F486173

General Info

Members Datasets Scaffolds Average Seq Length
935 463 1870 173

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0309145|Ga0496105_0309145_572_1171
Length 199
Sequence MPQSPLSAESSAAAGFFNAIELEKTMEFLSAIKELVPDYAKDIRLNVDGTIARSSLEGNDAVGVALAAAYAAKATKLTSIIRNAGVLSPEETNAALTAAALMGMNNVWYPYLEMADNADLRTQPAGLRMNAYASHGGVDKRRFEMYALAASIIGKCHFCVKSHYENLVAEGMSTTQLRDVGRIAAVINAVALTIEAEKS

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
211 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
212 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
213 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
214 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
215 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
216 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
217 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
242 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
248 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
249 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
250 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
266 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
375 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
390 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
402 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
403 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
414 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
415 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
416 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
417 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
418 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
419 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
420 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
421 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
422 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
423 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
424 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
425 2643221569 Achromobacter sp. Root565 Isolate Unclassified
426 2643221594 Achromobacter sp. Root170 Isolate Unclassified
427 2643221621 Achromobacter sp. Root83 Isolate Unclassified
428 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
429 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
430 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
431 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
432 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
433 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
434 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
435 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
436 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
437 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
438 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
439 2818991450 Burkholderia sp. 604 Isolate Unclassified
440 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
441 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
442 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
443 2858950400 Achromobacter sp. K91 Isolate Unclassified
444 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
445 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
446 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
447 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
448 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
449 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
450 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
451 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
452 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
453 2928058823 Ralstonia sp. 1138 Isolate Unclassified
454 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
455 2941479691
456 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
457 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
458 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
459 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
460 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
461 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
462 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
463 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 2.14
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 1.5
Rhizoplane 6.52
Rhizosphere 69.41
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0309145 3300048908 Bacteria 1269
2 JGI24741J21665_1003361 3300001915 Bacteria 3823
3 JGI24740J21852_10000041 3300001979 Bacteria 42020
4 JGI24740J21852_10001633 3300001979 Bacteria 10334
5 JGI24740J21852_10008694 3300001979 Bacteria 4032
6 JGI24739J22299_10013904 3300001989 Bacteria 2932
7 JGI24739J22299_10033143 3300001989 Bacteria 1770
8 JGI24739J22299_10105049 3300001989 Bacteria 850
9 JGI24737J22298_10041748 3300001990 Bacteria 1406
10 JGI24737J22298_10053319 3300001990 Bacteria 1225
11 JGI24735J21928_10000091 3300002067 Bacteria 34002
12 JGI24735J21928_10001866 3300002067 Bacteria 7386
13 JGI24735J21928_10011992 3300002067 Bacteria 2742
14 JGI24735J21928_10018104 3300002067 Bacteria 2174
15 JGI25156J39149_1000646 3300002705 Bacteria 19037
16 JGI25156J39149_1001062 3300002705 Bacteria 12680
17 JGI25156J39149_1002962 3300002705 Bacteria 5773
18 JGI25156J39149_1006575 3300002705 Bacteria 3156
19 JGI25154J39366_1002233 3300002738 Bacteria 5315
20 JGI25151J46595_10001673 3300003187 Bacteria 14528
21 JGI25151J46595_10002590 3300003187 Bacteria 10673
22 JGI25151J46595_10018669 3300003187 Bacteria 2968
23 JGI25151J46595_10124825 3300003187 Bacteria 650
24 JGI25165J46597_1001137 3300003214 Bacteria 16691
25 rootH1_10098837 3300003316 Bacteria 4108
26 rootL2_10098015 3300003322 Bacteria 1680
27 rootL2_10382709 3300003322 Bacteria 1813
28 rootH1_10134737 3300003323 Bacteria 2210
29 JGI25160J50197_1000185 3300003354 Bacteria 52659
30 Ga0006554J51385_1020631 3300003567 Bacteria 1241
31 Ga0055538_1003408 3300003751 Bacteria 2031
32 Ga0055539_1000062 3300003752 Bacteria 141171
33 Ga0055533_1000298 3300003756 Bacteria 24982
34 Ga0055533_1002564 3300003756 Bacteria 4060
35 Ga0055533_1002709 3300003756 Bacteria 3899
36 Ga0055532_1000019 3300003758 Bacteria 286358
37 Ga0055532_1000027 3300003758 Bacteria 234571
38 Ga0055525_1000275 3300003759 Bacteria 47849
39 Ga0055527_1000019 3300003760 Bacteria 234571
40 Ga0055527_1001040 3300003760 Bacteria 6615
41 Ga0055535_1000014 3300003761 Bacteria 286358
42 Ga0055535_1000021 3300003761 Bacteria 234571
43 Ga0055542_1000032 3300003762 Bacteria 234571
44 Ga0055542_1000961 3300003762 Bacteria 18802
45 Ga0055529_1000038 3300003763 Bacteria 234571
46 Ga0055529_1000086 3300003763 Bacteria 140681
47 Ga0055526_1001285 3300003771 Bacteria 18004
48 Ga0055526_1015718 3300003771 Bacteria 3019
49 Ga0055526_1018400 3300003771 Bacteria 2606
50 Ga0055537_1004036 3300003773 Bacteria 4311
51 Ga0055524_1001113 3300003775 Bacteria 16230
52 Ga0055524_1018331 3300003775 Bacteria 2435
53 Ga0055536_1000034 3300003781 Bacteria 148178
54 Ga0055534_1000550 3300003784 Bacteria 19984
55 Ga0055534_1008796 3300003784 Bacteria 2254
56 Ga0055534_1022196 3300003784 Bacteria 1052
57 Ga0055541_1001800 3300003841 Bacteria 4481
58 Ga0065165_1000591 3300005262 Bacteria 53211
59 Ga0070658_10052963 3300005327 Bacteria 3292
60 Ga0070676_10428585 3300005328 Bacteria 926
61 Ga0070683_100020025 3300005329 Bacteria 5949
62 Ga0068869_100940323 3300005334 Unclassified 750
63 Ga0070666_10076945 3300005335 Bacteria 2277
64 Ga0070682_100331390 3300005337 Bacteria 1128
65 Ga0070682_100719310 3300005337 Bacteria 803
66 Ga0068868_100255852 3300005338 Bacteria 1475
67 Ga0070660_100007556 3300005339 Bacteria 7575
68 Ga0070660_100027436 3300005339 Bacteria 4250
69 Ga0070661_100001754 3300005344 Bacteria 15059
70 Ga0070661_100044368 3300005344 Bacteria 3248
71 Ga0070661_100155113 3300005344 Bacteria 1732
72 Ga0070661_100376018 3300005344 Bacteria 1119
73 Ga0070668_100040327 3300005347 Bacteria 3573
74 Ga0070669_100173220 3300005353 Bacteria 1684
75 Ga0070675_100570982 3300005354 Bacteria 1024
76 Ga0070675_101024806 3300005354 Bacteria 758
77 Ga0070671_100587557 3300005355 Bacteria 962
78 Ga0070674_100625632 3300005356 Bacteria 912
79 Ga0070674_100700696 3300005356 Bacteria 866
80 Ga0070659_100008608 3300005366 Bacteria 7463
81 Ga0070659_100078029 3300005366 Bacteria 2642
82 Ga0070667_100075887 3300005367 Bacteria 2870
83 Ga0070667_100452928 3300005367 Bacteria 1173
84 Ga0070700_100827326 3300005441 Bacteria 748
85 Ga0070663_100000010 3300005455 Bacteria 158193
86 Ga0070663_100104717 3300005455 Bacteria 2116
87 Ga0070663_100118664 3300005455 Bacteria 1996
88 Ga0070663_100741213 3300005455 Bacteria 838
89 Ga0070681_10002686 3300005458 Bacteria 16352
90 Ga0070681_10083560 3300005458 Bacteria 3146
91 Ga0070681_10395393 3300005458 Bacteria 1293
92 Ga0068867_100027566 3300005459 Bacteria 4084
93 Ga0070706_100016789 3300005467 Bacteria 6762
94 Ga0070679_100001227 3300005530 Bacteria 22510
95 Ga0070679_100435654 3300005530 Bacteria 1256
96 Ga0070684_100025198 3300005535 Bacteria 4997
97 Ga0070697_100028393 3300005536 Bacteria 4480
98 Ga0068853_100002964 3300005539 Bacteria 12925
99 Ga0068853_100138624 3300005539 Bacteria 2182
100 Ga0068853_100907792 3300005539 Bacteria 846
101 Ga0068853_101135642 3300005539 Bacteria 754
102 Ga0070672_100171161 3300005543 Bacteria 1806
103 Ga0070672_100315765 3300005543 Bacteria 1327
104 Ga0070695_101095228 3300005545 Bacteria 652
105 Ga0070693_100092541 3300005547 Bacteria 1826
106 Ga0070665_100033702 3300005548 Bacteria 5152
107 Ga0070665_100164076 3300005548 Bacteria 2224
108 Ga0070665_101480114 3300005548 Bacteria 688
109 Ga0068855_100006598 3300005563 Bacteria 14109
110 Ga0070664_100000005 3300005564 Bacteria 222746
111 Ga0070664_100026844 3300005564 Bacteria 4782
112 Ga0068857_100002812 3300005577 Bacteria 14320
113 Ga0068857_100042621 3300005577 Bacteria 4027
114 Ga0068857_100243267 3300005577 Bacteria 1648
115 Ga0068854_100000032 3300005578 Bacteria 106054
116 Ga0068854_100045605 3300005578 Bacteria 3118
117 Ga0068856_100000054 3300005614 Bacteria 104246
118 Ga0068856_100131828 3300005614 Bacteria 2504
119 Ga0068856_100246623 3300005614 Bacteria 1801
120 Ga0070702_100147969 3300005615 Bacteria 1504
121 Ga0068852_100181895 3300005616 Bacteria 1977
122 Ga0068852_100501879 3300005616 Bacteria 1208
123 Ga0068859_100107183 3300005617 Bacteria 2854
124 Ga0068864_100017172 3300005618 Bacteria 6035
125 Ga0068866_10143062 3300005718 Bacteria 1375
126 Ga0068861_101014595 3300005719 Bacteria 793
127 Ga0068861_101228088 3300005719 Bacteria 726
128 Ga0068863_100018468 3300005841 Bacteria 6674
129 Ga0068863_100272170 3300005841 Bacteria 1639
130 Ga0068858_100012259 3300005842 Bacteria 8082
131 Ga0068858_100968759 3300005842 Bacteria 833
132 Ga0068860_100010416 3300005843 Bacteria 9196
133 Ga0068860_100557196 3300005843 Bacteria 1149
134 Ga0068860_100625279 3300005843 Bacteria 1083
135 Ga0068862_100062324 3300005844 Bacteria 3207
136 Ga0068862_100577406 3300005844 Bacteria 1076
137 Ga0075364_10000343 3300006051 Bacteria 23165
138 Ga0075432_10116710 3300006058 Bacteria 999
139 Ga0075366_10000330 3300006195 Bacteria 21707
140 Ga0068871_100359419 3300006358 Bacteria 1290
141 Ga0075428_100442582 3300006844 Bacteria 1392
142 Ga0075428_101201855 3300006844 Bacteria 799
143 Ga0075430_100028691 3300006846 Bacteria 4726
144 Ga0075431_100002878 3300006847 Bacteria 16654
145 Ga0075433_10785549 3300006852 Bacteria 832
146 Ga0075434_100129275 3300006871 Bacteria 2544
147 Ga0075434_100158926 3300006871 Bacteria 2280
148 Ga0075429_100031889 3300006880 Bacteria 4581
149 Ga0068865_100031584 3300006881 Bacteria 3532
150 Ga0097620_100107187 3300006931 Bacteria 2854
151 Ga0099826_10000004 3300006948 Bacteria 802669
152 Ga0075435_100122314 3300007076 Bacteria 2173
153 Ga0105251_10000184 3300009011 Bacteria 62889
154 Ga0105251_10000293 3300009011 Bacteria 50304
155 Ga0105251_10054901 3300009011 Bacteria 1890
156 Ga0105251_10080456 3300009011 Bacteria 1507
157 Ga0105244_10022984 3300009036 Bacteria 3426
158 Ga0105250_10148471 3300009092 Bacteria 974
159 Ga0105250_10292130 3300009092 Bacteria 703
160 Ga0105240_10002359 3300009093 Bacteria 30448
161 Ga0105240_10003095 3300009093 Bacteria 26158
162 Ga0105240_10268140 3300009093 Bacteria 1967
163 Ga0105240_10280953 3300009093 Bacteria 1912
164 Ga0105240_10329382 3300009093 Bacteria 1738
165 Ga0105240_10442198 3300009093 Bacteria 1457
166 Ga0105240_10484586 3300009093 Bacteria 1378
167 Ga0105240_11365160 3300009093 Bacteria 746
168 Ga0105240_12134227 3300009093 Bacteria 581
169 Ga0111539_10044921 3300009094 Bacteria 5290
170 Ga0111539_10571517 3300009094 Bacteria 1317
171 Ga0105245_10765471 3300009098 Bacteria 1002
172 Ga0114129_10034281 3300009147 Bacteria 7169
173 Ga0114129_10533803 3300009147 Bacteria 1528
174 Ga0105243_10191622 3300009148 Bacteria 1786
175 Ga0105243_11454611 3300009148 Bacteria 707
176 Ga0105242_10055147 3300009176 Bacteria 3252
177 Ga0105248_10095583 3300009177 Bacteria 3345
178 Ga0105248_10174075 3300009177 Bacteria 2426
179 Ga0105237_10002731 3300009545 Bacteria 21526
180 Ga0105238_10211276 3300009551 Bacteria 1916
181 Ga0105238_10236796 3300009551 Bacteria 1803
182 Ga0105238_10787334 3300009551 Bacteria 966
183 Ga0105239_10008498 3300010375 Bacteria 11673
184 Ga0157373_10016456 3300013100 Bacteria 5393
185 Ga0157373_10026736 3300013100 Bacteria 4165
186 Ga0157373_10033207 3300013100 Bacteria 3713
187 Ga0157373_10065116 3300013100 Bacteria 2579
188 Ga0157371_10000103 3300013102 Bacteria 128611
189 Ga0157371_10030892 3300013102 Bacteria 3861
190 Ga0157371_10035498 3300013102 Bacteria 3572
191 Ga0157370_10002609 3300013104 Bacteria 21676
192 Ga0157370_10003769 3300013104 Bacteria 17697
193 Ga0157370_10007198 3300013104 Bacteria 12144
194 Ga0157369_10000515 3300013105 Bacteria 50852
195 Ga0157369_10011140 3300013105 Bacteria 10223
196 Ga0157369_10025592 3300013105 Bacteria 6548
197 Ga0157369_10073047 3300013105 Bacteria 3680
198 Ga0157369_10340967 3300013105 Bacteria 1557
199 Ga0157374_10000033 3300013296 Bacteria 185818
200 Ga0157374_10000479 3300013296 Bacteria 36298
201 Ga0157374_10116452 3300013296 Bacteria 2575
202 Ga0157378_10471636 3300013297 Bacteria 1249
203 Ga0157378_10999567 3300013297 Bacteria 871
204 Ga0163162_10004991 3300013306 Bacteria 12789
205 Ga0163162_10012206 3300013306 Bacteria 8385
206 Ga0163162_10105166 3300013306 Bacteria 2917
207 Ga0163162_10470033 3300013306 Bacteria 1389
208 Ga0157372_10000151 3300013307 Bacteria 75926
209 Ga0157372_10001075 3300013307 Bacteria 29808
210 Ga0157372_10020411 3300013307 Bacteria 7147
211 Ga0157372_10053129 3300013307 Bacteria 4514
212 Ga0157375_10015180 3300013308 Bacteria 6891
213 Ga0157375_10721043 3300013308 Bacteria 1150
214 Ga0157380_10013954 3300014326 Bacteria 5866
215 Ga0157380_10078162 3300014326 Bacteria 2698
216 Ga0157380_10205274 3300014326 Bacteria 1752
217 Ga0157380_11496058 3300014326 Bacteria 728
218 Ga0182008_10054527 3300014497 Bacteria 1978
219 Ga0182008_10392561 3300014497 Bacteria 744
220 Ga0157379_10017358 3300014968 Bacteria 6341
221 Ga0157376_10044386 3300014969 Bacteria 3654
222 Ga0157376_10869359 3300014969 Bacteria 918
223 Ga0182006_1084630 3300015261 Bacteria 1151
224 Ga0182006_1109578 3300015261 Bacteria 970
225 Ga0182007_10000413 3300015262 Bacteria 26178
226 Ga0182007_10005838 3300015262 Bacteria 5351
227 Ga0183361_10032 3300016635 Bacteria 51062
228 Ga0163161_10037887 3300017792 Bacteria 3456
229 Ga0197907_10353847 3300020069 Bacteria 2038
230 Ga0206349_1032392 3300020075 Bacteria 1076
231 Ga0206355_1153515 3300020076 Bacteria 1654
232 Ga0206351_10069195 3300020077 Bacteria 11415
233 Ga0206350_11308327 3300020080 Bacteria 1334
234 Ga0154015_1423277 3300020610 Bacteria 27201
235 Ga0213875_10397355 3300021388 Bacteria 657
236 Ga0224712_10059727 3300022467 Bacteria 1515
237 Ga0224712_10085225 3300022467 Bacteria 1312
238 Ga0209435_105095 3300025206 Bacteria 1475
239 Ga0209784_100003 3300025224 Bacteria 1379451
240 Ga0209784_100445 3300025224 Bacteria 17752
241 Ga0209566_100002 3300025225 Bacteria 2614868
242 Ga0209566_100540 3300025225 Bacteria 25625
243 Ga0209566_100748 3300025225 Bacteria 17880
244 Ga0209566_104256 3300025225 Bacteria 1985
245 Ga0209674_100005 3300025226 Bacteria 1708125
246 Ga0209674_100008 3300025226 Bacteria 1076909
247 Ga0209674_100103 3300025226 Bacteria 154966
248 Ga0209674_100239 3300025226 Bacteria 46704
249 Ga0209674_103676 3300025226 Bacteria 2738
250 Ga0209672_100001 3300025228 Bacteria 2828210
251 Ga0209672_100787 3300025228 Bacteria 15121
252 Ga0209672_100814 3300025228 Bacteria 14684
253 Ga0209147_100001 3300025229 Bacteria 2384371
254 Ga0209147_100002 3300025229 Bacteria 2158988
255 Ga0209563_100004 3300025230 Bacteria 1814108
256 Ga0209563_100316 3300025230 Bacteria 19169
257 Ga0207427_103128 3300025231 Bacteria 3721
258 Ga0209258_100001 3300025242 Bacteria 2384269
259 Ga0209258_100002 3300025242 Bacteria 2158988
260 Ga0209646_1000019 3300025246 Bacteria 475248
261 Ga0209646_1023233 3300025246 Bacteria 881
262 Ga0209026_1001789 3300025250 Bacteria 8888
263 Ga0209026_1017300 3300025250 Bacteria 1155
264 Ga0209677_100009 3300025253 Bacteria 749530
265 Ga0209148_1000003 3300025254 Bacteria 2384288
266 Ga0209148_1000193 3300025254 Bacteria 115649
267 Ga0209148_1011092 3300025254 Bacteria 1685
268 Ga0209759_1000219 3300025256 Bacteria 87715
269 Ga0209759_1000653 3300025256 Bacteria 32280
270 Ga0209759_1001904 3300025256 Bacteria 10264
271 Ga0209759_1007353 3300025256 Bacteria 3552
272 Ga0209759_1008171 3300025256 Bacteria 3289
273 Ga0209759_1008442 3300025256 Bacteria 3204
274 Ga0209759_1013403 3300025256 Bacteria 2221
275 Ga0209233_1000043 3300025261 Bacteria 509723
276 Ga0209565_1000066 3300025263 Bacteria 173062
277 Ga0209565_1000191 3300025263 Bacteria 75148
278 Ga0209455_1000001 3300025272 Bacteria 2384278
279 Ga0209455_1000076 3300025272 Bacteria 284092
280 Ga0209673_1020940 3300025273 Bacteria 2300
281 Ga0209673_1036990 3300025273 Bacteria 1440
282 Ga0209130_1016805 3300025284 Bacteria 1759
283 Ga0209675_1000084 3300025291 Bacteria 152066
284 Ga0209675_1002190 3300025291 Bacteria 10244
285 Ga0209675_1003512 3300025291 Bacteria 7402
286 Ga0209676_1000014 3300025292 Bacteria 793514
287 Ga0209676_1003152 3300025292 Bacteria 10531
288 Ga0209025_1000323 3300025294 Bacteria 106442
289 Ga0209025_1001111 3300025294 Bacteria 38546
290 Ga0209025_1001574 3300025294 Bacteria 28861
291 Ga0209025_1003707 3300025294 Bacteria 14042
292 Ga0209025_1044106 3300025294 Bacteria 1869
293 Ga0209564_1000182 3300025295 Bacteria 150744
294 Ga0209564_1000679 3300025295 Bacteria 50214
295 Ga0209564_1001564 3300025295 Bacteria 22453
296 Ga0209564_1004920 3300025295 Bacteria 7905
297 Ga0209758_1015621 3300025297 Bacteria 3916
298 Ga0209050_1005244 3300025298 Bacteria 8264
299 Ga0209256_1000272 3300025299 Bacteria 90458
300 Ga0209256_1005003 3300025299 Bacteria 7926
301 Ga0207426_1000128 3300025302 Bacteria 211383
302 Ga0207426_1004287 3300025302 Bacteria 7060
303 Ga0209051_1003658 3300025303 Bacteria 9954
304 Ga0209051_1026672 3300025303 Bacteria 2323
305 Ga0207656_10254436 3300025321 Bacteria 861
306 Ga0207713_1000402 3300025735 Bacteria 46300
307 Ga0207713_1000487 3300025735 Bacteria 41086
308 Ga0207713_1148885 3300025735 Bacteria 757
309 Ga0207642_10115236 3300025899 Bacteria 1376
310 Ga0207642_10304153 3300025899 Bacteria 925
311 Ga0207688_10181543 3300025901 Bacteria 1255
312 Ga0207680_10053262 3300025903 Bacteria 2428
313 Ga0207680_10180824 3300025903 Bacteria 1426
314 Ga0207645_10008397 3300025907 Bacteria 7205
315 Ga0207705_10013924 3300025909 Bacteria 5800
316 Ga0207705_10074011 3300025909 Bacteria 2472
317 Ga0207684_10090207 3300025910 Bacteria 2612
318 Ga0207707_10097964 3300025912 Bacteria 2563
319 Ga0207707_10110834 3300025912 Bacteria 2399
320 Ga0207695_10000879 3300025913 Bacteria 54696
321 Ga0207695_10002741 3300025913 Bacteria 25691
322 Ga0207695_10013750 3300025913 Bacteria 9630
323 Ga0207695_10297466 3300025913 Bacteria 1505
324 Ga0207695_10420309 3300025913 Bacteria 1221
325 Ga0207671_10135085 3300025914 Bacteria 1896
326 Ga0207662_10076088 3300025918 Bacteria 2040
327 Ga0207662_10149400 3300025918 Bacteria 1485
328 Ga0207657_10000269 3300025919 Bacteria 55259
329 Ga0207657_10098200 3300025919 Bacteria 2434
330 Ga0207649_10000961 3300025920 Bacteria 17881
331 Ga0207649_10020123 3300025920 Bacteria 3822
332 Ga0207649_10158264 3300025920 Bacteria 1567
333 Ga0207652_10966040 3300025921 Bacteria 750
334 Ga0207681_10032337 3300025923 Bacteria 3424
335 Ga0207694_10190010 3300025924 Bacteria 1668
336 Ga0207650_10038563 3300025925 Bacteria 3490
337 Ga0207659_10359741 3300025926 Bacteria 1209
338 Ga0207687_10663313 3300025927 Bacteria 883
339 Ga0207644_10643905 3300025931 Bacteria 882
340 Ga0207690_10043033 3300025932 Bacteria 2970
341 Ga0207706_10144831 3300025933 Bacteria 2090
342 Ga0207669_10231618 3300025937 Bacteria 1363
343 Ga0207669_11558530 3300025937 Bacteria 564
344 Ga0207704_10590083 3300025938 Bacteria 908
345 Ga0207665_10232627 3300025939 Bacteria 1355
346 Ga0207691_10004198 3300025940 Bacteria 13986
347 Ga0207691_10049890 3300025940 Bacteria 3834
348 Ga0207691_10118021 3300025940 Bacteria 2354
349 Ga0207691_10594990 3300025940 Bacteria 936
350 Ga0207711_10060874 3300025941 Bacteria 3254
351 Ga0207661_10047911 3300025944 Bacteria 3394
352 Ga0207679_10000020 3300025945 Bacteria 225727
353 Ga0207679_10690529 3300025945 Bacteria 926
354 Ga0207667_10005200 3300025949 Bacteria 15884
355 Ga0207651_11314277 3300025960 Bacteria 650
356 Ga0207712_11073339 3300025961 Bacteria 716
357 Ga0207668_10000588 3300025972 Bacteria 22596
358 Ga0207668_10019037 3300025972 Bacteria 4331
359 Ga0207640_10000017 3300025981 Bacteria 208145
360 Ga0207640_10110169 3300025981 Bacteria 1950
361 Ga0207658_10707264 3300025986 Bacteria 911
362 Ga0207677_10283532 3300026023 Bacteria 1361
363 Ga0207703_10116406 3300026035 Bacteria 2288
364 Ga0207639_10017592 3300026041 Bacteria 5068
365 Ga0207639_10076238 3300026041 Bacteria 2639
366 Ga0207639_10792064 3300026041 Bacteria 883
367 Ga0207639_11263927 3300026041 Bacteria 693
368 Ga0207678_10000008 3300026067 Bacteria 168926
369 Ga0207678_10029369 3300026067 Bacteria 4798
370 Ga0207678_10082857 3300026067 Bacteria 2744
371 Ga0207678_10174048 3300026067 Bacteria 1838
372 Ga0207708_10211272 3300026075 Bacteria 1551
373 Ga0207708_10421817 3300026075 Bacteria 1106
374 Ga0207702_10000017 3300026078 Bacteria 222964
375 Ga0207702_10182684 3300026078 Bacteria 1932
376 Ga0207702_11226531 3300026078 Bacteria 744
377 Ga0207641_10018387 3300026088 Bacteria 5731
378 Ga0207641_10918642 3300026088 Bacteria 870
379 Ga0207674_10007727 3300026116 Bacteria 12517
380 Ga0207674_10017042 3300026116 Bacteria 7930
381 Ga0207674_10069277 3300026116 Bacteria 3549
382 Ga0207675_100122841 3300026118 Bacteria 2458
383 Ga0207675_101831227 3300026118 Unclassified 626
384 Ga0207683_10034065 3300026121 Bacteria 4425
385 Ga0207683_10150855 3300026121 Bacteria 2097
386 Ga0207698_10047635 3300026142 Bacteria 3249
387 Ga0207698_10081738 3300026142 Bacteria 2609
388 Ga0207698_10860891 3300026142 Bacteria 912
389 Ga0209371_1024030 3300027312 Bacteria 1424
390 Ga0209371_1033628 3300027312 Bacteria 1093
391 Ga0209282_1000099 3300027666 Bacteria 59643
392 Ga0207428_10156290 3300027907 Bacteria 1734
393 Ga0268266_10030298 3300028379 Bacteria 4598
394 Ga0268266_10131138 3300028379 Bacteria 2242
395 Ga0268266_10789748 3300028379 Bacteria 917
396 Ga0268265_10060496 3300028380 Bacteria 2903
397 Ga0268264_10123127 3300028381 Bacteria 2288
398 Ga0268264_10215530 3300028381 Bacteria 1765
399 Ga0268264_10445207 3300028381 Bacteria 1254
400 Ga0265338_10000373 3300028800 Bacteria 80312
401 Ga0268256_1024210 3300030500 Bacteria 1561
402 Ga0268256_1027733 3300030500 Bacteria 1407
403 Ga0316177_1219224 3300030731 Bacteria 1867
404 Ga0314311_1209785 3300030733 Bacteria 821
405 Ga0316178_1077292 3300030735 Bacteria 2304
406 Ga0316180_1107170 3300030736 Bacteria 2671
407 Ga0316183_1149106 3300030742 Bacteria 1155
408 Ga0316181_1028793 3300030744 Bacteria 1565
409 Ga0316182_1026372 3300030745 Bacteria 782
410 Ga0316182_1379610 3300030745 Bacteria 1639
411 Ga0307408_100176938 3300031548 Bacteria 1708
412 Ga0265342_10067675 3300031712 Bacteria 2089
413 Ga0307405_10426478 3300031731 Bacteria 1045
414 Ga0307413_10085260 3300031824 Bacteria 2039
415 Ga0307413_10198044 3300031824 Bacteria 1448
416 Ga0307413_10322876 3300031824 Bacteria 1180
417 Ga0307413_10862344 3300031824 Bacteria 766
418 Ga0307410_10044476 3300031852 Bacteria 2950
419 Ga0307410_10113174 3300031852 Bacteria 1967
420 Ga0307410_10144592 3300031852 Bacteria 1763
421 Ga0307410_10751249 3300031852 Bacteria 826
422 Ga0307406_10265779 3300031901 Bacteria 1300
423 Ga0307407_10025812 3300031903 Bacteria 3103
424 Ga0307407_10247560 3300031903 Bacteria 1219
425 Ga0307412_10000024 3300031911 Bacteria 235467
426 Ga0307412_10000436 3300031911 Bacteria 25202
427 Ga0307412_10463729 3300031911 Bacteria 1047
428 Ga0307412_10666180 3300031911 Bacteria 889
429 Ga0307409_100092316 3300031995 Bacteria 2484
430 Ga0307409_100125404 3300031995 Bacteria 2183
431 Ga0307416_100215162 3300032002 Bacteria 1837
432 Ga0307416_100684568 3300032002 Bacteria 1113
433 Ga0307416_100848664 3300032002 Bacteria 1011
434 Ga0307416_102814189 3300032002 Bacteria 582
435 Ga0307414_10708395 3300032004 Bacteria 912
436 Ga0307415_100028072 3300032126 Bacteria 3575
437 Ga0307415_100329315 3300032126 Bacteria 1277
438 Ga0307415_101008967 3300032126 Bacteria 774
439 Ga0373931_0512054 3300035691 Bacteria 775
440 Ga0373947_0586766 3300035725 Bacteria 759
441 Ga0395900_0038650 3300037418 Bacteria 4919
442 Ga0395900_0093007 3300037418 Bacteria 3098
443 Ga0395900_0095421 3300037418 Bacteria 3056
444 Ga0395900_0526780 3300037418 Bacteria 1129
445 Ga0395898_0010083 3300037466 Bacteria 9888
446 Ga0395898_0266435 3300037466 Bacteria 1634
447 Ga0395905_0000139 3300037471 Bacteria 120342
448 Ga0395905_0025569 3300037471 Bacteria 5567
449 Ga0436364_1537887 3300037853 Bacteria 657
450 Ga0395901_0643803 3300038443 Bacteria 1064
451 Ga0436365_1306015 3300039437 Bacteria 804
452 Ga0436361_0480554 3300039447 Bacteria 8546
453 Ga0436361_0509700 3300039447 Bacteria 920
454 Ga0451853_1606758 3300041512 Bacteria 999
455 Ga0451853_2182218 3300041512 Bacteria 719
456 Ga0439448_0000015 3300042005 Bacteria 28886
457 Ga0450913_004827 3300042117 Bacteria 940
458 Ga0450888_007942 3300042126 Bacteria 1186
459 Ga0451577_0381618 3300042876 Bacteria 1279
460 Ga0466986_0041101 3300044650 Bacteria 3181
461 Ga0466969_0004373 3300044656 Bacteria 7519
462 Ga0466969_0008360 3300044656 Bacteria 5487
463 Ga0466972_0008336 3300044658 Bacteria 5194
464 Ga0466973_0278332 3300044659 Bacteria 1146
465 Ga0466980_0332424 3300044668 Bacteria 895
466 Ga0466978_0053880 3300044671 Bacteria 2508
467 Ga0466982_0101071 3300044672 Bacteria 1786
468 Ga0466965_0000467 3300044683 Bacteria 14283
469 Ga0466965_0025797 3300044683 Bacteria 2847
470 Ga0466965_0043109 3300044683 Bacteria 2227
471 Ga0466966_0011232 3300044684 Bacteria 5941
472 Ga0466961_0000202 3300044693 Bacteria 40048
473 Ga0466961_0014067 3300044693 Bacteria 5132
474 Ga0466961_0020105 3300044693 Bacteria 4297
475 Ga0466961_0309204 3300044693 Bacteria 964
476 Ga0466961_0469565 3300044693 Bacteria 761
477 Ga0466963_0001290 3300044694 Bacteria 13298
478 Ga0466964_0002827 3300044706 Bacteria 6254
479 Ga0466968_0027309 3300044735 Bacteria 2348
480 Ga0466970_0023594 3300044765 Bacteria 3213
481 Ga0466970_0031675 3300044765 Bacteria 2793
482 Ga0466970_0037006 3300044765 Bacteria 2586
483 Ga0466970_0056263 3300044765 Bacteria 2102
484 Ga0466960_0037268 3300044901 Bacteria 2281
485 Ga0466959_0000534 3300045049 Bacteria 22033
486 Ga0466959_0014413 3300045049 Bacteria 5742
487 Ga0466959_0019887 3300045049 Bacteria 4941
488 Ga0451576_1944497 3300045051 Bacteria 606
489 Ga0466958_0000819 3300045836 Bacteria 13738
490 Ga0466958_0185133 3300045836 Bacteria 1322
491 Ga0466967_0099476 3300045976 Bacteria 2656
492 Ga0466967_1055759 3300045976 Bacteria 809
493 Ga0495592_0034124 3300046454 Bacteria 3836
494 Ga0495592_0154430 3300046454 Bacteria 1584
495 Ga0495603_0003816 3300046455 Bacteria 8973
496 Ga0495603_0005929 3300046455 Bacteria 7303
497 Ga0495603_0029084 3300046455 Bacteria 3333
498 Ga0495590_0020740 3300046457 Bacteria 2333
499 Ga0495590_0099860 3300046457 Bacteria 1031
500 Ga0495591_001325 3300046458 Bacteria 15572
501 Ga0495629_0000621 3300046459 Bacteria 28828
502 Ga0495629_0003554 3300046459 Bacteria 11771
503 Ga0495629_0040683 3300046459 Bacteria 3270
504 Ga0495629_0057326 3300046459 Bacteria 2724
505 Ga0495629_0351169 3300046459 Bacteria 1006
506 Ga0495638_0014232 3300046460 Bacteria 5384
507 Ga0495641_0028838 3300046461 Bacteria 2681
508 Ga0495651_0088256 3300046462 Bacteria 2330
509 Ga0495651_0242755 3300046462 Bacteria 1234
510 Ga0495651_0381468 3300046462 Bacteria 924
511 Ga0495653_0025199 3300046463 Bacteria 4784
512 Ga0495653_0076410 3300046463 Bacteria 2490
513 Ga0495653_0133708 3300046463 Bacteria 1752
514 Ga0495653_0344286 3300046463 Bacteria 960
515 Ga0495653_0604849 3300046463 Bacteria 673
516 Ga0495650_0011793 3300046471 Bacteria 4750
517 Ga0495650_0176951 3300046471 Bacteria 752
518 Ga0495580_0002750 3300046472 Bacteria 15155
519 Ga0495580_0013455 3300046472 Bacteria 6240
520 Ga0495580_0029257 3300046472 Bacteria 3999
521 Ga0495580_0035932 3300046472 Bacteria 3561
522 Ga0495580_0036611 3300046472 Bacteria 3523
523 Ga0495580_0054160 3300046472 Bacteria 2830
524 Ga0495582_0016270 3300046473 Bacteria 4074
525 Ga0495582_0033980 3300046473 Bacteria 2804
526 Ga0495605_0010467 3300046474 Bacteria 5187
527 Ga0495605_0017315 3300046474 Bacteria 3884
528 Ga0495605_0017609 3300046474 Bacteria 3842
529 Ga0495605_0017825 3300046474 Bacteria 3815
530 Ga0495662_0023002 3300046476 Bacteria 3009
531 Ga0495662_0363601 3300046476 Bacteria 711
532 Ga0495664_0035726 3300046477 Bacteria 2927
533 Ga0495664_0036436 3300046477 Bacteria 2900
534 Ga0495664_0083549 3300046477 Bacteria 1916
535 Ga0495584_0089198 3300046491 Bacteria 1555
536 Ga0495596_0001108 3300046500 Bacteria 15956
537 Ga0495596_0003240 3300046500 Bacteria 8328
538 Ga0495596_0048457 3300046500 Bacteria 1666
539 Ga0495596_0085457 3300046500 Bacteria 1224
540 Ga0495596_0127958 3300046500 Bacteria 986
541 Ga0495607_0012078 3300046501 Bacteria 5714
542 Ga0495583_0000068 3300046506 Bacteria 188922
543 Ga0495583_0018710 3300046506 Bacteria 3640
544 Ga0495583_0027207 3300046506 Bacteria 2825
545 Ga0495583_0032336 3300046506 Bacteria 2526
546 Ga0495583_0043440 3300046506 Bacteria 2093
547 Ga0495606_0034153 3300046507 Bacteria 3495
548 Ga0495606_0043724 3300046507 Bacteria 2984
549 Ga0495606_0075935 3300046507 Bacteria 2101
550 Ga0495606_0264250 3300046507 Bacteria 948
551 Ga0495608_0017666 3300046511 Bacteria 4932
552 Ga0495608_0166695 3300046511 Bacteria 1399
553 Ga0495608_0448456 3300046511 Bacteria 785
554 Ga0495610_0013689 3300046512 Bacteria 4806
555 Ga0495610_0014902 3300046512 Bacteria 4545
556 Ga0495616_0007070 3300046513 Bacteria 6742
557 Ga0495616_0250338 3300046513 Bacteria 761
558 Ga0495618_0126221 3300046514 Bacteria 1638
559 Ga0495618_0324787 3300046514 Bacteria 952
560 Ga0495618_0527002 3300046514 Bacteria 710
561 Ga0495620_0049235 3300046515 Bacteria 1804
562 Ga0495628_0002857 3300046516 Bacteria 15477
563 Ga0495628_0029333 3300046516 Bacteria 4462
564 Ga0495628_0136832 3300046516 Bacteria 1871
565 Ga0495628_0250843 3300046516 Bacteria 1321
566 Ga0495628_0327447 3300046516 Bacteria 1129
567 Ga0495630_0014598 3300046517 Bacteria 5724
568 Ga0495630_0027944 3300046517 Bacteria 4190
569 Ga0495630_0075991 3300046517 Bacteria 2530
570 Ga0495643_0104551 3300046522 Bacteria 1447
571 Ga0495643_0360632 3300046522 Bacteria 649
572 Ga0495644_0194917 3300046523 Bacteria 780
573 Ga0495648_0029844 3300046524 Bacteria 3613
574 Ga0495648_0047663 3300046524 Bacteria 2646
575 Ga0495648_0069197 3300046524 Bacteria 2055
576 Ga0495648_0073286 3300046524 Bacteria 1978
577 Ga0495648_0089245 3300046524 Bacteria 1730
578 Ga0495648_0093375 3300046524 Bacteria 1678
579 Ga0495663_0003587 3300046525 Bacteria 4461
580 Ga0495666_0012383 3300046526 Bacteria 4251
581 Ga0495666_0016881 3300046526 Bacteria 3635
582 Ga0495666_0077062 3300046526 Bacteria 1580
583 Ga0495642_0008709 3300046528 Bacteria 3876
584 Ga0495642_0088947 3300046528 Bacteria 1306
585 Ga0495642_0295768 3300046528 Bacteria 709
586 Ga0495652_0034961 3300046529 Bacteria 4375
587 Ga0495652_0183910 3300046529 Bacteria 1601
588 Ga0495652_0185574 3300046529 Bacteria 1592
589 Ga0495654_0026546 3300046530 Bacteria 2976
590 Ga0495665_0009569 3300046531 Bacteria 5250
591 Ga0495665_0012689 3300046531 Bacteria 4560
592 Ga0495665_0078242 3300046531 Bacteria 1740
593 Ga0495640_0009173 3300046533 Bacteria 7721
594 Ga0495640_0022060 3300046533 Bacteria 4662
595 Ga0495640_0046438 3300046533 Bacteria 3009
596 Ga0495586_0001230 3300046535 Bacteria 14363
597 Ga0495586_0022072 3300046535 Bacteria 3397
598 Ga0495587_0001551 3300046536 Bacteria 15275
599 Ga0495587_0033824 3300046536 Bacteria 3084
600 Ga0495609_0003326 3300046538 Bacteria 9268
601 Ga0495621_0245748 3300046539 Bacteria 730
602 Ga0495597_0044386 3300046542 Bacteria 1977
603 Ga0495597_0153302 3300046542 Bacteria 944
604 Ga0495597_0175169 3300046542 Bacteria 869
605 Ga0495645_0001069 3300046543 Bacteria 18628
606 Ga0495645_0001820 3300046543 Bacteria 14497
607 Ga0495645_0016349 3300046543 Bacteria 5295
608 Ga0495645_0166677 3300046543 Bacteria 1519
609 Ga0495622_0000298 3300046557 Bacteria 37422
610 Ga0495622_0082588 3300046557 Bacteria 1478
611 Ga0495667_0010583 3300046559 Bacteria 6242
612 Ga0495667_0375985 3300046559 Bacteria 896
613 Ga0495656_0028681 3300046615 Bacteria 2234
614 Ga0495656_0085707 3300046615 Bacteria 1431
615 Ga0495656_0091825 3300046615 Bacteria 1389
616 Ga0495656_0326919 3300046615 Bacteria 791
617 Ga0495668_0601798 3300046616 Bacteria 607
618 Ga0495634_0003726 3300046642 Bacteria 12143
619 Ga0495634_0010925 3300046642 Bacteria 6625
620 Ga0495634_0330265 3300046642 Bacteria 916
621 Ga0495611_0045239 3300046648 Bacteria 1971
622 Ga0495625_0359796 3300046660 Bacteria 918
623 Ga0495625_0406136 3300046660 Bacteria 850
624 Ga0495635_0053654 3300046663 Bacteria 2777
625 Ga0495635_0061583 3300046663 Bacteria 2577
626 Ga0495659_0207905 3300046664 Bacteria 804
627 Ga0495661_0001700 3300046665 Bacteria 17828
628 Ga0495661_0016395 3300046665 Bacteria 4911
629 Ga0495661_0052048 3300046665 Bacteria 2469
630 Ga0495588_0038490 3300046674 Bacteria 2433
631 Ga0495599_0011522 3300046678 Bacteria 5434
632 Ga0495599_0104590 3300046678 Bacteria 1763
633 Ga0495599_0456226 3300046678 Bacteria 756
634 Ga0495623_0046998 3300046679 Bacteria 2739
635 Ga0495623_0104644 3300046679 Bacteria 1721
636 Ga0495623_0122849 3300046679 Bacteria 1561
637 Ga0495646_0004121 3300046680 Bacteria 9124
638 Ga0495646_0066398 3300046680 Bacteria 2133
639 Ga0495646_0108096 3300046680 Bacteria 1586
640 Ga0495646_0144927 3300046680 Bacteria 1325
641 Ga0495669_0024369 3300046684 Bacteria 2635
642 Ga0495669_0075831 3300046684 Bacteria 1539
643 Ga0495624_0006224 3300046690 Bacteria 8483
644 Ga0495624_0029504 3300046690 Bacteria 3578
645 Ga0495624_0131339 3300046690 Bacteria 1535
646 Ga0495624_0145352 3300046690 Bacteria 1451
647 Ga0495670_0253363 3300046691 Bacteria 939
648 Ga0495671_0013958 3300046692 Bacteria 4332
649 Ga0495671_0082832 3300046692 Bacteria 1572
650 Ga0495649_0013958 3300046694 Bacteria 4621
651 Ga0495649_0015869 3300046694 Bacteria 4279
652 Ga0495649_0159382 3300046694 Bacteria 1183
653 Ga0495589_0082395 3300046794 Bacteria 1564
654 Ga0495589_0098603 3300046794 Bacteria 1415
655 Ga0495589_0102386 3300046794 Bacteria 1385
656 Ga0495589_0127612 3300046794 Bacteria 1223
657 Ga0495600_0053478 3300046809 Bacteria 2637
658 Ga0495660_0307469 3300046810 Bacteria 716
659 Ga0495581_0016676 3300047315 Bacteria 4270
660 Ga0495581_0078534 3300047315 Bacteria 1910
661 Ga0495604_0024415 3300047317 Bacteria 4822
662 Ga0495604_0027217 3300047317 Bacteria 4549
663 Ga0495604_0027396 3300047317 Bacteria 4533
664 Ga0495604_0109534 3300047317 Bacteria 2016
665 Ga0495604_0231095 3300047317 Bacteria 1268
666 Ga0495636_0009413 3300047318 Bacteria 3847
667 Ga0495636_0271226 3300047318 Bacteria 788
668 Ga0495636_0305354 3300047318 Bacteria 745
669 Ga0495636_0419735 3300047318 Bacteria 639
670 Ga0495674_0019899 3300047319 Bacteria 6222
671 Ga0495674_0083337 3300047319 Bacteria 2741
672 Ga0495674_0097625 3300047319 Bacteria 2502
673 Ga0495674_0147654 3300047319 Bacteria 1973
674 Ga0495674_0322751 3300047319 Bacteria 1257
675 Ga0495674_0364118 3300047319 Bacteria 1172
676 Ga0495674_0604560 3300047319 Bacteria 868
677 Ga0495672_0004572 3300047320 Bacteria 11247
678 Ga0495672_0012791 3300047320 Bacteria 5831
679 Ga0495676_0052189 3300047321 Bacteria 3266
680 Ga0495676_0085740 3300047321 Bacteria 2372
681 Ga0495680_0038431 3300047322 Bacteria 3824
682 Ga0495680_0042668 3300047322 Bacteria 3597
683 Ga0495680_0043740 3300047322 Bacteria 3544
684 Ga0495683_0000695 3300047323 Bacteria 24629
685 Ga0495683_0016227 3300047323 Bacteria 3868
686 Ga0495687_000022 3300047443 Bacteria 327353
687 Ga0495687_004505 3300047443 Bacteria 9365
688 Ga0495687_039957 3300047443 Bacteria 2071
689 Ga0495687_045290 3300047443 Bacteria 1906
690 Ga0495687_056596 3300047443 Bacteria 1635
691 Ga0495687_179169 3300047443 Bacteria 693
692 Ga0495675_0002394 3300047444 Bacteria 11205
693 Ga0495675_0007474 3300047444 Bacteria 6728
694 Ga0495675_0052046 3300047444 Bacteria 2600
695 Ga0495675_0295225 3300047444 Bacteria 964
696 Ga0495675_0360931 3300047444 Bacteria 853
697 Ga0495679_011806 3300047446 Bacteria 3355
698 Ga0495679_019342 3300047446 Bacteria 2394
699 Ga0495685_032742 3300047447 Bacteria 1786
700 Ga0495685_036773 3300047447 Bacteria 1680
701 Ga0495685_056395 3300047447 Bacteria 1328
702 Ga0495685_177379 3300047447 Bacteria 687
703 Ga0495673_0024843 3300047469 Bacteria 2886
704 Ga0495681_0026216 3300047470 Bacteria 3039
705 Ga0495684_0066135 3300047471 Bacteria 2748
706 Ga0495684_0281827 3300047471 Bacteria 1199
707 Ga0495684_0414072 3300047471 Bacteria 943
708 Ga0495686_0000002 3300047472 Bacteria 1050777
709 Ga0495686_0253002 3300047472 Bacteria 989
710 Ga0495593_0003104 3300047673 Bacteria 9996
711 Ga0495593_0020827 3300047673 Bacteria 3668
712 Ga0495593_0035609 3300047673 Bacteria 2702
713 Ga0495593_0036881 3300047673 Bacteria 2648
714 Ga0495593_0100051 3300047673 Bacteria 1487
715 Ga0495602_0008283 3300048088 Bacteria 10861
716 Ga0495602_0015149 3300048088 Bacteria 7792
717 Ga0495602_0027929 3300048088 Bacteria 5411
718 Ga0495602_0299734 3300048088 Bacteria 1176
719 Ga0495614_0002622 3300048089 Bacteria 7994
720 Ga0495614_0010514 3300048089 Bacteria 4081
721 Ga0496100_0000180 3300048903 Bacteria 35187
722 Ga0496100_0000207 3300048903 Bacteria 32379
723 Ga0496100_0524419 3300048903 Bacteria 914
724 Ga0496100_0554497 3300048903 Bacteria 889
725 Ga0496101_0000547 3300048904 Bacteria 23007
726 Ga0496101_0003927 3300048904 Bacteria 9290
727 Ga0496101_0289396 3300048904 Bacteria 1281
728 Ga0496101_0788419 3300048904 Bacteria 749
729 Ga0496102_0000216 3300048905 Bacteria 76017
730 Ga0496102_0000717 3300048905 Bacteria 32796
731 Ga0496102_0004936 3300048905 Bacteria 11300
732 Ga0496102_0052125 3300048905 Bacteria 3727
733 Ga0496102_0064982 3300048905 Bacteria 3343
734 Ga0496102_0132084 3300048905 Bacteria 2338
735 Ga0496102_0431688 3300048905 Bacteria 1237
736 Ga0496102_0551840 3300048905 Bacteria 1075
737 Ga0496103_0002758 3300048906 Bacteria 10952
738 Ga0496103_0006474 3300048906 Bacteria 6985
739 Ga0496103_0015874 3300048906 Bacteria 4490
740 Ga0496103_0018054 3300048906 Bacteria 4229
741 Ga0496104_0138053 3300048907 Bacteria 2342
742 Ga0496104_0166174 3300048907 Bacteria 2116
743 Ga0496104_0168319 3300048907 Bacteria 2101
744 Ga0496104_0286019 3300048907 Bacteria 1561
745 Ga0496104_0365963 3300048907 Bacteria 1354
746 Ga0496104_0414213 3300048907 Bacteria 1260
747 Ga0496104_0539220 3300048907 Bacteria 1078
748 Ga0496105_0205744 3300048908 Bacteria 1605
749 Ga0496105_0316558 3300048908 Bacteria 1251
750 Ga0496105_0318627 3300048908 Bacteria 1247
751 Ga0496105_0337689 3300048908 Bacteria 1205
752 Ga0496106_0000057 3300048909 Bacteria 90192
753 Ga0496106_0002634 3300048909 Bacteria 13342
754 Ga0496106_0072982 3300048909 Bacteria 2625
755 Ga0496107_0019485 3300048910 Bacteria 4786
756 Ga0496107_0094452 3300048910 Bacteria 2188
757 Ga0496107_0788302 3300048910 Bacteria 696
758 Ga0496107_0805852 3300048910 Bacteria 687
759 Ga0496108_0239564 3300048911 Bacteria 1578
760 Ga0496108_0735661 3300048911 Bacteria 854
761 Ga0496109_0020152 3300048912 Bacteria 5892
762 Ga0496109_0214370 3300048912 Bacteria 1811
763 Ga0496110_0001136 3300048913 Bacteria 18823
764 Ga0496110_0311365 3300048913 Bacteria 1434
765 Ga0496110_0369896 3300048913 Bacteria 1306
766 Ga0496111_0005793 3300048914 Bacteria 7968
767 Ga0496112_0010662 3300048915 Bacteria 8350
768 Ga0496113_0002190 3300048916 Bacteria 11269
769 Ga0496113_0024086 3300048916 Bacteria 4322
770 Ga0496114_0013131 3300048917 Bacteria 6637
771 Ga0496114_0224626 3300048917 Bacteria 1649
772 Ga0496114_0263616 3300048917 Bacteria 1518
773 Ga0496114_0373515 3300048917 Bacteria 1262
774 Ga0496115_0074020 3300048918 Bacteria 2765
775 Ga0496115_0090935 3300048918 Bacteria 2494
776 Ga0496115_0117860 3300048918 Bacteria 2184
777 Ga0496115_0629342 3300048918 Bacteria 850
778 Ga0496116_0001131 3300048919 Bacteria 31790
779 Ga0496116_0019204 3300048919 Bacteria 5239
780 Ga0496116_0019804 3300048919 Bacteria 5138
781 Ga0496116_0052426 3300048919 Bacteria 2703
782 Ga0496116_0084861 3300048919 Bacteria 1949
783 Ga0496116_0099329 3300048919 Bacteria 1743
784 Ga0496116_0151762 3300048919 Bacteria 1285
785 Ga0496116_0165712 3300048919 Bacteria 1205
786 Ga0496117_0001224 3300048920 Bacteria 38444
787 Ga0496117_0006835 3300048920 Bacteria 11351
788 Ga0496117_0007476 3300048920 Bacteria 10657
789 Ga0496117_0008109 3300048920 Bacteria 10047
790 Ga0496117_0016751 3300048920 Bacteria 6161
791 Ga0496117_0083071 3300048920 Bacteria 2096
792 Ga0496117_0100557 3300048920 Bacteria 1831
793 Ga0496117_0477750 3300048920 Bacteria 610
794 Ga0496118_0003743 3300048921 Bacteria 18807
795 Ga0496118_0004212 3300048921 Bacteria 17280
796 Ga0496118_0008399 3300048921 Bacteria 10682
797 Ga0496118_0013944 3300048921 Bacteria 7559
798 Ga0496118_0024474 3300048921 Bacteria 5207
799 Ga0496118_0025276 3300048921 Bacteria 5098
800 Ga0496118_0034131 3300048921 Bacteria 4158
801 Ga0496118_0039332 3300048921 Bacteria 3776
802 Ga0496118_0051436 3300048921 Bacteria 3151
803 Ga0496118_0188849 3300048921 Bacteria 1235
804 Ga0496119_0012281 3300048922 Bacteria 6979
805 Ga0496119_0061704 3300048922 Bacteria 2237
806 Ga0496121_0000446 3300048924 Bacteria 81530
807 Ga0496121_0001895 3300048924 Bacteria 33514
808 Ga0496121_0002624 3300048924 Bacteria 27116
809 Ga0496121_0016560 3300048924 Bacteria 7603
810 Ga0496121_0054867 3300048924 Bacteria 3326
811 Ga0496121_0057297 3300048924 Bacteria 3231
812 Ga0496121_0336263 3300048924 Bacteria 1011
813 Ga0496121_0449482 3300048924 Bacteria 831
814 Ga0496122_0005474 3300048925 Bacteria 15112
815 Ga0496122_0005675 3300048925 Bacteria 14729
816 Ga0496122_0013800 3300048925 Bacteria 7870
817 Ga0496123_0002852 3300048926 Bacteria 20402
818 Ga0496123_0002953 3300048926 Bacteria 19834
819 Ga0496123_0024705 3300048926 Bacteria 4557
820 Ga0496123_0226540 3300048926 Bacteria 939
821 Ga0496124_0143127 3300048927 Bacteria 1884
822 Ga0496124_0155636 3300048927 Bacteria 1788
823 Ga0496124_0294913 3300048927 Bacteria 1174
824 Ga0496125_0000011 3300048928 Bacteria 655895
825 Ga0496125_0002367 3300048928 Bacteria 24660
826 Ga0496125_0017544 3300048928 Bacteria 6819
827 Ga0496125_0053414 3300048928 Bacteria 3312
828 Ga0496125_0062439 3300048928 Bacteria 2979
829 Ga0496125_0328314 3300048928 Bacteria 924
830 Ga0496126_0000083 3300048929 Bacteria 217567
831 Ga0496126_0001580 3300048929 Bacteria 34787
832 Ga0496126_0005065 3300048929 Bacteria 15289
833 Ga0496126_0045036 3300048929 Bacteria 4058
834 Ga0496126_0097518 3300048929 Bacteria 2576
835 Ga0496126_0116147 3300048929 Bacteria 2326
836 Ga0496126_0175925 3300048929 Bacteria 1820
837 Ga0501306_035685 3300049127 Bacteria 755
838 Ga0501310_031526 3300049130 Bacteria 706
839 Ga0495682_0046321 3300049460 Bacteria 1587
840 Ga0501323_004450 3300049539 Bacteria 1484
841 Ga0501032_0587797 3300049569 Bacteria 709
842 Ga0501033_0191769 3300049570 Bacteria 1462
843 Ga0501034_0001301 3300049571 Bacteria 33743
844 Ga0501034_0009210 3300049571 Bacteria 10357
845 Ga0501036_0457068 3300049572 Bacteria 1064
846 Ga0501037_0282163 3300049573 Bacteria 1157
847 Ga0501041_0923807 3300049577 Bacteria 561
848 Ga0501047_0014543 3300049581 Bacteria 7486
849 Ga0501067_0084924 3300049583 Bacteria 1756
850 Ga0501068_0743598 3300049584 Bacteria 642
851 Ga0501073_0004765 3300049589 Bacteria 10180
852 Ga0501074_0217964 3300049590 Bacteria 1359
853 Ga0501075_0294295 3300049591 Bacteria 1237
854 Ga0501080_0007643 3300049742 Bacteria 9775
855 Ga0501083_0631773 3300049744 Bacteria 696
856 Ga0501035_0032407 3300049822 Bacteria 4754
857 Ga0501035_0524287 3300049822 Bacteria 973
858 Ga0501044_0003960 3300049823 Bacteria 16586
859 nmdc:mga00v17_654_c1 3300050491 Bacteria 19164
860 nmdc:mga0k408_215_c1 3300050493 Bacteria 31065
861 nmdc:mga05p37_74663_c1 3300050507 Bacteria 4173
862 nmdc:mga09592_14494_c1 3300050508 Bacteria 6434
863 nmdc:mga0qj67_252320_c1 3300050509 Bacteria 1431
864 nmdc:mga0qj67_40779_c1 3300050509 Bacteria 3649
865 nmdc:mga06r32_6465_c1 3300050510 Bacteria 10528
866 nmdc:mga08y16_602363_c1 3300050511 Bacteria 1107
867 nmdc:mga08y16_62468_c1 3300050511 Bacteria 3890
868 nmdc:mga0n895_256036_c1 3300050512 Bacteria 1776
869 nmdc:mga0n895_384868_c1 3300050512 Bacteria 1419
870 nmdc:mga0rr50_403615_c1 3300050513 Bacteria 1155
871 Ga0500608_095042 3300053122 Bacteria 1387
872 Ga0500634_0048967 3300053161 Bacteria 2279
873 Ga0587073_0013272 3300059492 Bacteria 1444
874 Ga0587082_007883 3300059504 Bacteria 1467
875 Ga0587088_004885 3300059508 Bacteria 1728
876 Ga0587098_001030 3300059604 Bacteria 2008
877 Ga0587106_005715 3300059605 Bacteria 1435
878 Ga0587067_003793 3300059640 Bacteria 1916
879 Ga0587072_000120 3300059643 Bacteria 6424
880 Ga0587111_0013030 3300060346 Bacteria 1479
881 Ga0501082_0241986 3300060353 Bacteria 1570
882 Ga0501082_0249398 3300060353 Bacteria 1545
883 Ga0466962_0013110 3300061719 Bacteria 3988
884 Ga0466962_0059381 3300061719 Bacteria 1825
885 2509128752 2508501125 Bacteria 7208311
886 2513957541 2513237150 Bacteria 6553639
887 2513960854 2513237151 Bacteria 6309801
888 2514044968 2513237165 Bacteria 6771773
889 2514048492 2513237166 Bacteria 10373764
890 2515689246 2515154123 Bacteria 6387382
891 2527075094 2526164713 Bacteria 6780608
892 2563062921 2562617112 Bacteria 10918404
893 2597032309 2596583598 Bacteria 5251611
894 2599444300 2599185178 Bacteria 5365746
895 2599903148 2599185292 Bacteria 6290804
896 2600809681 2600255067 Bacteria 6795583
897 2643862359 2643221569 Bacteria 6064337
898 2643980635 2643221594 Bacteria 5811388
899 2644122062 2643221621 Bacteria 6212786
900 2713477119 2711768613 Bacteria 11048459
901 2723877912 2721755763 Bacteria 4464185
902 2738820836 2738541296 Bacteria 7285013
903 2738833316 2738541298 Bacteria 7286732
904 2738874844 2738541306 Bacteria 7284992
905 2739186473 2738543002 Bacteria 7284546
906 2739221442 2738543008 Bacteria 7282815
907 2739612138 2739367655 Bacteria 4051151
908 2753570280 2751185846 Bacteria 7242164
909 2792836365 2791355137 Bacteria 9654227
910 2809032048 2808606395 Bacteria 6020352
911 2819620274 2818991450 Bacteria 6962147
912 2834641997 2834641062 Bacteria 5559922
913 2857538548 2857537821 Bacteria 5248181
914 2858693066 2858688981 Bacteria 8184122
915 2858955805 2858950400 Bacteria 6783797
916 2881416651 2881412998 Bacteria 6492157
917 2881930243 2881927736 Bacteria 3993927
918 2887377844 2887375801 Bacteria 5334027
919 2900581000 2900577576 Bacteria 5438534
920 2901300773 2901300506 Bacteria 8463898
921 2904484994 2904483920 Bacteria 7545285
922 2904617187 2904615490 Bacteria 10047340
923 2919530717 2919527303 Bacteria 7718827
924 2921651249 2921643360 Bacteria 11448031
925 2928063217 2928058823 Bacteria 5520022
926 2928505211 2928503688 Bacteria 7268108
927 2941481872
928 2945936878 2945934425 Bacteria 7444609
929 2990706396 2990703756 Bacteria 7715990
930 642423216 641736151 Bacteria 7477263
931 642592776 642555112 Bacteria 8676562
932 644747685 644736347 Bacteria 6476522
933 8003404461 8003400568 Bacteria 5535898
934 8055271068 8055266321 Bacteria 7999742
935 8055302477 8055301274 Bacteria 8587385
936 Ga0496105_0309145
937 JGI24741J21665_1003361
938 JGI24740J21852_10000041
939 JGI24740J21852_10001633
940 JGI24740J21852_10008694
941 JGI24739J22299_10013904
942 JGI24739J22299_10033143
943 JGI24739J22299_10105049
944 JGI24737J22298_10041748
945 JGI24737J22298_10053319
946 JGI24735J21928_10000091
947 JGI24735J21928_10001866
948 JGI24735J21928_10011992
949 JGI24735J21928_10018104
950 JGI25156J39149_1000646
951 JGI25156J39149_1001062
952 JGI25156J39149_1002962
953 JGI25156J39149_1006575
954 JGI25154J39366_1002233
955 JGI25151J46595_10001673
956 JGI25151J46595_10002590
957 JGI25151J46595_10018669
958 JGI25151J46595_10124825
959 JGI25165J46597_1001137
960 rootH1_10098837
961 rootL2_10098015
962 rootL2_10382709
963 rootH1_10134737
964 JGI25160J50197_1000185
965 Ga0006554J51385_1020631
966 Ga0055538_1003408
967 Ga0055539_1000062
968 Ga0055533_1000298
969 Ga0055533_1002564
970 Ga0055533_1002709
971 Ga0055532_1000019
972 Ga0055532_1000027
973 Ga0055525_1000275
974 Ga0055527_1000019
975 Ga0055527_1001040
976 Ga0055535_1000014
977 Ga0055535_1000021
978 Ga0055542_1000032
979 Ga0055542_1000961
980 Ga0055529_1000038
981 Ga0055529_1000086
982 Ga0055526_1001285
983 Ga0055526_1015718
984 Ga0055526_1018400
985 Ga0055537_1004036
986 Ga0055524_1001113
987 Ga0055524_1018331
988 Ga0055536_1000034
989 Ga0055534_1000550
990 Ga0055534_1008796
991 Ga0055534_1022196
992 Ga0055541_1001800
993 Ga0065165_1000591
994 Ga0070658_10052963
995 Ga0070676_10428585
996 Ga0070683_100020025
997 Ga0068869_100940323
998 Ga0070666_10076945
999 Ga0070682_100331390
1000 Ga0070682_100719310
1001 Ga0068868_100255852
1002 Ga0070660_100007556
1003 Ga0070660_100027436
1004 Ga0070661_100001754
1005 Ga0070661_100044368
1006 Ga0070661_100155113
1007 Ga0070661_100376018
1008 Ga0070668_100040327
1009 Ga0070669_100173220
1010 Ga0070675_100570982
1011 Ga0070675_101024806
1012 Ga0070671_100587557
1013 Ga0070674_100625632
1014 Ga0070674_100700696
1015 Ga0070659_100008608
1016 Ga0070659_100078029
1017 Ga0070667_100075887
1018 Ga0070667_100452928
1019 Ga0070700_100827326
1020 Ga0070663_100000010
1021 Ga0070663_100104717
1022 Ga0070663_100118664
1023 Ga0070663_100741213
1024 Ga0070681_10002686
1025 Ga0070681_10083560
1026 Ga0070681_10395393
1027 Ga0068867_100027566
1028 Ga0070706_100016789
1029 Ga0070679_100001227
1030 Ga0070679_100435654
1031 Ga0070684_100025198
1032 Ga0070697_100028393
1033 Ga0068853_100002964
1034 Ga0068853_100138624
1035 Ga0068853_100907792
1036 Ga0068853_101135642
1037 Ga0070672_100171161
1038 Ga0070672_100315765
1039 Ga0070695_101095228
1040 Ga0070693_100092541
1041 Ga0070665_100033702
1042 Ga0070665_100164076
1043 Ga0070665_101480114
1044 Ga0068855_100006598
1045 Ga0070664_100000005
1046 Ga0070664_100026844
1047 Ga0068857_100002812
1048 Ga0068857_100042621
1049 Ga0068857_100243267
1050 Ga0068854_100000032
1051 Ga0068854_100045605
1052 Ga0068856_100000054
1053 Ga0068856_100131828
1054 Ga0068856_100246623
1055 Ga0070702_100147969
1056 Ga0068852_100181895
1057 Ga0068852_100501879
1058 Ga0068859_100107183
1059 Ga0068864_100017172
1060 Ga0068866_10143062
1061 Ga0068861_101014595
1062 Ga0068861_101228088
1063 Ga0068863_100018468
1064 Ga0068863_100272170
1065 Ga0068858_100012259
1066 Ga0068858_100968759
1067 Ga0068860_100010416
1068 Ga0068860_100557196
1069 Ga0068860_100625279
1070 Ga0068862_100062324
1071 Ga0068862_100577406
1072 Ga0075364_10000343
1073 Ga0075432_10116710
1074 Ga0075366_10000330
1075 Ga0068871_100359419
1076 Ga0075428_100442582
1077 Ga0075428_101201855
1078 Ga0075430_100028691
1079 Ga0075431_100002878
1080 Ga0075433_10785549
1081 Ga0075434_100129275
1082 Ga0075434_100158926
1083 Ga0075429_100031889
1084 Ga0068865_100031584
1085 Ga0097620_100107187
1086 Ga0099826_10000004
1087 Ga0075435_100122314
1088 Ga0105251_10000184
1089 Ga0105251_10000293
1090 Ga0105251_10054901
1091 Ga0105251_10080456
1092 Ga0105244_10022984
1093 Ga0105250_10148471
1094 Ga0105250_10292130
1095 Ga0105240_10002359
1096 Ga0105240_10003095
1097 Ga0105240_10268140
1098 Ga0105240_10280953
1099 Ga0105240_10329382
1100 Ga0105240_10442198
1101 Ga0105240_10484586
1102 Ga0105240_11365160
1103 Ga0105240_12134227
1104 Ga0111539_10044921
1105 Ga0111539_10571517
1106 Ga0105245_10765471
1107 Ga0114129_10034281
1108 Ga0114129_10533803
1109 Ga0105243_10191622
1110 Ga0105243_11454611
1111 Ga0105242_10055147
1112 Ga0105248_10095583
1113 Ga0105248_10174075
1114 Ga0105237_10002731
1115 Ga0105238_10211276
1116 Ga0105238_10236796
1117 Ga0105238_10787334
1118 Ga0105239_10008498
1119 Ga0157373_10016456
1120 Ga0157373_10026736
1121 Ga0157373_10033207
1122 Ga0157373_10065116
1123 Ga0157371_10000103
1124 Ga0157371_10030892
1125 Ga0157371_10035498
1126 Ga0157370_10002609
1127 Ga0157370_10003769
1128 Ga0157370_10007198
1129 Ga0157369_10000515
1130 Ga0157369_10011140
1131 Ga0157369_10025592
1132 Ga0157369_10073047
1133 Ga0157369_10340967
1134 Ga0157374_10000033
1135 Ga0157374_10000479
1136 Ga0157374_10116452
1137 Ga0157378_10471636
1138 Ga0157378_10999567
1139 Ga0163162_10004991
1140 Ga0163162_10012206
1141 Ga0163162_10105166
1142 Ga0163162_10470033
1143 Ga0157372_10000151
1144 Ga0157372_10001075
1145 Ga0157372_10020411
1146 Ga0157372_10053129
1147 Ga0157375_10015180
1148 Ga0157375_10721043
1149 Ga0157380_10013954
1150 Ga0157380_10078162
1151 Ga0157380_10205274
1152 Ga0157380_11496058
1153 Ga0182008_10054527
1154 Ga0182008_10392561
1155 Ga0157379_10017358
1156 Ga0157376_10044386
1157 Ga0157376_10869359
1158 Ga0182006_1084630
1159 Ga0182006_1109578
1160 Ga0182007_10000413
1161 Ga0182007_10005838
1162 Ga0183361_10032
1163 Ga0163161_10037887
1164 Ga0197907_10353847
1165 Ga0206349_1032392
1166 Ga0206355_1153515
1167 Ga0206351_10069195
1168 Ga0206350_11308327
1169 Ga0154015_1423277
1170 Ga0213875_10397355
1171 Ga0224712_10059727
1172 Ga0224712_10085225
1173 Ga0209435_105095
1174 Ga0209784_100003
1175 Ga0209784_100445
1176 Ga0209566_100002
1177 Ga0209566_100540
1178 Ga0209566_100748
1179 Ga0209566_104256
1180 Ga0209674_100005
1181 Ga0209674_100008
1182 Ga0209674_100103
1183 Ga0209674_100239
1184 Ga0209674_103676
1185 Ga0209672_100001
1186 Ga0209672_100787
1187 Ga0209672_100814
1188 Ga0209147_100001
1189 Ga0209147_100002
1190 Ga0209563_100004
1191 Ga0209563_100316
1192 Ga0207427_103128
1193 Ga0209258_100001
1194 Ga0209258_100002
1195 Ga0209646_1000019
1196 Ga0209646_1023233
1197 Ga0209026_1001789
1198 Ga0209026_1017300
1199 Ga0209677_100009
1200 Ga0209148_1000003
1201 Ga0209148_1000193
1202 Ga0209148_1011092
1203 Ga0209759_1000219
1204 Ga0209759_1000653
1205 Ga0209759_1001904
1206 Ga0209759_1007353
1207 Ga0209759_1008171
1208 Ga0209759_1008442
1209 Ga0209759_1013403
1210 Ga0209233_1000043
1211 Ga0209565_1000066
1212 Ga0209565_1000191
1213 Ga0209455_1000001
1214 Ga0209455_1000076
1215 Ga0209673_1020940
1216 Ga0209673_1036990
1217 Ga0209130_1016805
1218 Ga0209675_1000084
1219 Ga0209675_1002190
1220 Ga0209675_1003512
1221 Ga0209676_1000014
1222 Ga0209676_1003152
1223 Ga0209025_1000323
1224 Ga0209025_1001111
1225 Ga0209025_1001574
1226 Ga0209025_1003707
1227 Ga0209025_1044106
1228 Ga0209564_1000182
1229 Ga0209564_1000679
1230 Ga0209564_1001564
1231 Ga0209564_1004920
1232 Ga0209758_1015621
1233 Ga0209050_1005244
1234 Ga0209256_1000272
1235 Ga0209256_1005003
1236 Ga0207426_1000128
1237 Ga0207426_1004287
1238 Ga0209051_1003658
1239 Ga0209051_1026672
1240 Ga0207656_10254436
1241 Ga0207713_1000402
1242 Ga0207713_1000487
1243 Ga0207713_1148885
1244 Ga0207642_10115236
1245 Ga0207642_10304153
1246 Ga0207688_10181543
1247 Ga0207680_10053262
1248 Ga0207680_10180824
1249 Ga0207645_10008397
1250 Ga0207705_10013924
1251 Ga0207705_10074011
1252 Ga0207684_10090207
1253 Ga0207707_10097964
1254 Ga0207707_10110834
1255 Ga0207695_10000879
1256 Ga0207695_10002741
1257 Ga0207695_10013750
1258 Ga0207695_10297466
1259 Ga0207695_10420309
1260 Ga0207671_10135085
1261 Ga0207662_10076088
1262 Ga0207662_10149400
1263 Ga0207657_10000269
1264 Ga0207657_10098200
1265 Ga0207649_10000961
1266 Ga0207649_10020123
1267 Ga0207649_10158264
1268 Ga0207652_10966040
1269 Ga0207681_10032337
1270 Ga0207694_10190010
1271 Ga0207650_10038563
1272 Ga0207659_10359741
1273 Ga0207687_10663313
1274 Ga0207644_10643905
1275 Ga0207690_10043033
1276 Ga0207706_10144831
1277 Ga0207669_10231618
1278 Ga0207669_11558530
1279 Ga0207704_10590083
1280 Ga0207665_10232627
1281 Ga0207691_10004198
1282 Ga0207691_10049890
1283 Ga0207691_10118021
1284 Ga0207691_10594990
1285 Ga0207711_10060874
1286 Ga0207661_10047911
1287 Ga0207679_10000020
1288 Ga0207679_10690529
1289 Ga0207667_10005200
1290 Ga0207651_11314277
1291 Ga0207712_11073339
1292 Ga0207668_10000588
1293 Ga0207668_10019037
1294 Ga0207640_10000017
1295 Ga0207640_10110169
1296 Ga0207658_10707264
1297 Ga0207677_10283532
1298 Ga0207703_10116406
1299 Ga0207639_10017592
1300 Ga0207639_10076238
1301 Ga0207639_10792064
1302 Ga0207639_11263927
1303 Ga0207678_10000008
1304 Ga0207678_10029369
1305 Ga0207678_10082857
1306 Ga0207678_10174048
1307 Ga0207708_10211272
1308 Ga0207708_10421817
1309 Ga0207702_10000017
1310 Ga0207702_10182684
1311 Ga0207702_11226531
1312 Ga0207641_10018387
1313 Ga0207641_10918642
1314 Ga0207674_10007727
1315 Ga0207674_10017042
1316 Ga0207674_10069277
1317 Ga0207675_100122841
1318 Ga0207675_101831227
1319 Ga0207683_10034065
1320 Ga0207683_10150855
1321 Ga0207698_10047635
1322 Ga0207698_10081738
1323 Ga0207698_10860891
1324 Ga0209371_1024030
1325 Ga0209371_1033628
1326 Ga0209282_1000099
1327 Ga0207428_10156290
1328 Ga0268266_10030298
1329 Ga0268266_10131138
1330 Ga0268266_10789748
1331 Ga0268265_10060496
1332 Ga0268264_10123127
1333 Ga0268264_10215530
1334 Ga0268264_10445207
1335 Ga0265338_10000373
1336 Ga0268256_1024210
1337 Ga0268256_1027733
1338 Ga0316177_1219224
1339 Ga0314311_1209785
1340 Ga0316178_1077292
1341 Ga0316180_1107170
1342 Ga0316183_1149106
1343 Ga0316181_1028793
1344 Ga0316182_1026372
1345 Ga0316182_1379610
1346 Ga0307408_100176938
1347 Ga0265342_10067675
1348 Ga0307405_10426478
1349 Ga0307413_10085260
1350 Ga0307413_10198044
1351 Ga0307413_10322876
1352 Ga0307413_10862344
1353 Ga0307410_10044476
1354 Ga0307410_10113174
1355 Ga0307410_10144592
1356 Ga0307410_10751249
1357 Ga0307406_10265779
1358 Ga0307407_10025812
1359 Ga0307407_10247560
1360 Ga0307412_10000024
1361 Ga0307412_10000436
1362 Ga0307412_10463729
1363 Ga0307412_10666180
1364 Ga0307409_100092316
1365 Ga0307409_100125404
1366 Ga0307416_100215162
1367 Ga0307416_100684568
1368 Ga0307416_100848664
1369 Ga0307416_102814189
1370 Ga0307414_10708395
1371 Ga0307415_100028072
1372 Ga0307415_100329315
1373 Ga0307415_101008967
1374 Ga0373931_0512054
1375 Ga0373947_0586766
1376 Ga0395900_0038650
1377 Ga0395900_0093007
1378 Ga0395900_0095421
1379 Ga0395900_0526780
1380 Ga0395898_0010083
1381 Ga0395898_0266435
1382 Ga0395905_0000139
1383 Ga0395905_0025569
1384 Ga0436364_1537887
1385 Ga0395901_0643803
1386 Ga0436365_1306015
1387 Ga0436361_0480554
1388 Ga0436361_0509700
1389 Ga0451853_1606758
1390 Ga0451853_2182218
1391 Ga0439448_0000015
1392 Ga0450913_004827
1393 Ga0450888_007942
1394 Ga0451577_0381618
1395 Ga0466986_0041101
1396 Ga0466969_0004373
1397 Ga0466969_0008360
1398 Ga0466972_0008336
1399 Ga0466973_0278332
1400 Ga0466980_0332424
1401 Ga0466978_0053880
1402 Ga0466982_0101071
1403 Ga0466965_0000467
1404 Ga0466965_0025797
1405 Ga0466965_0043109
1406 Ga0466966_0011232
1407 Ga0466961_0000202
1408 Ga0466961_0014067
1409 Ga0466961_0020105
1410 Ga0466961_0309204
1411 Ga0466961_0469565
1412 Ga0466963_0001290
1413 Ga0466964_0002827
1414 Ga0466968_0027309
1415 Ga0466970_0023594
1416 Ga0466970_0031675
1417 Ga0466970_0037006
1418 Ga0466970_0056263
1419 Ga0466960_0037268
1420 Ga0466959_0000534
1421 Ga0466959_0014413
1422 Ga0466959_0019887
1423 Ga0451576_1944497
1424 Ga0466958_0000819
1425 Ga0466958_0185133
1426 Ga0466967_0099476
1427 Ga0466967_1055759
1428 Ga0495592_0034124
1429 Ga0495592_0154430
1430 Ga0495603_0003816
1431 Ga0495603_0005929
1432 Ga0495603_0029084
1433 Ga0495590_0020740
1434 Ga0495590_0099860
1435 Ga0495591_001325
1436 Ga0495629_0000621
1437 Ga0495629_0003554
1438 Ga0495629_0040683
1439 Ga0495629_0057326
1440 Ga0495629_0351169
1441 Ga0495638_0014232
1442 Ga0495641_0028838
1443 Ga0495651_0088256
1444 Ga0495651_0242755
1445 Ga0495651_0381468
1446 Ga0495653_0025199
1447 Ga0495653_0076410
1448 Ga0495653_0133708
1449 Ga0495653_0344286
1450 Ga0495653_0604849
1451 Ga0495650_0011793
1452 Ga0495650_0176951
1453 Ga0495580_0002750
1454 Ga0495580_0013455
1455 Ga0495580_0029257
1456 Ga0495580_0035932
1457 Ga0495580_0036611
1458 Ga0495580_0054160
1459 Ga0495582_0016270
1460 Ga0495582_0033980
1461 Ga0495605_0010467
1462 Ga0495605_0017315
1463 Ga0495605_0017609
1464 Ga0495605_0017825
1465 Ga0495662_0023002
1466 Ga0495662_0363601
1467 Ga0495664_0035726
1468 Ga0495664_0036436
1469 Ga0495664_0083549
1470 Ga0495584_0089198
1471 Ga0495596_0001108
1472 Ga0495596_0003240
1473 Ga0495596_0048457
1474 Ga0495596_0085457
1475 Ga0495596_0127958
1476 Ga0495607_0012078
1477 Ga0495583_0000068
1478 Ga0495583_0018710
1479 Ga0495583_0027207
1480 Ga0495583_0032336
1481 Ga0495583_0043440
1482 Ga0495606_0034153
1483 Ga0495606_0043724
1484 Ga0495606_0075935
1485 Ga0495606_0264250
1486 Ga0495608_0017666
1487 Ga0495608_0166695
1488 Ga0495608_0448456
1489 Ga0495610_0013689
1490 Ga0495610_0014902
1491 Ga0495616_0007070
1492 Ga0495616_0250338
1493 Ga0495618_0126221
1494 Ga0495618_0324787
1495 Ga0495618_0527002
1496 Ga0495620_0049235
1497 Ga0495628_0002857
1498 Ga0495628_0029333
1499 Ga0495628_0136832
1500 Ga0495628_0250843
1501 Ga0495628_0327447
1502 Ga0495630_0014598
1503 Ga0495630_0027944
1504 Ga0495630_0075991
1505 Ga0495643_0104551
1506 Ga0495643_0360632
1507 Ga0495644_0194917
1508 Ga0495648_0029844
1509 Ga0495648_0047663
1510 Ga0495648_0069197
1511 Ga0495648_0073286
1512 Ga0495648_0089245
1513 Ga0495648_0093375
1514 Ga0495663_0003587
1515 Ga0495666_0012383
1516 Ga0495666_0016881
1517 Ga0495666_0077062
1518 Ga0495642_0008709
1519 Ga0495642_0088947
1520 Ga0495642_0295768
1521 Ga0495652_0034961
1522 Ga0495652_0183910
1523 Ga0495652_0185574
1524 Ga0495654_0026546
1525 Ga0495665_0009569
1526 Ga0495665_0012689
1527 Ga0495665_0078242
1528 Ga0495640_0009173
1529 Ga0495640_0022060
1530 Ga0495640_0046438
1531 Ga0495586_0001230
1532 Ga0495586_0022072
1533 Ga0495587_0001551
1534 Ga0495587_0033824
1535 Ga0495609_0003326
1536 Ga0495621_0245748
1537 Ga0495597_0044386
1538 Ga0495597_0153302
1539 Ga0495597_0175169
1540 Ga0495645_0001069
1541 Ga0495645_0001820
1542 Ga0495645_0016349
1543 Ga0495645_0166677
1544 Ga0495622_0000298
1545 Ga0495622_0082588
1546 Ga0495667_0010583
1547 Ga0495667_0375985
1548 Ga0495656_0028681
1549 Ga0495656_0085707
1550 Ga0495656_0091825
1551 Ga0495656_0326919
1552 Ga0495668_0601798
1553 Ga0495634_0003726
1554 Ga0495634_0010925
1555 Ga0495634_0330265
1556 Ga0495611_0045239
1557 Ga0495625_0359796
1558 Ga0495625_0406136
1559 Ga0495635_0053654
1560 Ga0495635_0061583
1561 Ga0495659_0207905
1562 Ga0495661_0001700
1563 Ga0495661_0016395
1564 Ga0495661_0052048
1565 Ga0495588_0038490
1566 Ga0495599_0011522
1567 Ga0495599_0104590
1568 Ga0495599_0456226
1569 Ga0495623_0046998
1570 Ga0495623_0104644
1571 Ga0495623_0122849
1572 Ga0495646_0004121
1573 Ga0495646_0066398
1574 Ga0495646_0108096
1575 Ga0495646_0144927
1576 Ga0495669_0024369
1577 Ga0495669_0075831
1578 Ga0495624_0006224
1579 Ga0495624_0029504
1580 Ga0495624_0131339
1581 Ga0495624_0145352
1582 Ga0495670_0253363
1583 Ga0495671_0013958
1584 Ga0495671_0082832
1585 Ga0495649_0013958
1586 Ga0495649_0015869
1587 Ga0495649_0159382
1588 Ga0495589_0082395
1589 Ga0495589_0098603
1590 Ga0495589_0102386
1591 Ga0495589_0127612
1592 Ga0495600_0053478
1593 Ga0495660_0307469
1594 Ga0495581_0016676
1595 Ga0495581_0078534
1596 Ga0495604_0024415
1597 Ga0495604_0027217
1598 Ga0495604_0027396
1599 Ga0495604_0109534
1600 Ga0495604_0231095
1601 Ga0495636_0009413
1602 Ga0495636_0271226
1603 Ga0495636_0305354
1604 Ga0495636_0419735
1605 Ga0495674_0019899
1606 Ga0495674_0083337
1607 Ga0495674_0097625
1608 Ga0495674_0147654
1609 Ga0495674_0322751
1610 Ga0495674_0364118
1611 Ga0495674_0604560
1612 Ga0495672_0004572
1613 Ga0495672_0012791
1614 Ga0495676_0052189
1615 Ga0495676_0085740
1616 Ga0495680_0038431
1617 Ga0495680_0042668
1618 Ga0495680_0043740
1619 Ga0495683_0000695
1620 Ga0495683_0016227
1621 Ga0495687_000022
1622 Ga0495687_004505
1623 Ga0495687_039957
1624 Ga0495687_045290
1625 Ga0495687_056596
1626 Ga0495687_179169
1627 Ga0495675_0002394
1628 Ga0495675_0007474
1629 Ga0495675_0052046
1630 Ga0495675_0295225
1631 Ga0495675_0360931
1632 Ga0495679_011806
1633 Ga0495679_019342
1634 Ga0495685_032742
1635 Ga0495685_036773
1636 Ga0495685_056395
1637 Ga0495685_177379
1638 Ga0495673_0024843
1639 Ga0495681_0026216
1640 Ga0495684_0066135
1641 Ga0495684_0281827
1642 Ga0495684_0414072
1643 Ga0495686_0000002
1644 Ga0495686_0253002
1645 Ga0495593_0003104
1646 Ga0495593_0020827
1647 Ga0495593_0035609
1648 Ga0495593_0036881
1649 Ga0495593_0100051
1650 Ga0495602_0008283
1651 Ga0495602_0015149
1652 Ga0495602_0027929
1653 Ga0495602_0299734
1654 Ga0495614_0002622
1655 Ga0495614_0010514
1656 Ga0496100_0000180
1657 Ga0496100_0000207
1658 Ga0496100_0524419
1659 Ga0496100_0554497
1660 Ga0496101_0000547
1661 Ga0496101_0003927
1662 Ga0496101_0289396
1663 Ga0496101_0788419
1664 Ga0496102_0000216
1665 Ga0496102_0000717
1666 Ga0496102_0004936
1667 Ga0496102_0052125
1668 Ga0496102_0064982
1669 Ga0496102_0132084
1670 Ga0496102_0431688
1671 Ga0496102_0551840
1672 Ga0496103_0002758
1673 Ga0496103_0006474
1674 Ga0496103_0015874
1675 Ga0496103_0018054
1676 Ga0496104_0138053
1677 Ga0496104_0166174
1678 Ga0496104_0168319
1679 Ga0496104_0286019
1680 Ga0496104_0365963
1681 Ga0496104_0414213
1682 Ga0496104_0539220
1683 Ga0496105_0205744
1684 Ga0496105_0316558
1685 Ga0496105_0318627
1686 Ga0496105_0337689
1687 Ga0496106_0000057
1688 Ga0496106_0002634
1689 Ga0496106_0072982
1690 Ga0496107_0019485
1691 Ga0496107_0094452
1692 Ga0496107_0788302
1693 Ga0496107_0805852
1694 Ga0496108_0239564
1695 Ga0496108_0735661
1696 Ga0496109_0020152
1697 Ga0496109_0214370
1698 Ga0496110_0001136
1699 Ga0496110_0311365
1700 Ga0496110_0369896
1701 Ga0496111_0005793
1702 Ga0496112_0010662
1703 Ga0496113_0002190
1704 Ga0496113_0024086
1705 Ga0496114_0013131
1706 Ga0496114_0224626
1707 Ga0496114_0263616
1708 Ga0496114_0373515
1709 Ga0496115_0074020
1710 Ga0496115_0090935
1711 Ga0496115_0117860
1712 Ga0496115_0629342
1713 Ga0496116_0001131
1714 Ga0496116_0019204
1715 Ga0496116_0019804
1716 Ga0496116_0052426
1717 Ga0496116_0084861
1718 Ga0496116_0099329
1719 Ga0496116_0151762
1720 Ga0496116_0165712
1721 Ga0496117_0001224
1722 Ga0496117_0006835
1723 Ga0496117_0007476
1724 Ga0496117_0008109
1725 Ga0496117_0016751
1726 Ga0496117_0083071
1727 Ga0496117_0100557
1728 Ga0496117_0477750
1729 Ga0496118_0003743
1730 Ga0496118_0004212
1731 Ga0496118_0008399
1732 Ga0496118_0013944
1733 Ga0496118_0024474
1734 Ga0496118_0025276
1735 Ga0496118_0034131
1736 Ga0496118_0039332
1737 Ga0496118_0051436
1738 Ga0496118_0188849
1739 Ga0496119_0012281
1740 Ga0496119_0061704
1741 Ga0496121_0000446
1742 Ga0496121_0001895
1743 Ga0496121_0002624
1744 Ga0496121_0016560
1745 Ga0496121_0054867
1746 Ga0496121_0057297
1747 Ga0496121_0336263
1748 Ga0496121_0449482
1749 Ga0496122_0005474
1750 Ga0496122_0005675
1751 Ga0496122_0013800
1752 Ga0496123_0002852
1753 Ga0496123_0002953
1754 Ga0496123_0024705
1755 Ga0496123_0226540
1756 Ga0496124_0143127
1757 Ga0496124_0155636
1758 Ga0496124_0294913
1759 Ga0496125_0000011
1760 Ga0496125_0002367
1761 Ga0496125_0017544
1762 Ga0496125_0053414
1763 Ga0496125_0062439
1764 Ga0496125_0328314
1765 Ga0496126_0000083
1766 Ga0496126_0001580
1767 Ga0496126_0005065
1768 Ga0496126_0045036
1769 Ga0496126_0097518
1770 Ga0496126_0116147
1771 Ga0496126_0175925
1772 Ga0501306_035685
1773 Ga0501310_031526
1774 Ga0495682_0046321
1775 Ga0501323_004450
1776 Ga0501032_0587797
1777 Ga0501033_0191769
1778 Ga0501034_0001301
1779 Ga0501034_0009210
1780 Ga0501036_0457068
1781 Ga0501037_0282163
1782 Ga0501041_0923807
1783 Ga0501047_0014543
1784 Ga0501067_0084924
1785 Ga0501068_0743598
1786 Ga0501073_0004765
1787 Ga0501074_0217964
1788 Ga0501075_0294295
1789 Ga0501080_0007643
1790 Ga0501083_0631773
1791 Ga0501035_0032407
1792 Ga0501035_0524287
1793 Ga0501044_0003960
1794 nmdc:mga00v17_654_c1
1795 nmdc:mga0k408_215_c1
1796 nmdc:mga05p37_74663_c1
1797 nmdc:mga09592_14494_c1
1798 nmdc:mga0qj67_252320_c1
1799 nmdc:mga0qj67_40779_c1
1800 nmdc:mga06r32_6465_c1
1801 nmdc:mga08y16_602363_c1
1802 nmdc:mga08y16_62468_c1
1803 nmdc:mga0n895_256036_c1
1804 nmdc:mga0n895_384868_c1
1805 nmdc:mga0rr50_403615_c1
1806 Ga0500608_095042
1807 Ga0500634_0048967
1808 Ga0587073_0013272
1809 Ga0587082_007883
1810 Ga0587088_004885
1811 Ga0587098_001030
1812 Ga0587106_005715
1813 Ga0587067_003793
1814 Ga0587072_000120
1815 Ga0587111_0013030
1816 Ga0501082_0241986
1817 Ga0501082_0249398
1818 Ga0466962_0013110
1819 Ga0466962_0059381
1820 2509128752
1821 2513957541
1822 2513960854
1823 2514044968
1824 2514048492
1825 2515689246
1826 2527075094
1827 2563062921
1828 2597032309
1829 2599444300
1830 2599903148
1831 2600809681
1832 2643862359
1833 2643980635
1834 2644122062
1835 2713477119
1836 2723877912
1837 2738820836
1838 2738833316
1839 2738874844
1840 2739186473
1841 2739221442
1842 2739612138
1843 2753570280
1844 2792836365
1845 2809032048
1846 2819620274
1847 2834641997
1848 2857538548
1849 2858693066
1850 2858955805
1851 2881416651
1852 2881930243
1853 2887377844
1854 2900581000
1855 2901300773
1856 2904484994
1857 2904617187
1858 2919530717
1859 2921651249
1860 2928063217
1861 2928505211
1862 2941481872
1863 2945936878
1864 2990706396
1865 642423216
1866 642592776
1867 644747685
1868 8003404461
1869 8055271068
1870 8055302477

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

118

198

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lw1-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant 0.9486 5 172
1me5-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9431 5 172
1me5-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9368 5 173
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.928 4 172
1me5-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9261 5 173
ID Description Score Start End Superfamily
1gu9D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9224 6 172 1.20.1290.10
1gu9D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8862 6 172 1.20.1290.10
af_A0A1D6HIR6_965_1113_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5302 58 157 1.25.40.10
af_A0A0R0J5W3_390_482_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5243 57 162 1.25.40.10
af_A0A0R0JM00_163_267_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5225 73 161 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0J9GM36-F1-model_v4 deleted 1.001 1 173
AF-A0A418X0P8-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9975 41 172 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920
AF-G3A7F0-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9971 1 138 GO:0006979
GO:0008785
GO:0032843
GO:0051920
AF-A0A0J9GM36-F1-model_v4 deleted 0.9948 1 173
AF-I3UB35-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9907 78 172 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920

Map