F486169

General Info

Members Datasets Scaffolds Average Seq Length
935 360 1870 147

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0007199|Ga0495653_0007199_836_1351
Length 171
Sequence LWRFLSLANTKRWRQNACLSGKQTVNMAKKLLLLNGPNLNLLGTREPAVYGATTLADIENAAVAQAQAAGATLACFQSNHEGALIDRIHAARQEGVNAIVINPGGLTHTSVALRDALAGVDIPFVEVHISNIYKREEFRHHSFLSAIAQGTICGLGADGYRFAIDFALKQR

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
306 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
307 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
310 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
319 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
320 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
325 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
346 2643221556 Massilia sp. Root1485 Isolate Unclassified
347 2643221638 Duganella sp. Root336D2 Isolate Unclassified
348 2643221645 Massilia sp. Root351 Isolate Unclassified
349 2643221664 Massilia sp. Root418 Isolate Unclassified
350 2643221684 Massilia sp. Root133 Isolate Unclassified
351 2738541280 Massilia sp. GV090 Isolate Unclassified
352 2738541300 Massilia sp. GV016 Isolate Unclassified
353 2738543018 Massilia sp. GV045 Isolate Unclassified
354 2738543030 Massilia sp. GV097 Isolate Unclassified
355 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
356 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
357 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
358 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
359 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
360 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 4.39
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0.11
Rhizoplane 3.96
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0007199 3300046463 Bacteria 9117
2 JGI25158J39367_1001655 3300002739 Bacteria 3836
3 JGI25157J39369_1017589 3300002741 Bacteria 866
4 JGI25152J39213_1000245 3300002773 Bacteria 36283
5 JGI25150J39212_1028710 3300002774 Bacteria 786
6 JGI25159J45721_1005640 3300002987 Bacteria 3896
7 JGI25159J45721_1012666 3300002987 Bacteria 1998
8 Ga0006759J45824_1068122 3300003163 Bacteria 1302
9 JGI25153J46596_10001778 3300003215 Bacteria 12789
10 rootH2_10032765 3300003320 Bacteria 31514
11 rootL2_10002967 3300003322 Bacteria 10018
12 rootL2_10002968 3300003322 Bacteria 4025
13 rootH1_10071921 3300003323 Bacteria 4391
14 JGI25160J50197_1003487 3300003354 Bacteria 7022
15 JGI25161J50226_1003103 3300003374 Bacteria 3958
16 Ga0007409J51694_1013231 3300003575 Bacteria 3960
17 Ga0032354_1046455 3300003693 Bacteria 2324
18 Ga0055526_1000556 3300003771 Bacteria 29488
19 Ga0055526_1024738 3300003771 Bacteria 1951
20 Ga0055537_1000056 3300003773 Bacteria 81623
21 Ga0055524_1003233 3300003775 Bacteria 7979
22 Ga0055534_1000178 3300003784 Bacteria 46872
23 Ga0055534_1009222 3300003784 Bacteria 2162
24 Ga0055528_1000297 3300003790 Bacteria 42261
25 Ga0055528_1003822 3300003790 Bacteria 7410
26 Ga0055530_10013759 3300003791 Bacteria 2741
27 Ga0055531_10012000 3300003794 Bacteria 4115
28 Ga0055543_1001330 3300004625 Bacteria 10091
29 Ga0065165_1000447 3300005262 Bacteria 64800
30 Ga0065165_1000986 3300005262 Bacteria 35247
31 Ga0065165_1041456 3300005262 Bacteria 1367
32 Ga0065714_10008115 3300005288 Bacteria 3585
33 Ga0070658_10245369 3300005327 Bacteria 1519
34 Ga0070658_11467976 3300005327 Bacteria 591
35 Ga0070683_100045537 3300005329 Bacteria 4049
36 Ga0070683_100371247 3300005329 Bacteria 1363
37 Ga0070690_100327819 3300005330 Bacteria 1105
38 Ga0068869_100000016 3300005334 Bacteria 70440
39 Ga0068869_100126435 3300005334 Bacteria 1960
40 Ga0068868_100064487 3300005338 Bacteria 2908
41 Ga0068868_100076914 3300005338 Bacteria 2669
42 Ga0070660_100020896 3300005339 Bacteria 4819
43 Ga0070660_100665185 3300005339 Bacteria 872
44 Ga0070659_100213325 3300005366 Bacteria 1591
45 Ga0070659_101418986 3300005366 Bacteria 617
46 Ga0070663_100285892 3300005455 Bacteria 1316
47 Ga0070678_100787963 3300005456 Bacteria 862
48 Ga0070662_100047427 3300005457 Bacteria 3090
49 Ga0070662_100287705 3300005457 Bacteria 1331
50 Ga0070662_100922971 3300005457 Bacteria 746
51 Ga0068867_100000872 3300005459 Bacteria 20351
52 Ga0070679_100033921 3300005530 Bacteria 5056
53 Ga0070679_100131647 3300005530 Bacteria 2482
54 Ga0070665_100496715 3300005548 Bacteria 1231
55 Ga0068855_100001020 3300005563 Bacteria 34917
56 Ga0068855_100014744 3300005563 Bacteria 9416
57 Ga0068855_100103246 3300005563 Bacteria 3280
58 Ga0070664_100034159 3300005564 Bacteria 4266
59 Ga0070664_100222706 3300005564 Bacteria 1688
60 Ga0068856_100001534 3300005614 Bacteria 24189
61 Ga0068856_100372840 3300005614 Bacteria 1446
62 Ga0068859_102045715 3300005617 Bacteria 632
63 Ga0068862_100596410 3300005844 Bacteria 1060
64 Ga0081538_10001906 3300005981 Bacteria 20950
65 Ga0097621_100206978 3300006237 Bacteria 1705
66 Ga0068871_100005339 3300006358 Bacteria 9008
67 Ga0068871_100566446 3300006358 Bacteria 1030
68 Ga0075433_10000299 3300006852 Bacteria 29738
69 Ga0075433_10011819 3300006852 Bacteria 7031
70 Ga0075434_100059706 3300006871 Bacteria 3791
71 Ga0068865_100019070 3300006881 Bacteria 4436
72 Ga0068865_100813314 3300006881 Bacteria 807
73 Ga0075436_100008751 3300006914 Bacteria 6924
74 Ga0097620_102045415 3300006931 Bacteria 632
75 Ga0075435_100199384 3300007076 Bacteria 1696
76 Ga0105240_10240122 3300009093 Bacteria 2101
77 Ga0105240_10345191 3300009093 Bacteria 1690
78 Ga0105245_10031045 3300009098 Bacteria 4726
79 Ga0105243_10008313 3300009148 Bacteria 7972
80 Ga0105241_10151149 3300009174 Bacteria 1900
81 Ga0105242_10033488 3300009176 Bacteria 4113
82 Ga0105242_10255942 3300009176 Bacteria 1579
83 Ga0105237_10223903 3300009545 Bacteria 1881
84 Ga0105238_10242950 3300009551 Bacteria 1778
85 Ga0105239_10009203 3300010375 Eukaryota 11170
86 Ga0157373_10000208 3300013100 Bacteria 48082
87 Ga0157373_10105984 3300013100 Bacteria 1977
88 Ga0157373_10342570 3300013100 Bacteria 1065
89 Ga0157371_10407012 3300013102 Bacteria 996
90 Ga0157370_10245395 3300013104 Bacteria 1657
91 Ga0157369_10285537 3300013105 Bacteria 1718
92 Ga0157378_10189454 3300013297 Bacteria 1939
93 Ga0157372_10001960 3300013307 Bacteria 22372
94 Ga0157372_11062449 3300013307 Bacteria 937
95 Ga0157372_11143060 3300013307 Bacteria 900
96 Ga0157377_10091734 3300014745 Bacteria 1795
97 Ga0182006_1044792 3300015261 Bacteria 1724
98 Ga0209436_100508 3300025208 Bacteria 17011
99 Ga0209436_100526 3300025208 Bacteria 16661
100 Ga0209563_100015 3300025230 Bacteria 879901
101 Ga0207425_1000006 3300025245 Bacteria 808854
102 Ga0207425_1000310 3300025245 Bacteria 35129
103 Ga0209026_1001421 3300025250 Bacteria 10631
104 Ga0209677_103454 3300025253 Bacteria 5121
105 Ga0209148_1000607 3300025254 Bacteria 32105
106 Ga0209129_1000009 3300025258 Bacteria 633100
107 Ga0209129_1005452 3300025258 Bacteria 4488
108 Ga0209565_1000006 3300025263 Bacteria 897294
109 Ga0209565_1001590 3300025263 Bacteria 9665
110 Ga0209565_1010430 3300025263 Bacteria 2304
111 Ga0209673_1000004 3300025273 Bacteria 896155
112 Ga0209673_1007274 3300025273 Bacteria 5141
113 Ga0209130_1000437 3300025284 Bacteria 44427
114 Ga0209130_1001628 3300025284 Bacteria 13839
115 Ga0209675_1000006 3300025291 Bacteria 732267
116 Ga0209675_1000890 3300025291 Bacteria 19177
117 Ga0209564_1000085 3300025295 Bacteria 251509
118 Ga0209564_1000146 3300025295 Bacteria 174811
119 Ga0209564_1003895 3300025295 Bacteria 9588
120 Ga0209758_1000047 3300025297 Bacteria 360971
121 Ga0209050_1000064 3300025298 Bacteria 314803
122 Ga0209050_1011525 3300025298 Bacteria 4174
123 Ga0209050_1011744 3300025298 Bacteria 4109
124 Ga0209256_1000179 3300025299 Bacteria 123865
125 Ga0209256_1000428 3300025299 Bacteria 66020
126 Ga0209256_1003975 3300025299 Bacteria 9712
127 Ga0209256_1071941 3300025299 Bacteria 775
128 Ga0207426_1002247 3300025302 Bacteria 12823
129 Ga0207426_1003558 3300025302 Bacteria 8300
130 Ga0209257_1000010 3300025304 Bacteria 1158682
131 Ga0209257_1001902 3300025304 Bacteria 22569
132 Ga0209257_1021334 3300025304 Bacteria 2356
133 Ga0207705_10044713 3300025909 Bacteria 3182
134 Ga0207705_10298809 3300025909 Bacteria 1235
135 Ga0207705_10759528 3300025909 Bacteria 753
136 Ga0207654_10001695 3300025911 Bacteria 11514
137 Ga0207671_10138785 3300025914 Eukaryota 1871
138 Ga0207671_10190862 3300025914 Bacteria 1598
139 Ga0207657_10594267 3300025919 Bacteria 864
140 Ga0207649_10009884 3300025920 Bacteria 5229
141 Ga0207649_11117299 3300025920 Bacteria 622
142 Ga0207652_10668107 3300025921 Bacteria 928
143 Ga0207687_10376025 3300025927 Bacteria 1163
144 Ga0207690_10125276 3300025932 Bacteria 1872
145 Ga0207706_10138620 3300025933 Bacteria 2140
146 Ga0207706_10298538 3300025933 Bacteria 1404
147 Ga0207706_10922525 3300025933 Bacteria 737
148 Ga0207686_10147464 3300025934 Bacteria 1634
149 Ga0207709_10010217 3300025935 Bacteria 5170
150 Ga0207704_10004481 3300025938 Bacteria 6383
151 Ga0207704_10607087 3300025938 Bacteria 896
152 Ga0207689_10000241 3300025942 Bacteria 48763
153 Ga0207661_10007731 3300025944 Bacteria 7652
154 Ga0207679_10928085 3300025945 Bacteria 797
155 Ga0207679_11085444 3300025945 Bacteria 734
156 Ga0207667_10000896 3300025949 Bacteria 37967
157 Ga0207667_10019827 3300025949 Bacteria 7495
158 Ga0207667_10531939 3300025949 Bacteria 1190
159 Ga0207667_11124227 3300025949 Eukaryota 768
160 Ga0207677_10045655 3300026023 Bacteria 2927
161 Ga0207639_10554611 3300026041 Bacteria 1055
162 Ga0207678_10061347 3300026067 Bacteria 3234
163 Ga0207702_10001475 3300026078 Bacteria 23342
164 Ga0207702_10723972 3300026078 Bacteria 981
165 Ga0207648_10000756 3300026089 Bacteria 36333
166 Ga0207648_10130406 3300026089 Bacteria 2213
167 Ga0207674_10082515 3300026116 Bacteria 3216
168 Ga0207674_11645664 3300026116 Bacteria 610
169 Ga0207683_10681471 3300026121 Bacteria 953
170 Ga0207698_10150254 3300026142 Bacteria 2020
171 Ga0268266_10484789 3300028379 Bacteria 1179
172 Ga0265337_1006922 3300028556 Bacteria 4304
173 Ga0265337_1007423 3300028556 Bacteria 4103
174 Ga0265337_1021153 3300028556 Bacteria 2031
175 Ga0265337_1131577 3300028556 Bacteria 678
176 Ga0265319_1001015 3300028563 Bacteria 17546
177 Ga0265319_1002638 3300028563 Bacteria 9648
178 Ga0265319_1010821 3300028563 Bacteria 3780
179 Ga0265319_1014782 3300028563 Bacteria 3048
180 Ga0265319_1016186 3300028563 Bacteria 2864
181 Ga0265319_1016890 3300028563 Bacteria 2791
182 Ga0265319_1043748 3300028563 Bacteria 1502
183 Ga0265334_10023332 3300028573 Bacteria 2516
184 Ga0265318_10001407 3300028577 Bacteria 14218
185 Ga0265318_10007120 3300028577 Bacteria 5086
186 Ga0265318_10008469 3300028577 Bacteria 4576
187 Ga0265318_10042058 3300028577 Bacteria 1734
188 Ga0265318_10345107 3300028577 Bacteria 543
189 Ga0265323_10000069 3300028653 Bacteria 56761
190 Ga0265323_10070875 3300028653 Bacteria 1192
191 Ga0265322_10000305 3300028654 Bacteria 20763
192 Ga0265322_10115042 3300028654 Bacteria 766
193 Ga0265322_10153083 3300028654 Bacteria 659
194 Ga0265336_10010984 3300028666 Bacteria 3085
195 Ga0265338_10000329 3300028800 Bacteria 86337
196 Ga0265338_10020776 3300028800 Bacteria 6886
197 Ga0265338_10072963 3300028800 Bacteria 2928
198 Ga0265338_10075568 3300028800 Bacteria 2858
199 Ga0265338_10455523 3300028800 Bacteria 905
200 Ga0265338_10732948 3300028800 Bacteria 680
201 Ga0265324_10003662 3300029957 Bacteria 7211
202 Ga0265324_10017110 3300029957 Bacteria 2638
203 Ga0265324_10063104 3300029957 Bacteria 1265
204 Ga0316182_1277600 3300030745 Bacteria 1057
205 Ga0265330_10095838 3300031235 Bacteria 1272
206 Ga0265330_10109542 3300031235 Unclassified 1180
207 Ga0265332_10049693 3300031238 Bacteria 1803
208 Ga0265328_10055459 3300031239 Bacteria 1454
209 Ga0265320_10000515 3300031240 Bacteria 29979
210 Ga0265320_10000735 3300031240 Bacteria 25059
211 Ga0265320_10001485 3300031240 Bacteria 17124
212 Ga0265320_10002038 3300031240 Bacteria 14226
213 Ga0265320_10017525 3300031240 Bacteria 3973
214 Ga0265320_10022073 3300031240 Bacteria 3412
215 Ga0265320_10030912 3300031240 Bacteria 2755
216 Ga0265325_10024461 3300031241 Bacteria 3286
217 Ga0265340_10014689 3300031247 Bacteria 4084
218 Ga0265339_10051665 3300031249 Bacteria 2242
219 Ga0265339_10061599 3300031249 Bacteria 2019
220 Ga0265331_10042698 3300031250 Bacteria 2199
221 Ga0265331_10043625 3300031250 Bacteria 2171
222 Ga0265327_10019749 3300031251 Bacteria 4131
223 Ga0265327_10066161 3300031251 Bacteria 1825
224 Ga0265316_10002099 3300031344 Bacteria 20962
225 Ga0265316_10037727 3300031344 Bacteria 3898
226 Ga0265316_10106340 3300031344 Bacteria 2128
227 Ga0265316_10150493 3300031344 Bacteria 1743
228 Ga0265316_10223063 3300031344 Bacteria 1390
229 Ga0265316_10320357 3300031344 Bacteria 1126
230 Ga0265316_10338292 3300031344 Bacteria 1091
231 Ga0265316_10858917 3300031344 Bacteria 635
232 Ga0307408_100000032 3300031548 Bacteria 213693
233 Ga0307408_100000311 3300031548 Bacteria 46654
234 Ga0265313_10000228 3300031595 Bacteria 60668
235 Ga0265313_10001658 3300031595 Bacteria 20635
236 Ga0265313_10046645 3300031595 Bacteria 2102
237 Ga0265313_10208918 3300031595 Bacteria 809
238 Ga0265314_10011755 3300031711 Bacteria 7200
239 Ga0265314_10051519 3300031711 Bacteria 2867
240 Ga0265314_10309112 3300031711 Bacteria 884
241 Ga0265342_10007378 3300031712 Bacteria 8060
242 Ga0265342_10060029 3300031712 Bacteria 2244
243 Ga0265342_10068863 3300031712 Bacteria 2067
244 Ga0265342_10129365 3300031712 Bacteria 1416
245 Ga0265342_10470035 3300031712 Bacteria 644
246 Ga0307410_10000013 3300031852 Bacteria 76345
247 Ga0307412_10577980 3300031911 Bacteria 948
248 Ga0307412_11407111 3300031911 Bacteria 631
249 Ga0307409_100000031 3300031995 Bacteria 48910
250 Ga0307416_100000038 3300032002 Bacteria 136704
251 Ga0307416_100014397 3300032002 Bacteria 5419
252 Ga0307414_10230779 3300032004 Bacteria 1526
253 Ga0373934_0078195 3300035086 Bacteria 1327
254 Ga0373940_0031344 3300035088 Bacteria 1419
255 Ga0373951_0016056 3300035091 Bacteria 1688
256 Ga0373931_0838126 3300035691 Bacteria 615
257 Ga0373935_0141726 3300035692 Bacteria 1624
258 Ga0373935_0223992 3300035692 Bacteria 1307
259 Ga0373933_0168616 3300035724 Bacteria 1393
260 Ga0373933_0349542 3300035724 Bacteria 960
261 Ga0373937_0076142 3300036401 Bacteria 3099
262 Ga0373937_1257363 3300036401 Bacteria 688
263 Ga0372808_008597 3300036459 Eukaryota 1417
264 Ga0310109_033945 3300036534 Eukaryota 671
265 Ga0316584_0560662 3300036712 Unclassified 796
266 Ga0395899_0096515 3300037312 Bacteria 2137
267 Ga0395899_0149134 3300037312 Bacteria 1658
268 Ga0395900_0000337 3300037418 Bacteria 69150
269 Ga0395900_0010583 3300037418 Bacteria 9432
270 Ga0395900_0017217 3300037418 Bacteria 7375
271 Ga0395900_0069541 3300037418 Bacteria 3618
272 Ga0395900_0267218 3300037418 Bacteria 1706
273 Ga0395898_0064271 3300037466 Bacteria 3559
274 Ga0395898_0090383 3300037466 Bacteria 2946
275 Ga0395898_0287456 3300037466 Bacteria 1568
276 Ga0395898_1070564 3300037466 Bacteria 740
277 Ga0395905_0000015 3300037471 Bacteria 393880
278 Ga0395905_0095396 3300037471 Bacteria 2791
279 Ga0395905_0190391 3300037471 Bacteria 1924
280 Ga0395905_0470630 3300037471 Bacteria 1155
281 Ga0395905_0511133 3300037471 Bacteria 1101
282 Ga0395905_0659801 3300037471 Bacteria 948
283 Ga0395905_0797259 3300037471 Bacteria 847
284 Ga0395905_0986346 3300037471 Bacteria 745
285 Ga0395901_0000597 3300038443 Bacteria 42057
286 Ga0395901_0094595 3300038443 Bacteria 3130
287 Ga0395901_0146485 3300038443 Bacteria 2481
288 Ga0395901_0195581 3300038443 Bacteria 2120
289 Ga0395901_0278048 3300038443 Bacteria 1740
290 Ga0395901_0710847 3300038443 Bacteria 1001
291 Ga0395901_1081144 3300038443 Bacteria 773
292 Ga0451793_1527940 3300041452 Bacteria 694
293 Ga0451800_0000795 3300041459 Unclassified 746
294 Ga0451837_1317882 3300041494 Unclassified 779
295 Ga0439431_0042404 3300041997 Bacteria 1162
296 Ga0439448_0000340 3300042005 Bacteria 10448
297 Ga0439448_0013508 3300042005 Bacteria 2454
298 Ga0439448_0109091 3300042005 Bacteria 944
299 Ga0439448_0120177 3300042005 Bacteria 901
300 Ga0439449_0027146 3300042007 Bacteria 2137
301 Ga0439450_023368 3300042008 Bacteria 1341
302 Ga0439450_042007 3300042008 Bacteria 1064
303 Ga0439450_096966 3300042008 Bacteria 745
304 Ga0439455_0042334 3300042012 Bacteria 1169
305 Ga0450911_017939 3300042115 Bacteria 930
306 Ga0450898_052173 3300042134 Bacteria 792
307 Ga0450903_018547 3300042138 Bacteria 1083
308 Ga0439458_0004623 3300042157 Bacteria 3143
309 Ga0451577_0035000 3300042876 Bacteria 4525
310 Ga0451577_0232719 3300042876 Bacteria 1667
311 Ga0451577_0790539 3300042876 Bacteria 857
312 Ga0451577_0957872 3300042876 Bacteria 769
313 Ga0466969_0088195 3300044656 Bacteria 1472
314 Ga0466969_0093180 3300044656 Bacteria 1425
315 Ga0466972_0000412 3300044658 Bacteria 22404
316 Ga0466972_0058334 3300044658 Bacteria 1853
317 Ga0453683_0090229 3300044673 Bacteria 1921
318 Ga0466965_0028296 3300044683 Bacteria 2722
319 Ga0466965_0040500 3300044683 Bacteria 2293
320 Ga0466965_0168049 3300044683 Bacteria 1152
321 Ga0466965_0491350 3300044683 Bacteria 687
322 Ga0466966_0011762 3300044684 Bacteria 5801
323 Ga0466966_0068120 3300044684 Bacteria 2234
324 Ga0466966_0950265 3300044684 Bacteria 518
325 Ga0466961_0363837 3300044693 Bacteria 879
326 Ga0466963_0069023 3300044694 Bacteria 2375
327 Ga0466964_0010802 3300044706 Bacteria 3447
328 Ga0466964_0013498 3300044706 Bacteria 3099
329 Ga0466964_0191850 3300044706 Bacteria 975
330 Ga0453684_0000045 3300044712 Bacteria 582917
331 Ga0453684_0011780 3300044712 Bacteria 14574
332 Ga0453684_0400446 3300044712 Bacteria 1537
333 Ga0453684_1647184 3300044712 Bacteria 657
334 Ga0466971_0042616 3300044719 Bacteria 2039
335 Ga0466971_0311304 3300044719 Bacteria 757
336 Ga0466968_0002554 3300044735 Bacteria 6689
337 Ga0466968_0299089 3300044735 Bacteria 773
338 Ga0466970_0184693 3300044765 Bacteria 1157
339 Ga0466970_0306667 3300044765 Bacteria 896
340 Ga0466970_0314634 3300044765 Bacteria 884
341 Ga0466970_0384332 3300044765 Bacteria 799
342 Ga0466957_0000394 3300044842 Bacteria 21306
343 Ga0466957_0016249 3300044842 Bacteria 4352
344 Ga0466957_0042880 3300044842 Bacteria 2738
345 Ga0466957_0222545 3300044842 Bacteria 1246
346 Ga0466957_0448731 3300044842 Bacteria 888
347 Ga0466957_1184236 3300044842 Bacteria 552
348 Ga0466960_0094536 3300044901 Bacteria 1529
349 Ga0466960_0221664 3300044901 Bacteria 1041
350 Ga0466960_0287208 3300044901 Bacteria 923
351 Ga0466960_0485238 3300044901 Bacteria 722
352 Ga0466960_0521380 3300044901 Bacteria 698
353 Ga0451576_0001454 3300045051 Bacteria 40277
354 Ga0451576_0001488 3300045051 Bacteria 39603
355 Ga0451576_0002783 3300045051 Bacteria 25253
356 Ga0451576_0090052 3300045051 Bacteria 3191
357 Ga0466958_0085192 3300045836 Bacteria 1949
358 Ga0466958_0320888 3300045836 Bacteria 995
359 Ga0466958_0365618 3300045836 Bacteria 929
360 Ga0466958_0833524 3300045836 Bacteria 601
361 Ga0466958_0945408 3300045836 Bacteria 562
362 Ga0466967_0001230 3300045976 Bacteria 14462
363 Ga0466967_0032003 3300045976 Bacteria 4437
364 Ga0466967_0078034 3300045976 Bacteria 2982
365 Ga0466967_0555244 3300045976 Bacteria 1130
366 Ga0495617_000002 3300046452 Bacteria 710121
367 Ga0495627_001427 3300046453 Bacteria 14061
368 Ga0495627_003235 3300046453 Bacteria 7311
369 Ga0495603_0035953 3300046455 Bacteria 2974
370 Ga0495590_0000007 3300046457 Bacteria 331108
371 Ga0495590_0000940 3300046457 Bacteria 12897
372 Ga0495590_0006196 3300046457 Bacteria 4683
373 Ga0495590_0097701 3300046457 Bacteria 1042
374 Ga0495590_0204189 3300046457 Bacteria 727
375 Ga0495590_0260230 3300046457 Bacteria 647
376 Ga0495591_004261 3300046458 Bacteria 7078
377 Ga0495591_014849 3300046458 Bacteria 2778
378 Ga0495638_0012534 3300046460 Bacteria 5805
379 Ga0495638_0431375 3300046460 Bacteria 677
380 Ga0495653_0047254 3300046463 Bacteria 3330
381 Ga0495650_0000969 3300046471 Bacteria 32892
382 Ga0495650_0033047 3300046471 Unclassified 2307
383 Ga0495650_0034752 3300046471 Bacteria 2227
384 Ga0495650_0304105 3300046471 Bacteria 533
385 Ga0495580_0070944 3300046472 Bacteria 2433
386 Ga0495582_0001028 3300046473 Bacteria 15630
387 Ga0495582_0017641 3300046473 Bacteria 3905
388 Ga0495605_0001725 3300046474 Bacteria 14004
389 Ga0495605_0002728 3300046474 Bacteria 10777
390 Ga0495605_0019333 3300046474 Bacteria 3640
391 Ga0495605_0031579 3300046474 Bacteria 2705
392 Ga0495605_0033247 3300046474 Bacteria 2619
393 Ga0495605_0039009 3300046474 Bacteria 2380
394 Ga0495605_0055372 3300046474 Bacteria 1916
395 Ga0495605_0106870 3300046474 Bacteria 1280
396 Ga0495605_0147291 3300046474 Bacteria 1052
397 Ga0495639_0037187 3300046475 Bacteria 2182
398 Ga0495664_0074512 3300046477 Bacteria 2031
399 Ga0495584_0002018 3300046491 Bacteria 11672
400 Ga0495584_0003124 3300046491 Bacteria 9197
401 Ga0495584_0004097 3300046491 Bacteria 7866
402 Ga0495584_0004978 3300046491 Bacteria 7077
403 Ga0495584_0008803 3300046491 Bacteria 5219
404 Ga0495584_0029095 3300046491 Bacteria 2800
405 Ga0495584_0029997 3300046491 Bacteria 2756
406 Ga0495584_0032837 3300046491 Bacteria 2626
407 Ga0495584_0043913 3300046491 Bacteria 2256
408 Ga0495584_0202998 3300046491 Bacteria 1007
409 Ga0495585_0000904 3300046492 Bacteria 25136
410 Ga0495585_0007432 3300046492 Bacteria 6709
411 Ga0495585_0012064 3300046492 Bacteria 5099
412 Ga0495585_0014494 3300046492 Bacteria 4591
413 Ga0495585_0029018 3300046492 Bacteria 3152
414 Ga0495585_0031985 3300046492 Bacteria 2983
415 Ga0495585_0034983 3300046492 Bacteria 2840
416 Ga0495585_0045765 3300046492 Bacteria 2441
417 Ga0495585_0072785 3300046492 Bacteria 1871
418 Ga0495585_0138386 3300046492 Bacteria 1276
419 Ga0495585_0256344 3300046492 Bacteria 871
420 Ga0495594_0010644 3300046499 Bacteria 4769
421 Ga0495594_0023395 3300046499 Bacteria 3310
422 Ga0495594_0075294 3300046499 Bacteria 1881
423 Ga0495594_0089879 3300046499 Bacteria 1720
424 Ga0495594_0095601 3300046499 Bacteria 1668
425 Ga0495594_0125443 3300046499 Bacteria 1452
426 Ga0495594_0161693 3300046499 Bacteria 1273
427 Ga0495596_0002563 3300046500 Bacteria 9668
428 Ga0495596_0006747 3300046500 Bacteria 5247
429 Ga0495596_0013962 3300046500 Bacteria 3392
430 Ga0495596_0015276 3300046500 Bacteria 3218
431 Ga0495596_0022377 3300046500 Bacteria 2574
432 Ga0495596_0035315 3300046500 Bacteria 1982
433 Ga0495596_0037999 3300046500 Bacteria 1903
434 Ga0495596_0041037 3300046500 Bacteria 1825
435 Ga0495596_0048534 3300046500 Bacteria 1664
436 Ga0495596_0066072 3300046500 Bacteria 1406
437 Ga0495596_0082437 3300046500 Bacteria 1248
438 Ga0495607_0000834 3300046501 Bacteria 29098
439 Ga0495607_0003363 3300046501 Bacteria 12266
440 Ga0495607_0006325 3300046501 Bacteria 8345
441 Ga0495607_0006614 3300046501 Bacteria 8130
442 Ga0495607_0010586 3300046501 Bacteria 6190
443 Ga0495607_0015612 3300046501 Bacteria 4919
444 Ga0495607_0115391 3300046501 Bacteria 1417
445 Ga0495583_0001085 3300046506 Bacteria 30173
446 Ga0495583_0008146 3300046506 Bacteria 6452
447 Ga0495583_0013210 3300046506 Bacteria 4619
448 Ga0495583_0024181 3300046506 Bacteria 3058
449 Ga0495583_0029225 3300046506 Bacteria 2699
450 Ga0495583_0040025 3300046506 Bacteria 2204
451 Ga0495583_0085548 3300046506 Bacteria 1364
452 Ga0495583_0147558 3300046506 Bacteria 976
453 Ga0495606_0035211 3300046507 Bacteria 3425
454 Ga0495606_0051437 3300046507 Bacteria 2687
455 Ga0495606_0061813 3300046507 Bacteria 2393
456 Ga0495606_0067904 3300046507 Bacteria 2256
457 Ga0495606_0109703 3300046507 Bacteria 1666
458 Ga0495606_0215779 3300046507 Bacteria 1084
459 Ga0495610_0003702 3300046512 Bacteria 11722
460 Ga0495610_0062898 3300046512 Bacteria 1759
461 Ga0495610_0069794 3300046512 Bacteria 1643
462 Ga0495616_0001336 3300046513 Bacteria 17226
463 Ga0495616_0009394 3300046513 Bacteria 5724
464 Ga0495616_0014430 3300046513 Bacteria 4421
465 Ga0495616_0017425 3300046513 Bacteria 3962
466 Ga0495616_0024730 3300046513 Bacteria 3217
467 Ga0495616_0027390 3300046513 Bacteria 3024
468 Ga0495616_0037612 3300046513 Bacteria 2488
469 Ga0495616_0057193 3300046513 Bacteria 1923
470 Ga0495616_0063395 3300046513 Bacteria 1806
471 Ga0495616_0080660 3300046513 Bacteria 1557
472 Ga0495616_0110213 3300046513 Bacteria 1279
473 Ga0495616_0197301 3300046513 Bacteria 886
474 Ga0495616_0222833 3300046513 Bacteria 820
475 Ga0495630_0009746 3300046517 Bacteria 6911
476 Ga0495631_0004761 3300046518 Bacteria 7167
477 Ga0495631_0005028 3300046518 Bacteria 6961
478 Ga0495631_0005442 3300046518 Bacteria 6661
479 Ga0495631_0005524 3300046518 Bacteria 6608
480 Ga0495631_0015732 3300046518 Bacteria 3617
481 Ga0495631_0037288 3300046518 Bacteria 2166
482 Ga0495631_0043721 3300046518 Bacteria 1975
483 Ga0495631_0296950 3300046518 Bacteria 687
484 Ga0495632_0000148 3300046519 Bacteria 72492
485 Ga0495632_0007100 3300046519 Bacteria 7091
486 Ga0495632_0007463 3300046519 Bacteria 6866
487 Ga0495632_0008697 3300046519 Bacteria 6195
488 Ga0495632_0041328 3300046519 Bacteria 2317
489 Ga0495632_0068087 3300046519 Bacteria 1716
490 Ga0495632_0166387 3300046519 Bacteria 1014
491 Ga0495637_0000006 3300046520 Bacteria 435763
492 Ga0495637_0021375 3300046520 Bacteria 2968
493 Ga0495637_0043231 3300046520 Bacteria 1924
494 Ga0495643_0002220 3300046522 Bacteria 15780
495 Ga0495643_0003624 3300046522 Bacteria 11220
496 Ga0495643_0020278 3300046522 Bacteria 3835
497 Ga0495643_0028825 3300046522 Bacteria 3109
498 Ga0495643_0310623 3300046522 Bacteria 715
499 Ga0495643_0358678 3300046522 Bacteria 651
500 Ga0495644_0002343 3300046523 Bacteria 7552
501 Ga0495644_0002779 3300046523 Bacteria 6934
502 Ga0495644_0004141 3300046523 Bacteria 5701
503 Ga0495644_0007340 3300046523 Bacteria 4258
504 Ga0495644_0016303 3300046523 Bacteria 2844
505 Ga0495644_0022329 3300046523 Bacteria 2411
506 Ga0495648_0011970 3300046524 Bacteria 6503
507 Ga0495648_0015757 3300046524 Bacteria 5470
508 Ga0495648_0024170 3300046524 Bacteria 4146
509 Ga0495648_0033135 3300046524 Bacteria 3379
510 Ga0495648_0034375 3300046524 Bacteria 3299
511 Ga0495648_0063736 3300046524 Bacteria 2174
512 Ga0495648_0084832 3300046524 Bacteria 1791
513 Ga0495648_0089969 3300046524 Bacteria 1721
514 Ga0495648_0126998 3300046524 Bacteria 1361
515 Ga0495648_0171750 3300046524 Bacteria 1110
516 Ga0495648_0278196 3300046524 Bacteria 794
517 Ga0495648_0310964 3300046524 Bacteria 734
518 Ga0495663_0107264 3300046525 Bacteria 925
519 Ga0495666_0000744 3300046526 Bacteria 14983
520 Ga0495666_0012484 3300046526 Bacteria 4234
521 Ga0495666_0086650 3300046526 Bacteria 1479
522 Ga0495642_0000569 3300046528 Bacteria 18527
523 Ga0495642_0003114 3300046528 Bacteria 6578
524 Ga0495642_0011383 3300046528 Bacteria 3417
525 Ga0495642_0013582 3300046528 Bacteria 3152
526 Ga0495642_0015875 3300046528 Bacteria 2931
527 Ga0495642_0028613 3300046528 Bacteria 2220
528 Ga0495642_0034709 3300046528 Bacteria 2032
529 Ga0495642_0119075 3300046528 Bacteria 1132
530 Ga0495642_0232852 3300046528 Bacteria 804
531 Ga0495652_0199498 3300046529 Bacteria 1519
532 Ga0495654_0009322 3300046530 Bacteria 5380
533 Ga0495654_0019833 3300046530 Bacteria 3511
534 Ga0495654_0051828 3300046530 Bacteria 2001
535 Ga0495654_0102276 3300046530 Bacteria 1317
536 Ga0495654_0105954 3300046530 Bacteria 1288
537 Ga0495665_0034032 3300046531 Bacteria 2724
538 Ga0495665_0053057 3300046531 Bacteria 2145
539 Ga0495665_0054761 3300046531 Bacteria 2107
540 Ga0495640_0332240 3300046533 Bacteria 940
541 Ga0495586_0030119 3300046535 Bacteria 2904
542 Ga0495586_0094793 3300046535 Bacteria 1651
543 Ga0495586_0114323 3300046535 Bacteria 1504
544 Ga0495586_0527517 3300046535 Bacteria 681
545 Ga0495587_0404604 3300046536 Bacteria 758
546 Ga0495609_0000002 3300046538 Bacteria 739816
547 Ga0495609_0000522 3300046538 Bacteria 30810
548 Ga0495609_0005081 3300046538 Bacteria 7012
549 Ga0495609_0006979 3300046538 Bacteria 5695
550 Ga0495609_0013121 3300046538 Bacteria 3918
551 Ga0495609_0029855 3300046538 Bacteria 2481
552 Ga0495609_0032295 3300046538 Bacteria 2378
553 Ga0495609_0263611 3300046538 Bacteria 707
554 Ga0495609_0325757 3300046538 Bacteria 622
555 Ga0495621_0370772 3300046539 Bacteria 603
556 Ga0495597_0001858 3300046542 Bacteria 14443
557 Ga0495597_0002415 3300046542 Bacteria 11888
558 Ga0495597_0005167 3300046542 Bacteria 6952
559 Ga0495597_0009834 3300046542 Bacteria 4704
560 Ga0495597_0083286 3300046542 Bacteria 1366
561 Ga0495597_0094028 3300046542 Bacteria 1269
562 Ga0495597_0108527 3300046542 Bacteria 1165
563 Ga0495597_0198054 3300046542 Bacteria 805
564 Ga0495597_0350683 3300046542 Bacteria 566
565 Ga0495645_0129125 3300046543 Bacteria 1773
566 Ga0495622_0011709 3300046557 Bacteria 4055
567 Ga0495622_0030966 3300046557 Bacteria 2501
568 Ga0495622_0033569 3300046557 Bacteria 2394
569 Ga0495622_0056631 3300046557 Bacteria 1818
570 Ga0495622_0214449 3300046557 Bacteria 854
571 Ga0495633_0005314 3300046558 Bacteria 7910
572 Ga0495633_0006247 3300046558 Bacteria 7110
573 Ga0495633_0006628 3300046558 Bacteria 6833
574 Ga0495633_0038303 3300046558 Bacteria 2290
575 Ga0495633_0040400 3300046558 Bacteria 2222
576 Ga0495633_0043296 3300046558 Bacteria 2136
577 Ga0495633_0079790 3300046558 Bacteria 1524
578 Ga0495633_0123935 3300046558 Bacteria 1196
579 Ga0495656_0015023 3300046615 Bacteria 2914
580 Ga0495656_0074870 3300046615 Bacteria 1513
581 Ga0495656_0155276 3300046615 Bacteria 1108
582 Ga0495656_0237023 3300046615 Bacteria 917
583 Ga0495656_0245225 3300046615 Bacteria 903
584 Ga0495656_0287665 3300046615 Bacteria 839
585 Ga0495668_0000021 3300046616 Bacteria 381308
586 Ga0495668_0000049 3300046616 Bacteria 217657
587 Ga0495668_0001558 3300046616 Bacteria 21752
588 Ga0495668_0001735 3300046616 Bacteria 20052
589 Ga0495668_0007257 3300046616 Bacteria 7110
590 Ga0495668_0009224 3300046616 Bacteria 6070
591 Ga0495668_0020897 3300046616 Bacteria 3759
592 Ga0495668_0027726 3300046616 Bacteria 3209
593 Ga0495668_0054902 3300046616 Bacteria 2200
594 Ga0495668_0159041 3300046616 Bacteria 1237
595 Ga0495634_0058211 3300046642 Bacteria 2576
596 Ga0495611_0000309 3300046648 Bacteria 33038
597 Ga0495611_0001771 3300046648 Bacteria 10432
598 Ga0495611_0004407 3300046648 Bacteria 6092
599 Ga0495611_0010876 3300046648 Bacteria 3854
600 Ga0495611_0037824 3300046648 Bacteria 2145
601 Ga0495611_0038370 3300046648 Bacteria 2130
602 Ga0495611_0075955 3300046648 Bacteria 1539
603 Ga0495625_0003181 3300046660 Bacteria 16707
604 Ga0495625_0014069 3300046660 Bacteria 6403
605 Ga0495625_0028518 3300046660 Bacteria 4186
606 Ga0495625_0028905 3300046660 Bacteria 4151
607 Ga0495625_0039495 3300046660 Bacteria 3446
608 Ga0495625_0076032 3300046660 Bacteria 2349
609 Ga0495625_0090689 3300046660 Bacteria 2113
610 Ga0495625_0257858 3300046660 Bacteria 1129
611 Ga0495659_0000098 3300046664 Bacteria 38376
612 Ga0495659_0006084 3300046664 Bacteria 3815
613 Ga0495659_0343928 3300046664 Bacteria 636
614 Ga0495661_0011074 3300046665 Bacteria 6124
615 Ga0495661_0014162 3300046665 Bacteria 5342
616 Ga0495661_0023349 3300046665 Bacteria 4015
617 Ga0495661_0031136 3300046665 Bacteria 3389
618 Ga0495661_0032557 3300046665 Bacteria 3294
619 Ga0495661_0033952 3300046665 Bacteria 3213
620 Ga0495661_0041378 3300046665 Bacteria 2851
621 Ga0495661_0042605 3300046665 Bacteria 2797
622 Ga0495661_0043846 3300046665 Bacteria 2746
623 Ga0495661_0046043 3300046665 Bacteria 2664
624 Ga0495661_0060592 3300046665 Bacteria 2247
625 Ga0495661_0067504 3300046665 Bacteria 2100
626 Ga0495661_0078056 3300046665 Bacteria 1916
627 Ga0495661_0094846 3300046665 Bacteria 1690
628 Ga0495661_0100993 3300046665 Bacteria 1623
629 Ga0495661_0102976 3300046665 Bacteria 1603
630 Ga0495661_0232685 3300046665 Bacteria 949
631 Ga0495661_0315704 3300046665 Bacteria 778
632 Ga0495661_0489791 3300046665 Bacteria 587
633 Ga0495588_0000135 3300046674 Bacteria 117387
634 Ga0495588_0017232 3300046674 Bacteria 3503
635 Ga0495588_0021690 3300046674 Bacteria 3168
636 Ga0495588_0027852 3300046674 Bacteria 2825
637 Ga0495588_0028510 3300046674 Bacteria 2794
638 Ga0495588_0101812 3300046674 Bacteria 1509
639 Ga0495588_0109238 3300046674 Bacteria 1456
640 Ga0495588_0124617 3300046674 Bacteria 1358
641 Ga0495588_0387781 3300046674 Bacteria 733
642 Ga0495588_0554448 3300046674 Bacteria 602
643 Ga0495623_0042373 3300046679 Bacteria 2899
644 Ga0495646_0142442 3300046680 Bacteria 1339
645 Ga0495669_0000400 3300046684 Bacteria 21289
646 Ga0495669_0000418 3300046684 Bacteria 20527
647 Ga0495669_0010842 3300046684 Bacteria 3858
648 Ga0495669_0016839 3300046684 Bacteria 3133
649 Ga0495669_0029643 3300046684 Bacteria 2400
650 Ga0495669_0043868 3300046684 Bacteria 1991
651 Ga0495669_0046897 3300046684 Bacteria 1929
652 Ga0495669_0049532 3300046684 Bacteria 1881
653 Ga0495669_0065511 3300046684 Bacteria 1649
654 Ga0495670_0015322 3300046691 Bacteria 3769
655 Ga0495670_0015421 3300046691 Bacteria 3754
656 Ga0495670_0050606 3300046691 Bacteria 2079
657 Ga0495670_0064745 3300046691 Bacteria 1842
658 Ga0495670_0092952 3300046691 Bacteria 1545
659 Ga0495670_0219178 3300046691 Bacteria 1010
660 Ga0495670_0225224 3300046691 Bacteria 996
661 Ga0495670_0246717 3300046691 Bacteria 951
662 Ga0495671_0000522 3300046692 Bacteria 29251
663 Ga0495671_0004896 3300046692 Bacteria 7921
664 Ga0495671_0021644 3300046692 Bacteria 3374
665 Ga0495671_0310795 3300046692 Bacteria 757
666 Ga0495649_0000625 3300046694 Bacteria 29147
667 Ga0495649_0005216 3300046694 Bacteria 8317
668 Ga0495649_0008026 3300046694 Bacteria 6377
669 Ga0495649_0043337 3300046694 Bacteria 2456
670 Ga0495649_0075218 3300046694 Bacteria 1808
671 Ga0495649_0110193 3300046694 Bacteria 1460
672 Ga0495649_0192314 3300046694 Bacteria 1062
673 Ga0495649_0216605 3300046694 Bacteria 991
674 Ga0495589_0000353 3300046794 Bacteria 35738
675 Ga0495589_0001512 3300046794 Bacteria 13375
676 Ga0495589_0002800 3300046794 Bacteria 9643
677 Ga0495589_0004643 3300046794 Bacteria 7301
678 Ga0495589_0004825 3300046794 Bacteria 7164
679 Ga0495589_0008572 3300046794 Bacteria 5330
680 Ga0495589_0012156 3300046794 Bacteria 4463
681 Ga0495589_0048393 3300046794 Bacteria 2105
682 Ga0495589_0083014 3300046794 Bacteria 1557
683 Ga0495589_0119006 3300046794 Bacteria 1272
684 Ga0495589_0180740 3300046794 Bacteria 1000
685 Ga0495589_0191183 3300046794 Bacteria 968
686 Ga0495600_0060647 3300046809 Bacteria 2470
687 Ga0495660_0000103 3300046810 Bacteria 91169
688 Ga0495660_0003819 3300046810 Bacteria 9222
689 Ga0495660_0013708 3300046810 Bacteria 4698
690 Ga0495660_0024276 3300046810 Bacteria 3454
691 Ga0495660_0035176 3300046810 Bacteria 2800
692 Ga0495660_0054077 3300046810 Bacteria 2176
693 Ga0495660_0060435 3300046810 Bacteria 2035
694 Ga0495660_0102345 3300046810 Bacteria 1472
695 Ga0495581_0029213 3300047315 Bacteria 3195
696 Ga0495581_0157034 3300047315 Bacteria 1329
697 Ga0495581_0364854 3300047315 Bacteria 843
698 Ga0495636_0001265 3300047318 Bacteria 9570
699 Ga0495636_0003721 3300047318 Bacteria 5935
700 Ga0495636_0040605 3300047318 Bacteria 1929
701 Ga0495636_0079855 3300047318 Bacteria 1407
702 Ga0495636_0084274 3300047318 Bacteria 1372
703 Ga0495672_0000118 3300047320 Bacteria 124396
704 Ga0495672_0000287 3300047320 Bacteria 69547
705 Ga0495672_0003619 3300047320 Bacteria 13107
706 Ga0495672_0009762 3300047320 Bacteria 6914
707 Ga0495672_0021332 3300047320 Bacteria 4226
708 Ga0495672_0119976 3300047320 Bacteria 1399
709 Ga0495672_0230055 3300047320 Bacteria 910
710 Ga0495676_0000627 3300047321 Bacteria 29238
711 Ga0495676_0083006 3300047321 Bacteria 2423
712 Ga0495676_0403775 3300047321 Bacteria 906
713 Ga0495683_0005242 3300047323 Bacteria 7201
714 Ga0495683_0005405 3300047323 Bacteria 7091
715 Ga0495683_0016184 3300047323 Bacteria 3873
716 Ga0495683_0025633 3300047323 Bacteria 3020
717 Ga0495683_0034591 3300047323 Bacteria 2569
718 Ga0495683_0369765 3300047323 Bacteria 601
719 Ga0495683_0473340 3300047323 Bacteria 511
720 Ga0495687_000047 3300047443 Bacteria 206452
721 Ga0495687_000166 3300047443 Bacteria 98891
722 Ga0495687_000210 3300047443 Bacteria 83884
723 Ga0495687_018829 3300047443 Bacteria 3402
724 Ga0495687_024581 3300047443 Bacteria 2861
725 Ga0495687_041822 3300047443 Bacteria 2007
726 Ga0495687_090705 3300047443 Bacteria 1170
727 Ga0495675_0030262 3300047444 Bacteria 3454
728 Ga0495675_0075202 3300047444 Bacteria 2128
729 Ga0495677_0000074 3300047445 Bacteria 50955
730 Ga0495677_0000920 3300047445 Bacteria 11865
731 Ga0495677_0001632 3300047445 Bacteria 9014
732 Ga0495677_0005519 3300047445 Bacteria 4794
733 Ga0495677_0017567 3300047445 Bacteria 2593
734 Ga0495677_0021851 3300047445 Bacteria 2318
735 Ga0495677_0034368 3300047445 Bacteria 1849
736 Ga0495677_0034631 3300047445 Bacteria 1842
737 Ga0495677_0036892 3300047445 Bacteria 1785
738 Ga0495677_0216899 3300047445 Bacteria 745
739 Ga0495679_007964 3300047446 Bacteria 4358
740 Ga0495679_012140 3300047446 Bacteria 3291
741 Ga0495679_018946 3300047446 Bacteria 2430
742 Ga0495679_052201 3300047446 Bacteria 1224
743 Ga0495679_068310 3300047446 Bacteria 1028
744 Ga0495679_122076 3300047446 Bacteria 711
745 Ga0495685_004856 3300047447 Bacteria 4363
746 Ga0495685_016653 3300047447 Bacteria 2513
747 Ga0495685_152066 3300047447 Bacteria 751
748 Ga0495681_0002867 3300047470 Bacteria 12181
749 Ga0495681_0003198 3300047470 Bacteria 11430
750 Ga0495681_0009476 3300047470 Bacteria 5993
751 Ga0495681_0023512 3300047470 Bacteria 3272
752 Ga0495681_0031160 3300047470 Bacteria 2704
753 Ga0495681_0183766 3300047470 Bacteria 857
754 Ga0495681_0202704 3300047470 Bacteria 804
755 Ga0495686_0000835 3300047472 Bacteria 39592
756 Ga0495686_0006193 3300047472 Bacteria 9231
757 Ga0495686_0006400 3300047472 Bacteria 9025
758 Ga0495686_0029229 3300047472 Bacteria 3586
759 Ga0495686_0078442 3300047472 Bacteria 2021
760 Ga0495686_0089005 3300047472 Bacteria 1876
761 Ga0495686_0133635 3300047472 Bacteria 1469
762 Ga0495593_0051146 3300047673 Bacteria 2187
763 Ga0495602_0042177 3300048088 Bacteria 4160
764 Ga0495602_0179218 3300048088 Bacteria 1636
765 Ga0495614_0020215 3300048089 Bacteria 2880
766 Ga0495614_0075094 3300048089 Bacteria 1460
767 Ga0495626_0000006 3300048091 Bacteria 284977
768 Ga0495626_0000034 3300048091 Bacteria 183391
769 Ga0495626_0005441 3300048091 Bacteria 7453
770 Ga0495626_0006165 3300048091 Bacteria 6859
771 Ga0495626_0006352 3300048091 Bacteria 6738
772 Ga0495626_0010572 3300048091 Bacteria 4913
773 Ga0495626_0017645 3300048091 Bacteria 3598
774 Ga0495626_0019151 3300048091 Bacteria 3425
775 Ga0495626_0029193 3300048091 Bacteria 2670
776 Ga0495626_0043239 3300048091 Bacteria 2114
777 Ga0495626_0053956 3300048091 Bacteria 1847
778 Ga0495626_0137375 3300048091 Bacteria 1038
779 Ga0496100_0424293 3300048903 Bacteria 1016
780 Ga0496101_0118146 3300048904 Bacteria 2002
781 Ga0496101_1405113 3300048904 Bacteria 544
782 Ga0496102_0010040 3300048905 Bacteria 8142
783 Ga0496102_0197528 3300048905 Bacteria 1896
784 Ga0496102_0653733 3300048905 Bacteria 974
785 Ga0496102_0679713 3300048905 Bacteria 952
786 Ga0496102_0759295 3300048905 Bacteria 892
787 Ga0496103_0071730 3300048906 Bacteria 2168
788 Ga0496103_0151577 3300048906 Bacteria 1485
789 Ga0496103_0179680 3300048906 Bacteria 1360
790 Ga0496103_0207447 3300048906 Bacteria 1260
791 Ga0496103_0247560 3300048906 Bacteria 1147
792 Ga0496104_0066589 3300048907 Bacteria 3420
793 Ga0496104_0201582 3300048907 Bacteria 1902
794 Ga0496105_0541225 3300048908 Bacteria 910
795 Ga0496106_0004987 3300048909 Bacteria 9827
796 Ga0496106_0176687 3300048909 Bacteria 1694
797 Ga0496106_0451959 3300048909 Bacteria 1032
798 Ga0496107_0012714 3300048910 Bacteria 5881
799 Ga0496107_0101165 3300048910 Bacteria 2113
800 Ga0496108_0929699 3300048911 Bacteria 745
801 Ga0496109_0034146 3300048912 Bacteria 4579
802 Ga0496109_0339540 3300048912 Bacteria 1418
803 Ga0496109_0402299 3300048912 Bacteria 1293
804 Ga0496109_0724705 3300048912 Bacteria 932
805 Ga0496110_0018489 3300048913 Bacteria 5843
806 Ga0496111_0125865 3300048914 Bacteria 1894
807 Ga0496111_0810019 3300048914 Bacteria 677
808 Ga0496112_0279929 3300048915 Bacteria 1615
809 Ga0496112_0473321 3300048915 Bacteria 1190
810 Ga0496113_0024113 3300048916 Bacteria 4320
811 Ga0496113_0572695 3300048916 Bacteria 905
812 Ga0496114_0178228 3300048917 Bacteria 1855
813 Ga0496115_0406788 3300048918 Bacteria 1104
814 Ga0496116_0331977 3300048919 Bacteria 706
815 Ga0496121_0078704 3300048924 Bacteria 2620
816 Ga0496122_0003245 3300048925 Bacteria 21574
817 Ga0496122_0015414 3300048925 Bacteria 7308
818 Ga0496122_0267307 3300048925 Bacteria 945
819 Ga0496123_0013411 3300048926 Bacteria 6884
820 Ga0496123_0015341 3300048926 Bacteria 6291
821 Ga0496123_0050901 3300048926 Bacteria 2764
822 Ga0496124_0026676 3300048927 Bacteria 5206
823 Ga0496124_0084722 3300048927 Bacteria 2598
824 Ga0496124_0086232 3300048927 Bacteria 2570
825 Ga0496124_0087250 3300048927 Bacteria 2552
826 Ga0496124_0094902 3300048927 Bacteria 2425
827 Ga0496124_0102421 3300048927 Bacteria 2317
828 Ga0496125_0007861 3300048928 Bacteria 11269
829 Ga0496125_0105869 3300048928 Bacteria 2055
830 Ga0496125_0553867 3300048928 Bacteria 637
831 Ga0496126_0145302 3300048929 Bacteria 2038
832 Ga0501306_018117 3300049127 Bacteria 961
833 Ga0501308_000946 3300049128 Bacteria 2147
834 Ga0501308_018674 3300049128 Bacteria 850
835 Ga0501309_004005 3300049129 Bacteria 1698
836 Ga0501304_000167 3300049160 Bacteria 2797
837 Ga0501307_006020 3300049162 Bacteria 1296
838 Ga0501307_007028 3300049162 Bacteria 1232
839 Ga0495678_000113 3300049459 Bacteria 96866
840 Ga0495678_000601 3300049459 Bacteria 33888
841 Ga0495678_010011 3300049459 Bacteria 4636
842 Ga0495678_020985 3300049459 Bacteria 2884
843 Ga0495678_076538 3300049459 Bacteria 1212
844 Ga0495682_0003524 3300049460 Bacteria 6935
845 Ga0495682_0006018 3300049460 Bacteria 4955
846 Ga0495682_0009817 3300049460 Bacteria 3726
847 Ga0495682_0014169 3300049460 Bacteria 3025
848 Ga0495682_0065817 3300049460 Bacteria 1306
849 Ga0501311_004404 3300049527 Bacteria 1497
850 Ga0501313_006175 3300049529 Bacteria 1290
851 Ga0501315_002695 3300049531 Bacteria 1702
852 Ga0501315_006164 3300049531 Bacteria 1326
853 Ga0501315_035017 3300049531 Bacteria 739
854 Ga0501316_004314 3300049532 Bacteria 1422
855 Ga0501316_032082 3300049532 Bacteria 706
856 Ga0501316_075490 3300049532 Bacteria 516
857 Ga0501318_020518 3300049534 Bacteria 833
858 Ga0501323_008593 3300049539 Bacteria 1188
859 Ga0501038_0322239 3300049574 Bacteria 1209
860 Ga0501042_0472253 3300049578 Bacteria 910
861 Ga0501043_0277175 3300049579 Bacteria 1286
862 Ga0501046_0035622 3300049580 Bacteria 4010
863 Ga0501046_0529471 3300049580 Bacteria 842
864 Ga0501047_0031101 3300049581 Bacteria 5148
865 Ga0501067_0708163 3300049583 Bacteria 566
866 Ga0501070_0248645 3300049586 Bacteria 1455
867 Ga0501070_0254639 3300049586 Bacteria 1436
868 Ga0501202_050767 3300049652 Bacteria 918
869 Ga0501207_023247 3300049654 Bacteria 1005
870 Ga0501227_002378 3300049665 Bacteria 4157
871 Ga0501227_021046 3300049665 Bacteria 1501
872 Ga0501243_001360 3300049675 Bacteria 3498
873 Ga0501083_0005756 3300049744 Bacteria 8768
874 Ga0501263_034297 3300049760 Bacteria 727
875 Ga0501263_060529 3300049760 Bacteria 593
876 Ga0501279_003747 3300049775 Bacteria 1988
877 Ga0501279_004114 3300049775 Bacteria 1905
878 Ga0501279_011654 3300049775 Bacteria 1191
879 Ga0501035_0004747 3300049822 Bacteria 12903
880 Ga0501035_0006337 3300049822 Bacteria 11126
881 Ga0501044_0001471 3300049823 Bacteria 27663
882 Ga0501044_1151090 3300049823 Bacteria 644
883 Ga0501226_012002 3300049853 Bacteria 960
884 nmdc:mga0n895_5361_c1 3300050512 Bacteria 10694
885 nmdc:mga0rr50_118422_c1 3300050513 Bacteria 2104
886 nmdc:mga08x19_13862_c1 3300050514 Bacteria 4883
887 nmdc:mga0a205_13293_c1 3300050515 Bacteria 7656
888 Ga0500555_014711 3300053103 Eukaryota 2256
889 Ga0500607_000615 3300053121 Eukaryota 34386
890 Ga0500607_008419 3300053121 Bacteria 6276
891 Ga0500614_039163 3300053123 Bacteria 1197
892 Ga0500559_0226021 3300053136 Bacteria 882
893 Ga0500636_0001052 3300053177 Bacteria 14818
894 Ga0500637_0092525 3300053178 Bacteria 1752
895 Ga0500625_119963 3300053729 Bacteria 1059
896 Ga0587084_014618 3300059477 Bacteria 1097
897 Ga0587066_053972 3300059490 Bacteria 800
898 Ga0587070_070430 3300059491 Bacteria 745
899 Ga0587073_0049366 3300059492 Bacteria 948
900 Ga0587077_057286 3300059493 Bacteria 834
901 Ga0587082_017491 3300059504 Bacteria 1130
902 Ga0587083_0002352 3300059505 Bacteria 2340
903 Ga0587083_0041313 3300059505 Bacteria 967
904 Ga0587088_002623 3300059508 Bacteria 2076
905 Ga0587091_020084 3300059511 Bacteria 1156
906 Ga0587106_001842 3300059605 Bacteria 1973
907 Ga0587106_006419 3300059605 Bacteria 1386
908 Ga0587101_020970 3300059623 Bacteria 940
909 Ga0587068_002833 3300059641 Bacteria 2152
910 Ga0587072_027254 3300059643 Bacteria 1048
911 Ga0587076_051532 3300059645 Bacteria 804
912 Ga0587079_025914 3300059647 Bacteria 1092
913 Ga0587102_005752 3300059649 Bacteria 1105
914 Ga0587105_001963 3300059651 Bacteria 1129
915 Ga0501082_1426855 3300060353 Bacteria 604
916 Ga0466962_0050633 3300061719 Bacteria 1985
917 Ga0466962_0156304 3300061719 Bacteria 1107
918 Ga0466962_0591116 3300061719 Bacteria 565
919 Ga0530510_0523549 3300061734 Bacteria 899
920 2643788683 2643221554 Bacteria 6603920
921 2643797775 2643221556 Bacteria 7251154
922 2644213296 2643221638 Bacteria 6579467
923 2644249636 2643221645 Bacteria 7207331
924 2644356200 2643221664 Bacteria 7272945
925 2644472953 2643221684 Bacteria 7145183
926 2738739147 2738541280 Bacteria 6630198
927 2738846382 2738541300 Bacteria 6675882
928 2739274969 2738543018 Bacteria 6718814
929 2739344013 2738543030 Bacteria 6719714
930 2765567555 2765235838 Bacteria 5445269
931 2788436509 2786546940 Bacteria 6396474
932 2808869378 2808606364 Bacteria 4465927
933 2809144265 2808606418 Bacteria 6724496
934 2839099499 2839094727 Bacteria 5534556
935 8047679074 8047673197 Bacteria 7395230
936 Ga0495653_0007199
937 JGI25158J39367_1001655
938 JGI25157J39369_1017589
939 JGI25152J39213_1000245
940 JGI25150J39212_1028710
941 JGI25159J45721_1005640
942 JGI25159J45721_1012666
943 Ga0006759J45824_1068122
944 JGI25153J46596_10001778
945 rootH2_10032765
946 rootL2_10002967
947 rootL2_10002968
948 rootH1_10071921
949 JGI25160J50197_1003487
950 JGI25161J50226_1003103
951 Ga0007409J51694_1013231
952 Ga0032354_1046455
953 Ga0055526_1000556
954 Ga0055526_1024738
955 Ga0055537_1000056
956 Ga0055524_1003233
957 Ga0055534_1000178
958 Ga0055534_1009222
959 Ga0055528_1000297
960 Ga0055528_1003822
961 Ga0055530_10013759
962 Ga0055531_10012000
963 Ga0055543_1001330
964 Ga0065165_1000447
965 Ga0065165_1000986
966 Ga0065165_1041456
967 Ga0065714_10008115
968 Ga0070658_10245369
969 Ga0070658_11467976
970 Ga0070683_100045537
971 Ga0070683_100371247
972 Ga0070690_100327819
973 Ga0068869_100000016
974 Ga0068869_100126435
975 Ga0068868_100064487
976 Ga0068868_100076914
977 Ga0070660_100020896
978 Ga0070660_100665185
979 Ga0070659_100213325
980 Ga0070659_101418986
981 Ga0070663_100285892
982 Ga0070678_100787963
983 Ga0070662_100047427
984 Ga0070662_100287705
985 Ga0070662_100922971
986 Ga0068867_100000872
987 Ga0070679_100033921
988 Ga0070679_100131647
989 Ga0070665_100496715
990 Ga0068855_100001020
991 Ga0068855_100014744
992 Ga0068855_100103246
993 Ga0070664_100034159
994 Ga0070664_100222706
995 Ga0068856_100001534
996 Ga0068856_100372840
997 Ga0068859_102045715
998 Ga0068862_100596410
999 Ga0081538_10001906
1000 Ga0097621_100206978
1001 Ga0068871_100005339
1002 Ga0068871_100566446
1003 Ga0075433_10000299
1004 Ga0075433_10011819
1005 Ga0075434_100059706
1006 Ga0068865_100019070
1007 Ga0068865_100813314
1008 Ga0075436_100008751
1009 Ga0097620_102045415
1010 Ga0075435_100199384
1011 Ga0105240_10240122
1012 Ga0105240_10345191
1013 Ga0105245_10031045
1014 Ga0105243_10008313
1015 Ga0105241_10151149
1016 Ga0105242_10033488
1017 Ga0105242_10255942
1018 Ga0105237_10223903
1019 Ga0105238_10242950
1020 Ga0105239_10009203
1021 Ga0157373_10000208
1022 Ga0157373_10105984
1023 Ga0157373_10342570
1024 Ga0157371_10407012
1025 Ga0157370_10245395
1026 Ga0157369_10285537
1027 Ga0157378_10189454
1028 Ga0157372_10001960
1029 Ga0157372_11062449
1030 Ga0157372_11143060
1031 Ga0157377_10091734
1032 Ga0182006_1044792
1033 Ga0209436_100508
1034 Ga0209436_100526
1035 Ga0209563_100015
1036 Ga0207425_1000006
1037 Ga0207425_1000310
1038 Ga0209026_1001421
1039 Ga0209677_103454
1040 Ga0209148_1000607
1041 Ga0209129_1000009
1042 Ga0209129_1005452
1043 Ga0209565_1000006
1044 Ga0209565_1001590
1045 Ga0209565_1010430
1046 Ga0209673_1000004
1047 Ga0209673_1007274
1048 Ga0209130_1000437
1049 Ga0209130_1001628
1050 Ga0209675_1000006
1051 Ga0209675_1000890
1052 Ga0209564_1000085
1053 Ga0209564_1000146
1054 Ga0209564_1003895
1055 Ga0209758_1000047
1056 Ga0209050_1000064
1057 Ga0209050_1011525
1058 Ga0209050_1011744
1059 Ga0209256_1000179
1060 Ga0209256_1000428
1061 Ga0209256_1003975
1062 Ga0209256_1071941
1063 Ga0207426_1002247
1064 Ga0207426_1003558
1065 Ga0209257_1000010
1066 Ga0209257_1001902
1067 Ga0209257_1021334
1068 Ga0207705_10044713
1069 Ga0207705_10298809
1070 Ga0207705_10759528
1071 Ga0207654_10001695
1072 Ga0207671_10138785
1073 Ga0207671_10190862
1074 Ga0207657_10594267
1075 Ga0207649_10009884
1076 Ga0207649_11117299
1077 Ga0207652_10668107
1078 Ga0207687_10376025
1079 Ga0207690_10125276
1080 Ga0207706_10138620
1081 Ga0207706_10298538
1082 Ga0207706_10922525
1083 Ga0207686_10147464
1084 Ga0207709_10010217
1085 Ga0207704_10004481
1086 Ga0207704_10607087
1087 Ga0207689_10000241
1088 Ga0207661_10007731
1089 Ga0207679_10928085
1090 Ga0207679_11085444
1091 Ga0207667_10000896
1092 Ga0207667_10019827
1093 Ga0207667_10531939
1094 Ga0207667_11124227
1095 Ga0207677_10045655
1096 Ga0207639_10554611
1097 Ga0207678_10061347
1098 Ga0207702_10001475
1099 Ga0207702_10723972
1100 Ga0207648_10000756
1101 Ga0207648_10130406
1102 Ga0207674_10082515
1103 Ga0207674_11645664
1104 Ga0207683_10681471
1105 Ga0207698_10150254
1106 Ga0268266_10484789
1107 Ga0265337_1006922
1108 Ga0265337_1007423
1109 Ga0265337_1021153
1110 Ga0265337_1131577
1111 Ga0265319_1001015
1112 Ga0265319_1002638
1113 Ga0265319_1010821
1114 Ga0265319_1014782
1115 Ga0265319_1016186
1116 Ga0265319_1016890
1117 Ga0265319_1043748
1118 Ga0265334_10023332
1119 Ga0265318_10001407
1120 Ga0265318_10007120
1121 Ga0265318_10008469
1122 Ga0265318_10042058
1123 Ga0265318_10345107
1124 Ga0265323_10000069
1125 Ga0265323_10070875
1126 Ga0265322_10000305
1127 Ga0265322_10115042
1128 Ga0265322_10153083
1129 Ga0265336_10010984
1130 Ga0265338_10000329
1131 Ga0265338_10020776
1132 Ga0265338_10072963
1133 Ga0265338_10075568
1134 Ga0265338_10455523
1135 Ga0265338_10732948
1136 Ga0265324_10003662
1137 Ga0265324_10017110
1138 Ga0265324_10063104
1139 Ga0316182_1277600
1140 Ga0265330_10095838
1141 Ga0265330_10109542
1142 Ga0265332_10049693
1143 Ga0265328_10055459
1144 Ga0265320_10000515
1145 Ga0265320_10000735
1146 Ga0265320_10001485
1147 Ga0265320_10002038
1148 Ga0265320_10017525
1149 Ga0265320_10022073
1150 Ga0265320_10030912
1151 Ga0265325_10024461
1152 Ga0265340_10014689
1153 Ga0265339_10051665
1154 Ga0265339_10061599
1155 Ga0265331_10042698
1156 Ga0265331_10043625
1157 Ga0265327_10019749
1158 Ga0265327_10066161
1159 Ga0265316_10002099
1160 Ga0265316_10037727
1161 Ga0265316_10106340
1162 Ga0265316_10150493
1163 Ga0265316_10223063
1164 Ga0265316_10320357
1165 Ga0265316_10338292
1166 Ga0265316_10858917
1167 Ga0307408_100000032
1168 Ga0307408_100000311
1169 Ga0265313_10000228
1170 Ga0265313_10001658
1171 Ga0265313_10046645
1172 Ga0265313_10208918
1173 Ga0265314_10011755
1174 Ga0265314_10051519
1175 Ga0265314_10309112
1176 Ga0265342_10007378
1177 Ga0265342_10060029
1178 Ga0265342_10068863
1179 Ga0265342_10129365
1180 Ga0265342_10470035
1181 Ga0307410_10000013
1182 Ga0307412_10577980
1183 Ga0307412_11407111
1184 Ga0307409_100000031
1185 Ga0307416_100000038
1186 Ga0307416_100014397
1187 Ga0307414_10230779
1188 Ga0373934_0078195
1189 Ga0373940_0031344
1190 Ga0373951_0016056
1191 Ga0373931_0838126
1192 Ga0373935_0141726
1193 Ga0373935_0223992
1194 Ga0373933_0168616
1195 Ga0373933_0349542
1196 Ga0373937_0076142
1197 Ga0373937_1257363
1198 Ga0372808_008597
1199 Ga0310109_033945
1200 Ga0316584_0560662
1201 Ga0395899_0096515
1202 Ga0395899_0149134
1203 Ga0395900_0000337
1204 Ga0395900_0010583
1205 Ga0395900_0017217
1206 Ga0395900_0069541
1207 Ga0395900_0267218
1208 Ga0395898_0064271
1209 Ga0395898_0090383
1210 Ga0395898_0287456
1211 Ga0395898_1070564
1212 Ga0395905_0000015
1213 Ga0395905_0095396
1214 Ga0395905_0190391
1215 Ga0395905_0470630
1216 Ga0395905_0511133
1217 Ga0395905_0659801
1218 Ga0395905_0797259
1219 Ga0395905_0986346
1220 Ga0395901_0000597
1221 Ga0395901_0094595
1222 Ga0395901_0146485
1223 Ga0395901_0195581
1224 Ga0395901_0278048
1225 Ga0395901_0710847
1226 Ga0395901_1081144
1227 Ga0451793_1527940
1228 Ga0451800_0000795
1229 Ga0451837_1317882
1230 Ga0439431_0042404
1231 Ga0439448_0000340
1232 Ga0439448_0013508
1233 Ga0439448_0109091
1234 Ga0439448_0120177
1235 Ga0439449_0027146
1236 Ga0439450_023368
1237 Ga0439450_042007
1238 Ga0439450_096966
1239 Ga0439455_0042334
1240 Ga0450911_017939
1241 Ga0450898_052173
1242 Ga0450903_018547
1243 Ga0439458_0004623
1244 Ga0451577_0035000
1245 Ga0451577_0232719
1246 Ga0451577_0790539
1247 Ga0451577_0957872
1248 Ga0466969_0088195
1249 Ga0466969_0093180
1250 Ga0466972_0000412
1251 Ga0466972_0058334
1252 Ga0453683_0090229
1253 Ga0466965_0028296
1254 Ga0466965_0040500
1255 Ga0466965_0168049
1256 Ga0466965_0491350
1257 Ga0466966_0011762
1258 Ga0466966_0068120
1259 Ga0466966_0950265
1260 Ga0466961_0363837
1261 Ga0466963_0069023
1262 Ga0466964_0010802
1263 Ga0466964_0013498
1264 Ga0466964_0191850
1265 Ga0453684_0000045
1266 Ga0453684_0011780
1267 Ga0453684_0400446
1268 Ga0453684_1647184
1269 Ga0466971_0042616
1270 Ga0466971_0311304
1271 Ga0466968_0002554
1272 Ga0466968_0299089
1273 Ga0466970_0184693
1274 Ga0466970_0306667
1275 Ga0466970_0314634
1276 Ga0466970_0384332
1277 Ga0466957_0000394
1278 Ga0466957_0016249
1279 Ga0466957_0042880
1280 Ga0466957_0222545
1281 Ga0466957_0448731
1282 Ga0466957_1184236
1283 Ga0466960_0094536
1284 Ga0466960_0221664
1285 Ga0466960_0287208
1286 Ga0466960_0485238
1287 Ga0466960_0521380
1288 Ga0451576_0001454
1289 Ga0451576_0001488
1290 Ga0451576_0002783
1291 Ga0451576_0090052
1292 Ga0466958_0085192
1293 Ga0466958_0320888
1294 Ga0466958_0365618
1295 Ga0466958_0833524
1296 Ga0466958_0945408
1297 Ga0466967_0001230
1298 Ga0466967_0032003
1299 Ga0466967_0078034
1300 Ga0466967_0555244
1301 Ga0495617_000002
1302 Ga0495627_001427
1303 Ga0495627_003235
1304 Ga0495603_0035953
1305 Ga0495590_0000007
1306 Ga0495590_0000940
1307 Ga0495590_0006196
1308 Ga0495590_0097701
1309 Ga0495590_0204189
1310 Ga0495590_0260230
1311 Ga0495591_004261
1312 Ga0495591_014849
1313 Ga0495638_0012534
1314 Ga0495638_0431375
1315 Ga0495653_0047254
1316 Ga0495650_0000969
1317 Ga0495650_0033047
1318 Ga0495650_0034752
1319 Ga0495650_0304105
1320 Ga0495580_0070944
1321 Ga0495582_0001028
1322 Ga0495582_0017641
1323 Ga0495605_0001725
1324 Ga0495605_0002728
1325 Ga0495605_0019333
1326 Ga0495605_0031579
1327 Ga0495605_0033247
1328 Ga0495605_0039009
1329 Ga0495605_0055372
1330 Ga0495605_0106870
1331 Ga0495605_0147291
1332 Ga0495639_0037187
1333 Ga0495664_0074512
1334 Ga0495584_0002018
1335 Ga0495584_0003124
1336 Ga0495584_0004097
1337 Ga0495584_0004978
1338 Ga0495584_0008803
1339 Ga0495584_0029095
1340 Ga0495584_0029997
1341 Ga0495584_0032837
1342 Ga0495584_0043913
1343 Ga0495584_0202998
1344 Ga0495585_0000904
1345 Ga0495585_0007432
1346 Ga0495585_0012064
1347 Ga0495585_0014494
1348 Ga0495585_0029018
1349 Ga0495585_0031985
1350 Ga0495585_0034983
1351 Ga0495585_0045765
1352 Ga0495585_0072785
1353 Ga0495585_0138386
1354 Ga0495585_0256344
1355 Ga0495594_0010644
1356 Ga0495594_0023395
1357 Ga0495594_0075294
1358 Ga0495594_0089879
1359 Ga0495594_0095601
1360 Ga0495594_0125443
1361 Ga0495594_0161693
1362 Ga0495596_0002563
1363 Ga0495596_0006747
1364 Ga0495596_0013962
1365 Ga0495596_0015276
1366 Ga0495596_0022377
1367 Ga0495596_0035315
1368 Ga0495596_0037999
1369 Ga0495596_0041037
1370 Ga0495596_0048534
1371 Ga0495596_0066072
1372 Ga0495596_0082437
1373 Ga0495607_0000834
1374 Ga0495607_0003363
1375 Ga0495607_0006325
1376 Ga0495607_0006614
1377 Ga0495607_0010586
1378 Ga0495607_0015612
1379 Ga0495607_0115391
1380 Ga0495583_0001085
1381 Ga0495583_0008146
1382 Ga0495583_0013210
1383 Ga0495583_0024181
1384 Ga0495583_0029225
1385 Ga0495583_0040025
1386 Ga0495583_0085548
1387 Ga0495583_0147558
1388 Ga0495606_0035211
1389 Ga0495606_0051437
1390 Ga0495606_0061813
1391 Ga0495606_0067904
1392 Ga0495606_0109703
1393 Ga0495606_0215779
1394 Ga0495610_0003702
1395 Ga0495610_0062898
1396 Ga0495610_0069794
1397 Ga0495616_0001336
1398 Ga0495616_0009394
1399 Ga0495616_0014430
1400 Ga0495616_0017425
1401 Ga0495616_0024730
1402 Ga0495616_0027390
1403 Ga0495616_0037612
1404 Ga0495616_0057193
1405 Ga0495616_0063395
1406 Ga0495616_0080660
1407 Ga0495616_0110213
1408 Ga0495616_0197301
1409 Ga0495616_0222833
1410 Ga0495630_0009746
1411 Ga0495631_0004761
1412 Ga0495631_0005028
1413 Ga0495631_0005442
1414 Ga0495631_0005524
1415 Ga0495631_0015732
1416 Ga0495631_0037288
1417 Ga0495631_0043721
1418 Ga0495631_0296950
1419 Ga0495632_0000148
1420 Ga0495632_0007100
1421 Ga0495632_0007463
1422 Ga0495632_0008697
1423 Ga0495632_0041328
1424 Ga0495632_0068087
1425 Ga0495632_0166387
1426 Ga0495637_0000006
1427 Ga0495637_0021375
1428 Ga0495637_0043231
1429 Ga0495643_0002220
1430 Ga0495643_0003624
1431 Ga0495643_0020278
1432 Ga0495643_0028825
1433 Ga0495643_0310623
1434 Ga0495643_0358678
1435 Ga0495644_0002343
1436 Ga0495644_0002779
1437 Ga0495644_0004141
1438 Ga0495644_0007340
1439 Ga0495644_0016303
1440 Ga0495644_0022329
1441 Ga0495648_0011970
1442 Ga0495648_0015757
1443 Ga0495648_0024170
1444 Ga0495648_0033135
1445 Ga0495648_0034375
1446 Ga0495648_0063736
1447 Ga0495648_0084832
1448 Ga0495648_0089969
1449 Ga0495648_0126998
1450 Ga0495648_0171750
1451 Ga0495648_0278196
1452 Ga0495648_0310964
1453 Ga0495663_0107264
1454 Ga0495666_0000744
1455 Ga0495666_0012484
1456 Ga0495666_0086650
1457 Ga0495642_0000569
1458 Ga0495642_0003114
1459 Ga0495642_0011383
1460 Ga0495642_0013582
1461 Ga0495642_0015875
1462 Ga0495642_0028613
1463 Ga0495642_0034709
1464 Ga0495642_0119075
1465 Ga0495642_0232852
1466 Ga0495652_0199498
1467 Ga0495654_0009322
1468 Ga0495654_0019833
1469 Ga0495654_0051828
1470 Ga0495654_0102276
1471 Ga0495654_0105954
1472 Ga0495665_0034032
1473 Ga0495665_0053057
1474 Ga0495665_0054761
1475 Ga0495640_0332240
1476 Ga0495586_0030119
1477 Ga0495586_0094793
1478 Ga0495586_0114323
1479 Ga0495586_0527517
1480 Ga0495587_0404604
1481 Ga0495609_0000002
1482 Ga0495609_0000522
1483 Ga0495609_0005081
1484 Ga0495609_0006979
1485 Ga0495609_0013121
1486 Ga0495609_0029855
1487 Ga0495609_0032295
1488 Ga0495609_0263611
1489 Ga0495609_0325757
1490 Ga0495621_0370772
1491 Ga0495597_0001858
1492 Ga0495597_0002415
1493 Ga0495597_0005167
1494 Ga0495597_0009834
1495 Ga0495597_0083286
1496 Ga0495597_0094028
1497 Ga0495597_0108527
1498 Ga0495597_0198054
1499 Ga0495597_0350683
1500 Ga0495645_0129125
1501 Ga0495622_0011709
1502 Ga0495622_0030966
1503 Ga0495622_0033569
1504 Ga0495622_0056631
1505 Ga0495622_0214449
1506 Ga0495633_0005314
1507 Ga0495633_0006247
1508 Ga0495633_0006628
1509 Ga0495633_0038303
1510 Ga0495633_0040400
1511 Ga0495633_0043296
1512 Ga0495633_0079790
1513 Ga0495633_0123935
1514 Ga0495656_0015023
1515 Ga0495656_0074870
1516 Ga0495656_0155276
1517 Ga0495656_0237023
1518 Ga0495656_0245225
1519 Ga0495656_0287665
1520 Ga0495668_0000021
1521 Ga0495668_0000049
1522 Ga0495668_0001558
1523 Ga0495668_0001735
1524 Ga0495668_0007257
1525 Ga0495668_0009224
1526 Ga0495668_0020897
1527 Ga0495668_0027726
1528 Ga0495668_0054902
1529 Ga0495668_0159041
1530 Ga0495634_0058211
1531 Ga0495611_0000309
1532 Ga0495611_0001771
1533 Ga0495611_0004407
1534 Ga0495611_0010876
1535 Ga0495611_0037824
1536 Ga0495611_0038370
1537 Ga0495611_0075955
1538 Ga0495625_0003181
1539 Ga0495625_0014069
1540 Ga0495625_0028518
1541 Ga0495625_0028905
1542 Ga0495625_0039495
1543 Ga0495625_0076032
1544 Ga0495625_0090689
1545 Ga0495625_0257858
1546 Ga0495659_0000098
1547 Ga0495659_0006084
1548 Ga0495659_0343928
1549 Ga0495661_0011074
1550 Ga0495661_0014162
1551 Ga0495661_0023349
1552 Ga0495661_0031136
1553 Ga0495661_0032557
1554 Ga0495661_0033952
1555 Ga0495661_0041378
1556 Ga0495661_0042605
1557 Ga0495661_0043846
1558 Ga0495661_0046043
1559 Ga0495661_0060592
1560 Ga0495661_0067504
1561 Ga0495661_0078056
1562 Ga0495661_0094846
1563 Ga0495661_0100993
1564 Ga0495661_0102976
1565 Ga0495661_0232685
1566 Ga0495661_0315704
1567 Ga0495661_0489791
1568 Ga0495588_0000135
1569 Ga0495588_0017232
1570 Ga0495588_0021690
1571 Ga0495588_0027852
1572 Ga0495588_0028510
1573 Ga0495588_0101812
1574 Ga0495588_0109238
1575 Ga0495588_0124617
1576 Ga0495588_0387781
1577 Ga0495588_0554448
1578 Ga0495623_0042373
1579 Ga0495646_0142442
1580 Ga0495669_0000400
1581 Ga0495669_0000418
1582 Ga0495669_0010842
1583 Ga0495669_0016839
1584 Ga0495669_0029643
1585 Ga0495669_0043868
1586 Ga0495669_0046897
1587 Ga0495669_0049532
1588 Ga0495669_0065511
1589 Ga0495670_0015322
1590 Ga0495670_0015421
1591 Ga0495670_0050606
1592 Ga0495670_0064745
1593 Ga0495670_0092952
1594 Ga0495670_0219178
1595 Ga0495670_0225224
1596 Ga0495670_0246717
1597 Ga0495671_0000522
1598 Ga0495671_0004896
1599 Ga0495671_0021644
1600 Ga0495671_0310795
1601 Ga0495649_0000625
1602 Ga0495649_0005216
1603 Ga0495649_0008026
1604 Ga0495649_0043337
1605 Ga0495649_0075218
1606 Ga0495649_0110193
1607 Ga0495649_0192314
1608 Ga0495649_0216605
1609 Ga0495589_0000353
1610 Ga0495589_0001512
1611 Ga0495589_0002800
1612 Ga0495589_0004643
1613 Ga0495589_0004825
1614 Ga0495589_0008572
1615 Ga0495589_0012156
1616 Ga0495589_0048393
1617 Ga0495589_0083014
1618 Ga0495589_0119006
1619 Ga0495589_0180740
1620 Ga0495589_0191183
1621 Ga0495600_0060647
1622 Ga0495660_0000103
1623 Ga0495660_0003819
1624 Ga0495660_0013708
1625 Ga0495660_0024276
1626 Ga0495660_0035176
1627 Ga0495660_0054077
1628 Ga0495660_0060435
1629 Ga0495660_0102345
1630 Ga0495581_0029213
1631 Ga0495581_0157034
1632 Ga0495581_0364854
1633 Ga0495636_0001265
1634 Ga0495636_0003721
1635 Ga0495636_0040605
1636 Ga0495636_0079855
1637 Ga0495636_0084274
1638 Ga0495672_0000118
1639 Ga0495672_0000287
1640 Ga0495672_0003619
1641 Ga0495672_0009762
1642 Ga0495672_0021332
1643 Ga0495672_0119976
1644 Ga0495672_0230055
1645 Ga0495676_0000627
1646 Ga0495676_0083006
1647 Ga0495676_0403775
1648 Ga0495683_0005242
1649 Ga0495683_0005405
1650 Ga0495683_0016184
1651 Ga0495683_0025633
1652 Ga0495683_0034591
1653 Ga0495683_0369765
1654 Ga0495683_0473340
1655 Ga0495687_000047
1656 Ga0495687_000166
1657 Ga0495687_000210
1658 Ga0495687_018829
1659 Ga0495687_024581
1660 Ga0495687_041822
1661 Ga0495687_090705
1662 Ga0495675_0030262
1663 Ga0495675_0075202
1664 Ga0495677_0000074
1665 Ga0495677_0000920
1666 Ga0495677_0001632
1667 Ga0495677_0005519
1668 Ga0495677_0017567
1669 Ga0495677_0021851
1670 Ga0495677_0034368
1671 Ga0495677_0034631
1672 Ga0495677_0036892
1673 Ga0495677_0216899
1674 Ga0495679_007964
1675 Ga0495679_012140
1676 Ga0495679_018946
1677 Ga0495679_052201
1678 Ga0495679_068310
1679 Ga0495679_122076
1680 Ga0495685_004856
1681 Ga0495685_016653
1682 Ga0495685_152066
1683 Ga0495681_0002867
1684 Ga0495681_0003198
1685 Ga0495681_0009476
1686 Ga0495681_0023512
1687 Ga0495681_0031160
1688 Ga0495681_0183766
1689 Ga0495681_0202704
1690 Ga0495686_0000835
1691 Ga0495686_0006193
1692 Ga0495686_0006400
1693 Ga0495686_0029229
1694 Ga0495686_0078442
1695 Ga0495686_0089005
1696 Ga0495686_0133635
1697 Ga0495593_0051146
1698 Ga0495602_0042177
1699 Ga0495602_0179218
1700 Ga0495614_0020215
1701 Ga0495614_0075094
1702 Ga0495626_0000006
1703 Ga0495626_0000034
1704 Ga0495626_0005441
1705 Ga0495626_0006165
1706 Ga0495626_0006352
1707 Ga0495626_0010572
1708 Ga0495626_0017645
1709 Ga0495626_0019151
1710 Ga0495626_0029193
1711 Ga0495626_0043239
1712 Ga0495626_0053956
1713 Ga0495626_0137375
1714 Ga0496100_0424293
1715 Ga0496101_0118146
1716 Ga0496101_1405113
1717 Ga0496102_0010040
1718 Ga0496102_0197528
1719 Ga0496102_0653733
1720 Ga0496102_0679713
1721 Ga0496102_0759295
1722 Ga0496103_0071730
1723 Ga0496103_0151577
1724 Ga0496103_0179680
1725 Ga0496103_0207447
1726 Ga0496103_0247560
1727 Ga0496104_0066589
1728 Ga0496104_0201582
1729 Ga0496105_0541225
1730 Ga0496106_0004987
1731 Ga0496106_0176687
1732 Ga0496106_0451959
1733 Ga0496107_0012714
1734 Ga0496107_0101165
1735 Ga0496108_0929699
1736 Ga0496109_0034146
1737 Ga0496109_0339540
1738 Ga0496109_0402299
1739 Ga0496109_0724705
1740 Ga0496110_0018489
1741 Ga0496111_0125865
1742 Ga0496111_0810019
1743 Ga0496112_0279929
1744 Ga0496112_0473321
1745 Ga0496113_0024113
1746 Ga0496113_0572695
1747 Ga0496114_0178228
1748 Ga0496115_0406788
1749 Ga0496116_0331977
1750 Ga0496121_0078704
1751 Ga0496122_0003245
1752 Ga0496122_0015414
1753 Ga0496122_0267307
1754 Ga0496123_0013411
1755 Ga0496123_0015341
1756 Ga0496123_0050901
1757 Ga0496124_0026676
1758 Ga0496124_0084722
1759 Ga0496124_0086232
1760 Ga0496124_0087250
1761 Ga0496124_0094902
1762 Ga0496124_0102421
1763 Ga0496125_0007861
1764 Ga0496125_0105869
1765 Ga0496125_0553867
1766 Ga0496126_0145302
1767 Ga0501306_018117
1768 Ga0501308_000946
1769 Ga0501308_018674
1770 Ga0501309_004005
1771 Ga0501304_000167
1772 Ga0501307_006020
1773 Ga0501307_007028
1774 Ga0495678_000113
1775 Ga0495678_000601
1776 Ga0495678_010011
1777 Ga0495678_020985
1778 Ga0495678_076538
1779 Ga0495682_0003524
1780 Ga0495682_0006018
1781 Ga0495682_0009817
1782 Ga0495682_0014169
1783 Ga0495682_0065817
1784 Ga0501311_004404
1785 Ga0501313_006175
1786 Ga0501315_002695
1787 Ga0501315_006164
1788 Ga0501315_035017
1789 Ga0501316_004314
1790 Ga0501316_032082
1791 Ga0501316_075490
1792 Ga0501318_020518
1793 Ga0501323_008593
1794 Ga0501038_0322239
1795 Ga0501042_0472253
1796 Ga0501043_0277175
1797 Ga0501046_0035622
1798 Ga0501046_0529471
1799 Ga0501047_0031101
1800 Ga0501067_0708163
1801 Ga0501070_0248645
1802 Ga0501070_0254639
1803 Ga0501202_050767
1804 Ga0501207_023247
1805 Ga0501227_002378
1806 Ga0501227_021046
1807 Ga0501243_001360
1808 Ga0501083_0005756
1809 Ga0501263_034297
1810 Ga0501263_060529
1811 Ga0501279_003747
1812 Ga0501279_004114
1813 Ga0501279_011654
1814 Ga0501035_0004747
1815 Ga0501035_0006337
1816 Ga0501044_0001471
1817 Ga0501044_1151090
1818 Ga0501226_012002
1819 nmdc:mga0n895_5361_c1
1820 nmdc:mga0rr50_118422_c1
1821 nmdc:mga08x19_13862_c1
1822 nmdc:mga0a205_13293_c1
1823 Ga0500555_014711
1824 Ga0500607_000615
1825 Ga0500607_008419
1826 Ga0500614_039163
1827 Ga0500559_0226021
1828 Ga0500636_0001052
1829 Ga0500637_0092525
1830 Ga0500625_119963
1831 Ga0587084_014618
1832 Ga0587066_053972
1833 Ga0587070_070430
1834 Ga0587073_0049366
1835 Ga0587077_057286
1836 Ga0587082_017491
1837 Ga0587083_0002352
1838 Ga0587083_0041313
1839 Ga0587088_002623
1840 Ga0587091_020084
1841 Ga0587106_001842
1842 Ga0587106_006419
1843 Ga0587101_020970
1844 Ga0587068_002833
1845 Ga0587072_027254
1846 Ga0587076_051532
1847 Ga0587079_025914
1848 Ga0587102_005752
1849 Ga0587105_001963
1850 Ga0501082_1426855
1851 Ga0466962_0050633
1852 Ga0466962_0156304
1853 Ga0466962_0591116
1854 Ga0530510_0523549
1855 2643788683
1856 2643797775
1857 2644213296
1858 2644249636
1859 2644356200
1860 2644472953
1861 2738739147
1862 2738846382
1863 2739274969
1864 2739344013
1865 2765567555
1866 2788436509
1867 2808869378
1868 2809144265
1869 2839099499
1870 8047679074

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

30

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uqr-assembly1.cif.gz_I type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9937 3 144
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9862 2 141
3kip-assembly3.cif.gz_I crystal structure of type-ii 3-dehydroquinase from c. albicans 0.9856 1 142
1uqr-assembly1.cif.gz_F type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9824 3 144
4l8l-assembly1.cif.gz_A crystal structure of the type ii dehydroquinase from pseudomonas aeruginosa 0.9813 3 144
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9653 4 143 3.40.50.9100
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9653 1 143 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9646 3 143 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9596 4 143 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9446 4 143 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A7L5YE95-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 1 144 GO:0003855
GO:0003989
GO:0006633
GO:0008652
GO:0009073
GO:0009317
GO:0009423
GO:0019631
AF-W0V249-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 29 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A522IQJ0-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 1.002 34 143 GO:0003855
GO:0009423
GO:0019631
AF-A0A855HS84-F1-model_v4 deleted 1.001 29 144
AF-A4VPK2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1 3 144 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Map