Ga0209050_1000248
1124 Ga0209050_1001215
1125 Ga0209050_1004162
1126 Ga0209050_1009360
1127 Ga0209256_1000005
1128 Ga0209256_1000068
1129 Ga0209256_1000255
1130 Ga0209256_1000271
1131 Ga0209256_1000295
1132 Ga0209256_1000957
1133 Ga0207426_1006138
1134 Ga0209051_1000004
1135 Ga0209051_1013404
1136 Ga0209257_1000003
1137 Ga0209257_1000360
1138 Ga0209257_1005836
1139 Ga0207655_1014025
1140 Ga0207655_1030673
1141 Ga0207705_10005829
1142 Ga0207654_10004484
1143 Ga0207654_10236255
1144 Ga0207695_10003419
1145 Ga0207695_10041245
1146 Ga0207657_10010492
1147 Ga0207657_10043211
1148 Ga0207657_10155165
1149 Ga0207649_10000131
1150 Ga0207690_10020173
1151 Ga0207706_10238402
1152 Ga0207686_10084299
1153 Ga0207709_10009729
1154 Ga0207704_10124672
1155 Ga0207665_10040684
1156 Ga0207665_10188651
1157 Ga0207679_10000002
1158 Ga0207679_10010718
1159 Ga0207679_10048717
1160 Ga0207679_10085841
1161 Ga0207667_10059113
1162 Ga0207667_10112262
1163 Ga0207640_10000121
1164 Ga0207640_10206926
1165 Ga0207678_10000003
1166 Ga0207702_10000010
1167 Ga0207674_10017674
1168 Ga0209281_1000039
1169 Ga0209281_1008607
1170 Ga0209179_1013680
1171 Ga0209974_10003986
1172 Ga0265323_10011065
1173 Ga0316177_1166234
1174 Ga0316177_1182650
1175 Ga0316180_1007102
1176 Ga0316181_1223875
1177 Ga0265760_10022582
1178 Ga0265328_10026794
1179 Ga0265327_10000056
1180 Ga0307513_10054483
1181 Ga0307408_100001935
1182 Ga0307408_100002737
1183 Ga0307408_100025215
1184 Ga0307416_100122759
1185 Ga0307411_10218573
1186 Ga0373939_0051271
1187 Ga0395899_0000581
1188 Ga0395899_0001454
1189 Ga0395899_0004791
1190 Ga0395899_0117705
1191 Ga0395899_0196432
1192 Ga0395899_0219252
1193 Ga0395900_0000484
1194 Ga0395900_0002244
1195 Ga0395900_0003719
1196 Ga0395900_0014843
1197 Ga0395900_0016378
1198 Ga0395900_0048346
1199 Ga0395900_0132620
1200 Ga0395900_0171483
1201 Ga0395900_0251514
1202 Ga0395900_0314438
1203 Ga0395900_0320813
1204 Ga0395900_0364622
1205 Ga0395900_0382854
1206 Ga0395898_0031471
1207 Ga0395898_0170026
1208 Ga0395898_0241073
1209 Ga0395898_0274951
1210 Ga0395898_0398923
1211 Ga0395905_0000111
1212 Ga0395905_0036606
1213 Ga0395905_0086248
1214 Ga0395905_0121640
1215 Ga0395905_0214715
1216 Ga0395905_0366561
1217 Ga0395905_0514437
1218 Ga0395901_0182347
1219 Ga0395901_0308645
1220 Ga0395901_0397330
1221 Ga0395901_0519091
1222 Ga0436361_0377150
1223 Ga0436361_0482460
1224 Ga0436361_0604829
1225 Ga0451795_0749222
1226 Ga0451798_0885868
1227 Ga0451804_0963191
1228 Ga0451807_1511311
1229 Ga0439448_0000681
1230 Ga0439455_0010427
1231 Ga0450919_000532
1232 Ga0450904_000226
1233 Ga0439458_0009509
1234 Ga0450918_000948
1235 Ga0466969_0013941
1236 Ga0466969_0025166
1237 Ga0466972_0000018
1238 Ga0466972_0029272
1239 Ga0466972_0048500
1240 Ga0466978_0039971
1241 Ga0466965_0008358
1242 Ga0466965_0015432
1243 Ga0466965_0021746
1244 Ga0466966_0004557
1245 Ga0466966_0033361
1246 Ga0466966_0074032
1247 Ga0466961_0000035
1248 Ga0466961_0057316
1249 Ga0466963_0010873
1250 Ga0466964_0000193
1251 Ga0466964_0002262
1252 Ga0466964_0015269
1253 Ga0466964_0021363
1254 Ga0466964_0103584
1255 Ga0453684_0040621
1256 Ga0466968_0001597
1257 Ga0466968_0016900
1258 Ga0466970_0021182
1259 Ga0466970_0023409
1260 Ga0466957_0006525
1261 Ga0466957_0009421
1262 Ga0466957_0037607
1263 Ga0466967_0018036
1264 Ga0466967_0148083
1265 Ga0495617_002808
1266 Ga0495627_000007
1267 Ga0495627_001166
1268 Ga0495627_005942
1269 Ga0495590_0000010
1270 Ga0495590_0000215
1271 Ga0495590_0038070
1272 Ga0495591_003250
1273 Ga0495591_040443
1274 Ga0495638_0000027
1275 Ga0495638_0000035
1276 Ga0495638_0007617
1277 Ga0495638_0018090
1278 Ga0495638_0018384
1279 Ga0495638_0200143
1280 Ga0495638_0242980
1281 Ga0495653_0006487
1282 Ga0495653_0130992
1283 Ga0495653_0148055
1284 Ga0495650_0000044
1285 Ga0495650_0000066
1286 Ga0495650_0000159
1287 Ga0495650_0000299
1288 Ga0495650_0000376
1289 Ga0495650_0000762
1290 Ga0495650_0002387
1291 Ga0495650_0008054
1292 Ga0495650_0011738
1293 Ga0495580_0071871
1294 Ga0495582_0012187
1295 Ga0495605_0000027
1296 Ga0495605_0000081
1297 Ga0495605_0000087
1298 Ga0495605_0006810
1299 Ga0495605_0012102
1300 Ga0495605_0012366
1301 Ga0495605_0021237
1302 Ga0495605_0022354
1303 Ga0495605_0053317
1304 Ga0495639_0064868
1305 Ga0495584_0000284
1306 Ga0495584_0000656
1307 Ga0495584_0001086
1308 Ga0495584_0002251
1309 Ga0495584_0008430
1310 Ga0495584_0018670
1311 Ga0495584_0026465
1312 Ga0495584_0061937
1313 Ga0495585_0002659
1314 Ga0495585_0004022
1315 Ga0495585_0005099
1316 Ga0495585_0005608
1317 Ga0495585_0006411
1318 Ga0495585_0009675
1319 Ga0495585_0017246
1320 Ga0495585_0062429
1321 Ga0495585_0097775
1322 Ga0495585_0124613
1323 Ga0495594_0013361
1324 Ga0495594_0017430
1325 Ga0495594_0020311
1326 Ga0495594_0020960
1327 Ga0495596_0001025
1328 Ga0495596_0001303
1329 Ga0495596_0005349
1330 Ga0495596_0006643
1331 Ga0495596_0018016
1332 Ga0495596_0028655
1333 Ga0495596_0031312
1334 Ga0495607_0002642
1335 Ga0495607_0003259
1336 Ga0495607_0005410
1337 Ga0495607_0006251
1338 Ga0495607_0011211
1339 Ga0495607_0012494
1340 Ga0495607_0020085
1341 Ga0495607_0023228
1342 Ga0495607_0024157
1343 Ga0495607_0073202
1344 Ga0495607_0093533
1345 Ga0495607_0133937
1346 Ga0495583_0000006
1347 Ga0495583_0000008
1348 Ga0495583_0000021
1349 Ga0495583_0000241
1350 Ga0495583_0000889
1351 Ga0495583_0002552
1352 Ga0495583_0003576
1353 Ga0495583_0005082
1354 Ga0495583_0018529
1355 Ga0495583_0042030
1356 Ga0495583_0049299
1357 Ga0495583_0102905
1358 Ga0495583_0108587
1359 Ga0495606_0000015
1360 Ga0495606_0000103
1361 Ga0495606_0000132
1362 Ga0495606_0001376
1363 Ga0495606_0002672
1364 Ga0495606_0003996
1365 Ga0495606_0011112
1366 Ga0495606_0020832
1367 Ga0495606_0032198
1368 Ga0495606_0042741
1369 Ga0495606_0048860
1370 Ga0495606_0097559
1371 Ga0495606_0115159
1372 Ga0495606_0170628
1373 Ga0495610_0000008
1374 Ga0495610_0001892
1375 Ga0495610_0002550
1376 Ga0495610_0011619
1377 Ga0495610_0019698
1378 Ga0495610_0020090
1379 Ga0495610_0023194
1380 Ga0495610_0090544
1381 Ga0495616_0000262
1382 Ga0495616_0000814
1383 Ga0495616_0005469
1384 Ga0495616_0011598
1385 Ga0495616_0012089
1386 Ga0495616_0019243
1387 Ga0495616_0063574
1388 Ga0495616_0095234
1389 Ga0495630_0041577
1390 Ga0495631_0000612
1391 Ga0495631_0002259
1392 Ga0495631_0007858
1393 Ga0495631_0010695
1394 Ga0495631_0014433
1395 Ga0495631_0028193
1396 Ga0495631_0029324
1397 Ga0495632_0000040
1398 Ga0495632_0002350
1399 Ga0495632_0002654
1400 Ga0495632_0003323
1401 Ga0495632_0009849
1402 Ga0495632_0022738
1403 Ga0495632_0025628
1404 Ga0495637_0000006
1405 Ga0495637_0000524
1406 Ga0495637_0002085
1407 Ga0495637_0083141
1408 Ga0495643_0000022
1409 Ga0495643_0000117
1410 Ga0495643_0000192
1411 Ga0495643_0001148
1412 Ga0495643_0004686
1413 Ga0495643_0007442
1414 Ga0495643_0009654
1415 Ga0495643_0014817
1416 Ga0495643_0014957
1417 Ga0495643_0037964
1418 Ga0495643_0088116
1419 Ga0495643_0112784
1420 Ga0495644_0001210
1421 Ga0495644_0002559
1422 Ga0495644_0003758
1423 Ga0495644_0007894
1424 Ga0495644_0008115
1425 Ga0495644_0010949
1426 Ga0495644_0012012
1427 Ga0495648_0000571
1428 Ga0495648_0000719
1429 Ga0495648_0000875
1430 Ga0495648_0002832
1431 Ga0495648_0005134
1432 Ga0495648_0011418
1433 Ga0495648_0025099
1434 Ga0495648_0039003
1435 Ga0495648_0042043
1436 Ga0495648_0067721
1437 Ga0495648_0074753
1438 Ga0495663_0041722
1439 Ga0495666_0000268
1440 Ga0495666_0023693
1441 Ga0495666_0037333
1442 Ga0495666_0050727
1443 Ga0495642_0000057
1444 Ga0495642_0001072
1445 Ga0495642_0001279
1446 Ga0495642_0003386
1447 Ga0495642_0005390
1448 Ga0495642_0012173
1449 Ga0495642_0012459
1450 Ga0495642_0017136
1451 Ga0495642_0018026
1452 Ga0495642_0019849
1453 Ga0495642_0022708
1454 Ga0495642_0028351
1455 Ga0495642_0033201
1456 Ga0495642_0053633
1457 Ga0495652_0013194
1458 Ga0495654_0000002
1459 Ga0495654_0012228
1460 Ga0495654_0013859
1461 Ga0495654_0026607
1462 Ga0495654_0050495
1463 Ga0495654_0058003
1464 Ga0495665_0002647
1465 Ga0495665_0005143
1466 Ga0495665_0030522
1467 Ga0495640_0017995
1468 Ga0495640_0108935
1469 Ga0495586_0019673
1470 Ga0495586_0049651
1471 Ga0495586_0110386
1472 Ga0495587_0041172
1473 Ga0495609_0000096
1474 Ga0495609_0000607
1475 Ga0495609_0001057
1476 Ga0495609_0001889
1477 Ga0495609_0002159
1478 Ga0495609_0003723
1479 Ga0495609_0005033
1480 Ga0495609_0008527
1481 Ga0495609_0009819
1482 Ga0495609_0019233
1483 Ga0495609_0028945
1484 Ga0495609_0036056
1485 Ga0495609_0043056
1486 Ga0495597_0000146
1487 Ga0495597_0000357
1488 Ga0495597_0000447
1489 Ga0495597_0001332
1490 Ga0495597_0002318
1491 Ga0495597_0013016
1492 Ga0495597_0023419
1493 Ga0495597_0063989
1494 Ga0495622_0000012
1495 Ga0495622_0000281
1496 Ga0495622_0008632
1497 Ga0495622_0126300
1498 Ga0495633_0000375
1499 Ga0495633_0000377
1500 Ga0495633_0002006
1501 Ga0495633_0002910
1502 Ga0495633_0003466
1503 Ga0495633_0004824
1504 Ga0495633_0006501
1505 Ga0495633_0006512
1506 Ga0495633_0017132
1507 Ga0495633_0046218
1508 Ga0495633_0078927
1509 Ga0495656_0003512
1510 Ga0495656_0014365
1511 Ga0495656_0031351
1512 Ga0495656_0126376
1513 Ga0495668_0000006
1514 Ga0495668_0000038
1515 Ga0495668_0000394
1516 Ga0495668_0000606
1517 Ga0495668_0001536
1518 Ga0495668_0001656
1519 Ga0495668_0002352
1520 Ga0495668_0004518
1521 Ga0495668_0006974
1522 Ga0495668_0015959
1523 Ga0495668_0016325
1524 Ga0495668_0073873
1525 Ga0495668_0079666
1526 Ga0495668_0086846
1527 Ga0495668_0115725
1528 Ga0495634_0055594
1529 Ga0495611_0004070
1530 Ga0495611_0004871
1531 Ga0495611_0006178
1532 Ga0495611_0007082
1533 Ga0495611_0020589
1534 Ga0495611_0084447
1535 Ga0495625_0000488
1536 Ga0495625_0000516
1537 Ga0495625_0001664
1538 Ga0495625_0007421
1539 Ga0495625_0013188
1540 Ga0495625_0019224
1541 Ga0495625_0027778
1542 Ga0495625_0039967
1543 Ga0495625_0108500
1544 Ga0495625_0150652
1545 Ga0495625_0183528
1546 Ga0495659_0000008
1547 Ga0495659_0001397
1548 Ga0495659_0002919
1549 Ga0495659_0031699
1550 Ga0495661_0000252
1551 Ga0495661_0001204
1552 Ga0495661_0001940
1553 Ga0495661_0001951
1554 Ga0495661_0009650
1555 Ga0495661_0011326
1556 Ga0495661_0017639
1557 Ga0495661_0041429
1558 Ga0495661_0044131
1559 Ga0495661_0046118
1560 Ga0495661_0057901
1561 Ga0495661_0058159
1562 Ga0495661_0060729
1563 Ga0495661_0085590
1564 Ga0495588_0000070
1565 Ga0495588_0009321
1566 Ga0495588_0011957
1567 Ga0495588_0018467
1568 Ga0495588_0093430
1569 Ga0495588_0117422
1570 Ga0495623_0006925
1571 Ga0495623_0043564
1572 Ga0495623_0058165
1573 Ga0495669_0000117
1574 Ga0495669_0003025
1575 Ga0495669_0005350
1576 Ga0495669_0024815
1577 Ga0495669_0031443
1578 Ga0495669_0036339
1579 Ga0495669_0079492
1580 Ga0495613_0015998
1581 Ga0495670_0007099
1582 Ga0495670_0012121
1583 Ga0495670_0012732
1584 Ga0495670_0023725
1585 Ga0495670_0030116
1586 Ga0495670_0039099
1587 Ga0495670_0059741
1588 Ga0495671_0000002
1589 Ga0495671_0000080
1590 Ga0495671_0000181
1591 Ga0495671_0014707
1592 Ga0495671_0018306
1593 Ga0495671_0044539
1594 Ga0495671_0058739
1595 Ga0495671_0077783
1596 Ga0495671_0090874
1597 Ga0495649_0000236
1598 Ga0495649_0000427
1599 Ga0495649_0010742
1600 Ga0495649_0013362
1601 Ga0495649_0036911
1602 Ga0495649_0074611
1603 Ga0495589_0000036
1604 Ga0495589_0000216
1605 Ga0495589_0001075
1606 Ga0495589_0006669
1607 Ga0495589_0022474
1608 Ga0495589_0023668
1609 Ga0495589_0082011
1610 Ga0495660_0000816
1611 Ga0495660_0001684
1612 Ga0495660_0002482
1613 Ga0495660_0003435
1614 Ga0495660_0004868
1615 Ga0495660_0007317
1616 Ga0495660_0009142
1617 Ga0495660_0010489
1618 Ga0495660_0015568
1619 Ga0495660_0078012
1620 Ga0495660_0150918
1621 Ga0495581_0034275
1622 Ga0495604_0050480
1623 Ga0495604_0075673
1624 Ga0495604_0189388
1625 Ga0495636_0000238
1626 Ga0495636_0006514
1627 Ga0495636_0016569
1628 Ga0495636_0098264
1629 Ga0495672_0000022
1630 Ga0495672_0000095
1631 Ga0495672_0000337
1632 Ga0495672_0000602
1633 Ga0495672_0000621
1634 Ga0495672_0001813
1635 Ga0495672_0006978
1636 Ga0495672_0008498
1637 Ga0495672_0035785
1638 Ga0495672_0080746
1639 Ga0495676_0000035
1640 Ga0495676_0068685
1641 Ga0495680_0003304
1642 Ga0495680_0030531
1643 Ga0495683_0000758
1644 Ga0495683_0004529
1645 Ga0495683_0006758
1646 Ga0495683_0007411
1647 Ga0495683_0013472
1648 Ga0495683_0024659
1649 Ga0495683_0067578
1650 Ga0495683_0067963
1651 Ga0495683_0126914
1652 Ga0495687_000074
1653 Ga0495687_000154
1654 Ga0495687_000245
1655 Ga0495687_003388
1656 Ga0495687_023322
1657 Ga0495687_077333
1658 Ga0495675_0007255
1659 Ga0495675_0010943
1660 Ga0495677_0000042
1661 Ga0495677_0000815
1662 Ga0495677_0000891
1663 Ga0495677_0005914
1664 Ga0495677_0007524
1665 Ga0495677_0015431
1666 Ga0495677_0030097
1667 Ga0495677_0046929
1668 Ga0495679_009956
1669 Ga0495679_010228
1670 Ga0495679_011386
1671 Ga0495679_029590
1672 Ga0495685_000069
1673 Ga0495685_002279
1674 Ga0495685_006837
1675 Ga0495673_0000005
1676 Ga0495673_0000012
1677 Ga0495673_0000064
1678 Ga0495673_0000109
1679 Ga0495673_0007915
1680 Ga0495673_0010826
1681 Ga0495681_0001793
1682 Ga0495681_0002624
1683 Ga0495681_0004966
1684 Ga0495681_0009395
1685 Ga0495681_0011083
1686 Ga0495681_0022579
1687 Ga0495681_0025803
1688 Ga0495681_0026586
1689 Ga0495681_0038437
1690 Ga0495681_0066821
1691 Ga0495686_0000462
1692 Ga0495686_0000573
1693 Ga0495686_0000651
1694 Ga0495686_0001478
1695 Ga0495686_0005039
1696 Ga0495686_0051664
1697 Ga0495686_0115000
1698 Ga0495593_0020091
1699 Ga0495602_0004054
1700 Ga0495602_0196278
1701 Ga0495614_0027849
1702 Ga0495626_0000006
1703 Ga0495626_0000030
1704 Ga0495626_0003060
1705 Ga0495626_0007164
1706 Ga0495626_0009545
1707 Ga0495626_0012157
1708 Ga0495626_0012405
1709 Ga0495626_0015090
1710 Ga0495626_0026006
1711 Ga0495626_0030871
1712 Ga0495626_0085933
1713 Ga0496100_0055428
1714 Ga0496100_0115200
1715 Ga0496101_0171985
1716 Ga0496101_0283550
1717 Ga0496102_0002947
1718 Ga0496102_0009747
1719 Ga0496102_0022369
1720 Ga0496102_0059217
1721 Ga0496102_0075042
1722 Ga0496102_0075874
1723 Ga0496102_0164950
1724 Ga0496103_0000716
1725 Ga0496103_0010783
1726 Ga0496104_0047124
1727 Ga0496105_0112297
1728 Ga0496105_0159699
1729 Ga0496106_0007989
1730 Ga0496107_0018431
1731 Ga0496107_0049152
1732 Ga0496108_0064868
1733 Ga0496109_0008975
1734 Ga0496110_0000137
1735 Ga0496110_0032962
1736 Ga0496111_0060893
1737 Ga0496111_0111824
1738 Ga0496112_0543379
1739 Ga0496113_0007534
1740 Ga0496113_0040210
1741 Ga0496114_0001264
1742 Ga0496114_0054488
1743 Ga0496115_0067787
1744 Ga0496116_0013163
1745 Ga0496117_0000001
1746 Ga0496117_0089849
1747 Ga0496118_0000002
1748 Ga0496121_0001968
1749 Ga0496121_0007789
1750 Ga0496121_0154528
1751 Ga0496122_0000942
1752 Ga0496122_0008838
1753 Ga0496122_0012563
1754 Ga0496122_0013411
1755 Ga0496122_0018115
1756 Ga0496122_0033660
1757 Ga0496123_0001138
1758 Ga0496123_0001815
1759 Ga0496123_0002145
1760 Ga0496123_0004199
1761 Ga0496123_0004633
1762 Ga0496124_0025513
1763 Ga0496124_0049672
1764 Ga0496124_0054203
1765 Ga0496124_0105848
1766 Ga0496125_0000911
1767 Ga0496125_0105057
1768 Ga0496126_0021538
1769 Ga0496126_0207547
1770 Ga0495678_000004
1771 Ga0495678_000064
1772 Ga0495678_000450
1773 Ga0495678_000467
1774 Ga0495678_000497
1775 Ga0495678_000748
1776 Ga0495678_000980
1777 Ga0495678_001036
1778 Ga0495678_011129
1779 Ga0495682_0001180
1780 Ga0495682_0001711
1781 Ga0495682_0003180
1782 Ga0495682_0010773
1783 Ga0495682_0011989
1784 Ga0495682_0025948
1785 Ga0495682_0029887
1786 Ga0495682_0039942
1787 Ga0501034_0087899
1788 Ga0501034_0134402
1789 Ga0501249_001271
1790 Ga0501252_001330
1791 Ga0501269_000239
1792 Ga0501035_0001227
1793 nmdc:mga03n38_27215_c1
1794 nmdc:mga0k408_101832_c1
1795 nmdc:mga07m45_10132_c1
1796 nmdc:mga05p37_161714_c1
1797 Ga0500578_0002290
1798 Ga0500643_019787
1799 Ga0500644_0013727
1800 Ga0500646_0001741
1801 Ga0500646_0004847
1802 Ga0500583_0173880
1803 Ga0500651_0035082
1804 Ga0500651_0047912
1805 Ga0500650_0119029
1806 Ga0500555_014048
1807 Ga0500569_026107
1808 Ga0500594_0001255
1809 Ga0500618_000032
1810 Ga0500618_000889
1811 Ga0500642_0012981
1812 Ga0500642_0115290
1813 Ga0500652_001359
1814 Ga0500655_001143
1815 Ga0500658_0073117
1816 Ga0500568_0053703
1817 Ga0500586_000758
1818 Ga0500586_020582
1819 Ga0500588_0032352
1820 Ga0500604_0000804
1821 Ga0500604_0006863
1822 Ga0500622_0001393
1823 Ga0500584_083664
1824 Ga0500625_035098
1825 Ga0500645_015144
1826 Ga0587072_000288
1827 Ga0466962_0012603
1828 Ga0466962_0014302
1829 2587727787
1830 2587733897
1831 2588292321
1832 2597030966
1833 2599445957
1834 2601667822
1835 2643787952
1836 2643797661
1837 2643972596
1838 2644026203
1839 2644138396
1840 2644212079
1841 2644253242
1842 2644273104
1843 2644355718
1844 2644470557
1845 2738742215
1846 2738828639
1847 2738841387
1848 2739152435
1849 2739194355
1850 2739272257
1851 2739320831
1852 2739339072
1853 2739341301
1854 2765571170
1855 2809144158
1856 2821132881
1857 2821135077
1858 2842714555
1859 2857550148
1860 2857558477
1861 2857563550
1862 2857568789
1863 2885082507
1864 2904427070
1865 2904542716
1866 2919480148
1867 2928059108
1868 2932411435
1869 2932418998
1870 8047678965

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

21

80

0.98

PF03466

LysR_substrate

LysR substrate binding domain

104

313

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9598 1 84
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9523 1 81
5z4z-assembly2.cif.gz_C-2 crystal structure of pacysb ntd domain with space group c2 0.9518 4 84
5z4y-assembly1.cif.gz_B crystal structure of pacysb ntd domain with space group p4 0.9447 4 84
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9411 1 84
ID Description Score Start End Superfamily
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9949 5 79 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9856 4 84 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9833 4 83 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9818 4 84 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9805 4 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.9462 99 295 GO:0003700
GO:0006351
GO:0043565
AF-A0A485CE98-F1-model_v4 D-malate degradation protein R 0.9458 89 292 GO:0003700
GO:0006351
GO:0043565
AF-K8CRU7-F1-model_v4 deleted 0.9442 112 292
AF-V7DAT4-F1-model_v4 LysR family transcriptional regulator 0.9291 85 296
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.9193 99 295 GO:0003700
GO:0006351
GO:0043565

Map