F486173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 463 | 1870 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0309145|Ga0496105_0309145_572_1171 |
| Length | 199 |
| Sequence | MPQSPLSAESSAAAGFFNAIELEKTMEFLSAIKELVPDYAKDIRLNVDGTIARSSLEGNDAVGVALAAAYAAKATKLTSIIRNAGVLSPEETNAALTAAALMGMNNVWYPYLEMADNADLRTQPAGLRMNAYASHGGVDKRRFEMYALAASIIGKCHFCVKSHYENLVAEGMSTTQLRDVGRIAAVINAVALTIEAEKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 212 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 213 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 214 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 215 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 216 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 217 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 242 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 248 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 249 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 250 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 402 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 403 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 414 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 415 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 416 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 417 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 418 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 419 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 420 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 421 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 422 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 423 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 424 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 425 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 426 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 427 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 428 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 429 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 430 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 431 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 432 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 433 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 434 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 435 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 436 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 437 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 438 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 439 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 440 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 441 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 442 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 443 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 444 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 445 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 446 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 447 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 448 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 449 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 450 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 451 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 452 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 453 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 454 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 455 | 2941479691 | |||
| 456 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 457 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 458 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 459 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 460 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 461 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 462 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 463 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.41 |
| Metatranscriptomes | 2.14 |
| Isolates | 5.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.16 |
| Nodule | 1.5 |
| Rhizoplane | 6.52 |
| Rhizosphere | 69.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496105_0309145 | 3300048908 | Bacteria | 1269 |
| 2 | JGI24741J21665_1003361 | 3300001915 | Bacteria | 3823 |
| 3 | JGI24740J21852_10000041 | 3300001979 | Bacteria | 42020 |
| 4 | JGI24740J21852_10001633 | 3300001979 | Bacteria | 10334 |
| 5 | JGI24740J21852_10008694 | 3300001979 | Bacteria | 4032 |
| 6 | JGI24739J22299_10013904 | 3300001989 | Bacteria | 2932 |
| 7 | JGI24739J22299_10033143 | 3300001989 | Bacteria | 1770 |
| 8 | JGI24739J22299_10105049 | 3300001989 | Bacteria | 850 |
| 9 | JGI24737J22298_10041748 | 3300001990 | Bacteria | 1406 |
| 10 | JGI24737J22298_10053319 | 3300001990 | Bacteria | 1225 |
| 11 | JGI24735J21928_10000091 | 3300002067 | Bacteria | 34002 |
| 12 | JGI24735J21928_10001866 | 3300002067 | Bacteria | 7386 |
| 13 | JGI24735J21928_10011992 | 3300002067 | Bacteria | 2742 |
| 14 | JGI24735J21928_10018104 | 3300002067 | Bacteria | 2174 |
| 15 | JGI25156J39149_1000646 | 3300002705 | Bacteria | 19037 |
| 16 | JGI25156J39149_1001062 | 3300002705 | Bacteria | 12680 |
| 17 | JGI25156J39149_1002962 | 3300002705 | Bacteria | 5773 |
| 18 | JGI25156J39149_1006575 | 3300002705 | Bacteria | 3156 |
| 19 | JGI25154J39366_1002233 | 3300002738 | Bacteria | 5315 |
| 20 | JGI25151J46595_10001673 | 3300003187 | Bacteria | 14528 |
| 21 | JGI25151J46595_10002590 | 3300003187 | Bacteria | 10673 |
| 22 | JGI25151J46595_10018669 | 3300003187 | Bacteria | 2968 |
| 23 | JGI25151J46595_10124825 | 3300003187 | Bacteria | 650 |
| 24 | JGI25165J46597_1001137 | 3300003214 | Bacteria | 16691 |
| 25 | rootH1_10098837 | 3300003316 | Bacteria | 4108 |
| 26 | rootL2_10098015 | 3300003322 | Bacteria | 1680 |
| 27 | rootL2_10382709 | 3300003322 | Bacteria | 1813 |
| 28 | rootH1_10134737 | 3300003323 | Bacteria | 2210 |
| 29 | JGI25160J50197_1000185 | 3300003354 | Bacteria | 52659 |
| 30 | Ga0006554J51385_1020631 | 3300003567 | Bacteria | 1241 |
| 31 | Ga0055538_1003408 | 3300003751 | Bacteria | 2031 |
| 32 | Ga0055539_1000062 | 3300003752 | Bacteria | 141171 |
| 33 | Ga0055533_1000298 | 3300003756 | Bacteria | 24982 |
| 34 | Ga0055533_1002564 | 3300003756 | Bacteria | 4060 |
| 35 | Ga0055533_1002709 | 3300003756 | Bacteria | 3899 |
| 36 | Ga0055532_1000019 | 3300003758 | Bacteria | 286358 |
| 37 | Ga0055532_1000027 | 3300003758 | Bacteria | 234571 |
| 38 | Ga0055525_1000275 | 3300003759 | Bacteria | 47849 |
| 39 | Ga0055527_1000019 | 3300003760 | Bacteria | 234571 |
| 40 | Ga0055527_1001040 | 3300003760 | Bacteria | 6615 |
| 41 | Ga0055535_1000014 | 3300003761 | Bacteria | 286358 |
| 42 | Ga0055535_1000021 | 3300003761 | Bacteria | 234571 |
| 43 | Ga0055542_1000032 | 3300003762 | Bacteria | 234571 |
| 44 | Ga0055542_1000961 | 3300003762 | Bacteria | 18802 |
| 45 | Ga0055529_1000038 | 3300003763 | Bacteria | 234571 |
| 46 | Ga0055529_1000086 | 3300003763 | Bacteria | 140681 |
| 47 | Ga0055526_1001285 | 3300003771 | Bacteria | 18004 |
| 48 | Ga0055526_1015718 | 3300003771 | Bacteria | 3019 |
| 49 | Ga0055526_1018400 | 3300003771 | Bacteria | 2606 |
| 50 | Ga0055537_1004036 | 3300003773 | Bacteria | 4311 |
| 51 | Ga0055524_1001113 | 3300003775 | Bacteria | 16230 |
| 52 | Ga0055524_1018331 | 3300003775 | Bacteria | 2435 |
| 53 | Ga0055536_1000034 | 3300003781 | Bacteria | 148178 |
| 54 | Ga0055534_1000550 | 3300003784 | Bacteria | 19984 |
| 55 | Ga0055534_1008796 | 3300003784 | Bacteria | 2254 |
| 56 | Ga0055534_1022196 | 3300003784 | Bacteria | 1052 |
| 57 | Ga0055541_1001800 | 3300003841 | Bacteria | 4481 |
| 58 | Ga0065165_1000591 | 3300005262 | Bacteria | 53211 |
| 59 | Ga0070658_10052963 | 3300005327 | Bacteria | 3292 |
| 60 | Ga0070676_10428585 | 3300005328 | Bacteria | 926 |
| 61 | Ga0070683_100020025 | 3300005329 | Bacteria | 5949 |
| 62 | Ga0068869_100940323 | 3300005334 | Unclassified | 750 |
| 63 | Ga0070666_10076945 | 3300005335 | Bacteria | 2277 |
| 64 | Ga0070682_100331390 | 3300005337 | Bacteria | 1128 |
| 65 | Ga0070682_100719310 | 3300005337 | Bacteria | 803 |
| 66 | Ga0068868_100255852 | 3300005338 | Bacteria | 1475 |
| 67 | Ga0070660_100007556 | 3300005339 | Bacteria | 7575 |
| 68 | Ga0070660_100027436 | 3300005339 | Bacteria | 4250 |
| 69 | Ga0070661_100001754 | 3300005344 | Bacteria | 15059 |
| 70 | Ga0070661_100044368 | 3300005344 | Bacteria | 3248 |
| 71 | Ga0070661_100155113 | 3300005344 | Bacteria | 1732 |
| 72 | Ga0070661_100376018 | 3300005344 | Bacteria | 1119 |
| 73 | Ga0070668_100040327 | 3300005347 | Bacteria | 3573 |
| 74 | Ga0070669_100173220 | 3300005353 | Bacteria | 1684 |
| 75 | Ga0070675_100570982 | 3300005354 | Bacteria | 1024 |
| 76 | Ga0070675_101024806 | 3300005354 | Bacteria | 758 |
| 77 | Ga0070671_100587557 | 3300005355 | Bacteria | 962 |
| 78 | Ga0070674_100625632 | 3300005356 | Bacteria | 912 |
| 79 | Ga0070674_100700696 | 3300005356 | Bacteria | 866 |
| 80 | Ga0070659_100008608 | 3300005366 | Bacteria | 7463 |
| 81 | Ga0070659_100078029 | 3300005366 | Bacteria | 2642 |
| 82 | Ga0070667_100075887 | 3300005367 | Bacteria | 2870 |
| 83 | Ga0070667_100452928 | 3300005367 | Bacteria | 1173 |
| 84 | Ga0070700_100827326 | 3300005441 | Bacteria | 748 |
| 85 | Ga0070663_100000010 | 3300005455 | Bacteria | 158193 |
| 86 | Ga0070663_100104717 | 3300005455 | Bacteria | 2116 |
| 87 | Ga0070663_100118664 | 3300005455 | Bacteria | 1996 |
| 88 | Ga0070663_100741213 | 3300005455 | Bacteria | 838 |
| 89 | Ga0070681_10002686 | 3300005458 | Bacteria | 16352 |
| 90 | Ga0070681_10083560 | 3300005458 | Bacteria | 3146 |
| 91 | Ga0070681_10395393 | 3300005458 | Bacteria | 1293 |
| 92 | Ga0068867_100027566 | 3300005459 | Bacteria | 4084 |
| 93 | Ga0070706_100016789 | 3300005467 | Bacteria | 6762 |
| 94 | Ga0070679_100001227 | 3300005530 | Bacteria | 22510 |
| 95 | Ga0070679_100435654 | 3300005530 | Bacteria | 1256 |
| 96 | Ga0070684_100025198 | 3300005535 | Bacteria | 4997 |
| 97 | Ga0070697_100028393 | 3300005536 | Bacteria | 4480 |
| 98 | Ga0068853_100002964 | 3300005539 | Bacteria | 12925 |
| 99 | Ga0068853_100138624 | 3300005539 | Bacteria | 2182 |
| 100 | Ga0068853_100907792 | 3300005539 | Bacteria | 846 |
| 101 | Ga0068853_101135642 | 3300005539 | Bacteria | 754 |
| 102 | Ga0070672_100171161 | 3300005543 | Bacteria | 1806 |
| 103 | Ga0070672_100315765 | 3300005543 | Bacteria | 1327 |
| 104 | Ga0070695_101095228 | 3300005545 | Bacteria | 652 |
| 105 | Ga0070693_100092541 | 3300005547 | Bacteria | 1826 |
| 106 | Ga0070665_100033702 | 3300005548 | Bacteria | 5152 |
| 107 | Ga0070665_100164076 | 3300005548 | Bacteria | 2224 |
| 108 | Ga0070665_101480114 | 3300005548 | Bacteria | 688 |
| 109 | Ga0068855_100006598 | 3300005563 | Bacteria | 14109 |
| 110 | Ga0070664_100000005 | 3300005564 | Bacteria | 222746 |
| 111 | Ga0070664_100026844 | 3300005564 | Bacteria | 4782 |
| 112 | Ga0068857_100002812 | 3300005577 | Bacteria | 14320 |
| 113 | Ga0068857_100042621 | 3300005577 | Bacteria | 4027 |
| 114 | Ga0068857_100243267 | 3300005577 | Bacteria | 1648 |
| 115 | Ga0068854_100000032 | 3300005578 | Bacteria | 106054 |
| 116 | Ga0068854_100045605 | 3300005578 | Bacteria | 3118 |
| 117 | Ga0068856_100000054 | 3300005614 | Bacteria | 104246 |
| 118 | Ga0068856_100131828 | 3300005614 | Bacteria | 2504 |
| 119 | Ga0068856_100246623 | 3300005614 | Bacteria | 1801 |
| 120 | Ga0070702_100147969 | 3300005615 | Bacteria | 1504 |
| 121 | Ga0068852_100181895 | 3300005616 | Bacteria | 1977 |
| 122 | Ga0068852_100501879 | 3300005616 | Bacteria | 1208 |
| 123 | Ga0068859_100107183 | 3300005617 | Bacteria | 2854 |
| 124 | Ga0068864_100017172 | 3300005618 | Bacteria | 6035 |
| 125 | Ga0068866_10143062 | 3300005718 | Bacteria | 1375 |
| 126 | Ga0068861_101014595 | 3300005719 | Bacteria | 793 |
| 127 | Ga0068861_101228088 | 3300005719 | Bacteria | 726 |
| 128 | Ga0068863_100018468 | 3300005841 | Bacteria | 6674 |
| 129 | Ga0068863_100272170 | 3300005841 | Bacteria | 1639 |
| 130 | Ga0068858_100012259 | 3300005842 | Bacteria | 8082 |
| 131 | Ga0068858_100968759 | 3300005842 | Bacteria | 833 |
| 132 | Ga0068860_100010416 | 3300005843 | Bacteria | 9196 |
| 133 | Ga0068860_100557196 | 3300005843 | Bacteria | 1149 |
| 134 | Ga0068860_100625279 | 3300005843 | Bacteria | 1083 |
| 135 | Ga0068862_100062324 | 3300005844 | Bacteria | 3207 |
| 136 | Ga0068862_100577406 | 3300005844 | Bacteria | 1076 |
| 137 | Ga0075364_10000343 | 3300006051 | Bacteria | 23165 |
| 138 | Ga0075432_10116710 | 3300006058 | Bacteria | 999 |
| 139 | Ga0075366_10000330 | 3300006195 | Bacteria | 21707 |
| 140 | Ga0068871_100359419 | 3300006358 | Bacteria | 1290 |
| 141 | Ga0075428_100442582 | 3300006844 | Bacteria | 1392 |
| 142 | Ga0075428_101201855 | 3300006844 | Bacteria | 799 |
| 143 | Ga0075430_100028691 | 3300006846 | Bacteria | 4726 |
| 144 | Ga0075431_100002878 | 3300006847 | Bacteria | 16654 |
| 145 | Ga0075433_10785549 | 3300006852 | Bacteria | 832 |
| 146 | Ga0075434_100129275 | 3300006871 | Bacteria | 2544 |
| 147 | Ga0075434_100158926 | 3300006871 | Bacteria | 2280 |
| 148 | Ga0075429_100031889 | 3300006880 | Bacteria | 4581 |
| 149 | Ga0068865_100031584 | 3300006881 | Bacteria | 3532 |
| 150 | Ga0097620_100107187 | 3300006931 | Bacteria | 2854 |
| 151 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 152 | Ga0075435_100122314 | 3300007076 | Bacteria | 2173 |
| 153 | Ga0105251_10000184 | 3300009011 | Bacteria | 62889 |
| 154 | Ga0105251_10000293 | 3300009011 | Bacteria | 50304 |
| 155 | Ga0105251_10054901 | 3300009011 | Bacteria | 1890 |
| 156 | Ga0105251_10080456 | 3300009011 | Bacteria | 1507 |
| 157 | Ga0105244_10022984 | 3300009036 | Bacteria | 3426 |
| 158 | Ga0105250_10148471 | 3300009092 | Bacteria | 974 |
| 159 | Ga0105250_10292130 | 3300009092 | Bacteria | 703 |
| 160 | Ga0105240_10002359 | 3300009093 | Bacteria | 30448 |
| 161 | Ga0105240_10003095 | 3300009093 | Bacteria | 26158 |
| 162 | Ga0105240_10268140 | 3300009093 | Bacteria | 1967 |
| 163 | Ga0105240_10280953 | 3300009093 | Bacteria | 1912 |
| 164 | Ga0105240_10329382 | 3300009093 | Bacteria | 1738 |
| 165 | Ga0105240_10442198 | 3300009093 | Bacteria | 1457 |
| 166 | Ga0105240_10484586 | 3300009093 | Bacteria | 1378 |
| 167 | Ga0105240_11365160 | 3300009093 | Bacteria | 746 |
| 168 | Ga0105240_12134227 | 3300009093 | Bacteria | 581 |
| 169 | Ga0111539_10044921 | 3300009094 | Bacteria | 5290 |
| 170 | Ga0111539_10571517 | 3300009094 | Bacteria | 1317 |
| 171 | Ga0105245_10765471 | 3300009098 | Bacteria | 1002 |
| 172 | Ga0114129_10034281 | 3300009147 | Bacteria | 7169 |
| 173 | Ga0114129_10533803 | 3300009147 | Bacteria | 1528 |
| 174 | Ga0105243_10191622 | 3300009148 | Bacteria | 1786 |
| 175 | Ga0105243_11454611 | 3300009148 | Bacteria | 707 |
| 176 | Ga0105242_10055147 | 3300009176 | Bacteria | 3252 |
| 177 | Ga0105248_10095583 | 3300009177 | Bacteria | 3345 |
| 178 | Ga0105248_10174075 | 3300009177 | Bacteria | 2426 |
| 179 | Ga0105237_10002731 | 3300009545 | Bacteria | 21526 |
| 180 | Ga0105238_10211276 | 3300009551 | Bacteria | 1916 |
| 181 | Ga0105238_10236796 | 3300009551 | Bacteria | 1803 |
| 182 | Ga0105238_10787334 | 3300009551 | Bacteria | 966 |
| 183 | Ga0105239_10008498 | 3300010375 | Bacteria | 11673 |
| 184 | Ga0157373_10016456 | 3300013100 | Bacteria | 5393 |
| 185 | Ga0157373_10026736 | 3300013100 | Bacteria | 4165 |
| 186 | Ga0157373_10033207 | 3300013100 | Bacteria | 3713 |
| 187 | Ga0157373_10065116 | 3300013100 | Bacteria | 2579 |
| 188 | Ga0157371_10000103 | 3300013102 | Bacteria | 128611 |
| 189 | Ga0157371_10030892 | 3300013102 | Bacteria | 3861 |
| 190 | Ga0157371_10035498 | 3300013102 | Bacteria | 3572 |
| 191 | Ga0157370_10002609 | 3300013104 | Bacteria | 21676 |
| 192 | Ga0157370_10003769 | 3300013104 | Bacteria | 17697 |
| 193 | Ga0157370_10007198 | 3300013104 | Bacteria | 12144 |
| 194 | Ga0157369_10000515 | 3300013105 | Bacteria | 50852 |
| 195 | Ga0157369_10011140 | 3300013105 | Bacteria | 10223 |
| 196 | Ga0157369_10025592 | 3300013105 | Bacteria | 6548 |
| 197 | Ga0157369_10073047 | 3300013105 | Bacteria | 3680 |
| 198 | Ga0157369_10340967 | 3300013105 | Bacteria | 1557 |
| 199 | Ga0157374_10000033 | 3300013296 | Bacteria | 185818 |
| 200 | Ga0157374_10000479 | 3300013296 | Bacteria | 36298 |
| 201 | Ga0157374_10116452 | 3300013296 | Bacteria | 2575 |
| 202 | Ga0157378_10471636 | 3300013297 | Bacteria | 1249 |
| 203 | Ga0157378_10999567 | 3300013297 | Bacteria | 871 |
| 204 | Ga0163162_10004991 | 3300013306 | Bacteria | 12789 |
| 205 | Ga0163162_10012206 | 3300013306 | Bacteria | 8385 |
| 206 | Ga0163162_10105166 | 3300013306 | Bacteria | 2917 |
| 207 | Ga0163162_10470033 | 3300013306 | Bacteria | 1389 |
| 208 | Ga0157372_10000151 | 3300013307 | Bacteria | 75926 |
| 209 | Ga0157372_10001075 | 3300013307 | Bacteria | 29808 |
| 210 | Ga0157372_10020411 | 3300013307 | Bacteria | 7147 |
| 211 | Ga0157372_10053129 | 3300013307 | Bacteria | 4514 |
| 212 | Ga0157375_10015180 | 3300013308 | Bacteria | 6891 |
| 213 | Ga0157375_10721043 | 3300013308 | Bacteria | 1150 |
| 214 | Ga0157380_10013954 | 3300014326 | Bacteria | 5866 |
| 215 | Ga0157380_10078162 | 3300014326 | Bacteria | 2698 |
| 216 | Ga0157380_10205274 | 3300014326 | Bacteria | 1752 |
| 217 | Ga0157380_11496058 | 3300014326 | Bacteria | 728 |
| 218 | Ga0182008_10054527 | 3300014497 | Bacteria | 1978 |
| 219 | Ga0182008_10392561 | 3300014497 | Bacteria | 744 |
| 220 | Ga0157379_10017358 | 3300014968 | Bacteria | 6341 |
| 221 | Ga0157376_10044386 | 3300014969 | Bacteria | 3654 |
| 222 | Ga0157376_10869359 | 3300014969 | Bacteria | 918 |
| 223 | Ga0182006_1084630 | 3300015261 | Bacteria | 1151 |
| 224 | Ga0182006_1109578 | 3300015261 | Bacteria | 970 |
| 225 | Ga0182007_10000413 | 3300015262 | Bacteria | 26178 |
| 226 | Ga0182007_10005838 | 3300015262 | Bacteria | 5351 |
| 227 | Ga0183361_10032 | 3300016635 | Bacteria | 51062 |
| 228 | Ga0163161_10037887 | 3300017792 | Bacteria | 3456 |
| 229 | Ga0197907_10353847 | 3300020069 | Bacteria | 2038 |
| 230 | Ga0206349_1032392 | 3300020075 | Bacteria | 1076 |
| 231 | Ga0206355_1153515 | 3300020076 | Bacteria | 1654 |
| 232 | Ga0206351_10069195 | 3300020077 | Bacteria | 11415 |
| 233 | Ga0206350_11308327 | 3300020080 | Bacteria | 1334 |
| 234 | Ga0154015_1423277 | 3300020610 | Bacteria | 27201 |
| 235 | Ga0213875_10397355 | 3300021388 | Bacteria | 657 |
| 236 | Ga0224712_10059727 | 3300022467 | Bacteria | 1515 |
| 237 | Ga0224712_10085225 | 3300022467 | Bacteria | 1312 |
| 238 | Ga0209435_105095 | 3300025206 | Bacteria | 1475 |
| 239 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 240 | Ga0209784_100445 | 3300025224 | Bacteria | 17752 |
| 241 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 242 | Ga0209566_100540 | 3300025225 | Bacteria | 25625 |
| 243 | Ga0209566_100748 | 3300025225 | Bacteria | 17880 |
| 244 | Ga0209566_104256 | 3300025225 | Bacteria | 1985 |
| 245 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 246 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 247 | Ga0209674_100103 | 3300025226 | Bacteria | 154966 |
| 248 | Ga0209674_100239 | 3300025226 | Bacteria | 46704 |
| 249 | Ga0209674_103676 | 3300025226 | Bacteria | 2738 |
| 250 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 251 | Ga0209672_100787 | 3300025228 | Bacteria | 15121 |
| 252 | Ga0209672_100814 | 3300025228 | Bacteria | 14684 |
| 253 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 254 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 255 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 256 | Ga0209563_100316 | 3300025230 | Bacteria | 19169 |
| 257 | Ga0207427_103128 | 3300025231 | Bacteria | 3721 |
| 258 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 259 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 260 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 261 | Ga0209646_1023233 | 3300025246 | Bacteria | 881 |
| 262 | Ga0209026_1001789 | 3300025250 | Bacteria | 8888 |
| 263 | Ga0209026_1017300 | 3300025250 | Bacteria | 1155 |
| 264 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 265 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 266 | Ga0209148_1000193 | 3300025254 | Bacteria | 115649 |
| 267 | Ga0209148_1011092 | 3300025254 | Bacteria | 1685 |
| 268 | Ga0209759_1000219 | 3300025256 | Bacteria | 87715 |
| 269 | Ga0209759_1000653 | 3300025256 | Bacteria | 32280 |
| 270 | Ga0209759_1001904 | 3300025256 | Bacteria | 10264 |
| 271 | Ga0209759_1007353 | 3300025256 | Bacteria | 3552 |
| 272 | Ga0209759_1008171 | 3300025256 | Bacteria | 3289 |
| 273 | Ga0209759_1008442 | 3300025256 | Bacteria | 3204 |
| 274 | Ga0209759_1013403 | 3300025256 | Bacteria | 2221 |
| 275 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 276 | Ga0209565_1000066 | 3300025263 | Bacteria | 173062 |
| 277 | Ga0209565_1000191 | 3300025263 | Bacteria | 75148 |
| 278 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 279 | Ga0209455_1000076 | 3300025272 | Bacteria | 284092 |
| 280 | Ga0209673_1020940 | 3300025273 | Bacteria | 2300 |
| 281 | Ga0209673_1036990 | 3300025273 | Bacteria | 1440 |
| 282 | Ga0209130_1016805 | 3300025284 | Bacteria | 1759 |
| 283 | Ga0209675_1000084 | 3300025291 | Bacteria | 152066 |
| 284 | Ga0209675_1002190 | 3300025291 | Bacteria | 10244 |
| 285 | Ga0209675_1003512 | 3300025291 | Bacteria | 7402 |
| 286 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 287 | Ga0209676_1003152 | 3300025292 | Bacteria | 10531 |
| 288 | Ga0209025_1000323 | 3300025294 | Bacteria | 106442 |
| 289 | Ga0209025_1001111 | 3300025294 | Bacteria | 38546 |
| 290 | Ga0209025_1001574 | 3300025294 | Bacteria | 28861 |
| 291 | Ga0209025_1003707 | 3300025294 | Bacteria | 14042 |
| 292 | Ga0209025_1044106 | 3300025294 | Bacteria | 1869 |
| 293 | Ga0209564_1000182 | 3300025295 | Bacteria | 150744 |
| 294 | Ga0209564_1000679 | 3300025295 | Bacteria | 50214 |
| 295 | Ga0209564_1001564 | 3300025295 | Bacteria | 22453 |
| 296 | Ga0209564_1004920 | 3300025295 | Bacteria | 7905 |
| 297 | Ga0209758_1015621 | 3300025297 | Bacteria | 3916 |
| 298 | Ga0209050_1005244 | 3300025298 | Bacteria | 8264 |
| 299 | Ga0209256_1000272 | 3300025299 | Bacteria | 90458 |
| 300 | Ga0209256_1005003 | 3300025299 | Bacteria | 7926 |
| 301 | Ga0207426_1000128 | 3300025302 | Bacteria | 211383 |
| 302 | Ga0207426_1004287 | 3300025302 | Bacteria | 7060 |
| 303 | Ga0209051_1003658 | 3300025303 | Bacteria | 9954 |
| 304 | Ga0209051_1026672 | 3300025303 | Bacteria | 2323 |
| 305 | Ga0207656_10254436 | 3300025321 | Bacteria | 861 |
| 306 | Ga0207713_1000402 | 3300025735 | Bacteria | 46300 |
| 307 | Ga0207713_1000487 | 3300025735 | Bacteria | 41086 |
| 308 | Ga0207713_1148885 | 3300025735 | Bacteria | 757 |
| 309 | Ga0207642_10115236 | 3300025899 | Bacteria | 1376 |
| 310 | Ga0207642_10304153 | 3300025899 | Bacteria | 925 |
| 311 | Ga0207688_10181543 | 3300025901 | Bacteria | 1255 |
| 312 | Ga0207680_10053262 | 3300025903 | Bacteria | 2428 |
| 313 | Ga0207680_10180824 | 3300025903 | Bacteria | 1426 |
| 314 | Ga0207645_10008397 | 3300025907 | Bacteria | 7205 |
| 315 | Ga0207705_10013924 | 3300025909 | Bacteria | 5800 |
| 316 | Ga0207705_10074011 | 3300025909 | Bacteria | 2472 |
| 317 | Ga0207684_10090207 | 3300025910 | Bacteria | 2612 |
| 318 | Ga0207707_10097964 | 3300025912 | Bacteria | 2563 |
| 319 | Ga0207707_10110834 | 3300025912 | Bacteria | 2399 |
| 320 | Ga0207695_10000879 | 3300025913 | Bacteria | 54696 |
| 321 | Ga0207695_10002741 | 3300025913 | Bacteria | 25691 |
| 322 | Ga0207695_10013750 | 3300025913 | Bacteria | 9630 |
| 323 | Ga0207695_10297466 | 3300025913 | Bacteria | 1505 |
| 324 | Ga0207695_10420309 | 3300025913 | Bacteria | 1221 |
| 325 | Ga0207671_10135085 | 3300025914 | Bacteria | 1896 |
| 326 | Ga0207662_10076088 | 3300025918 | Bacteria | 2040 |
| 327 | Ga0207662_10149400 | 3300025918 | Bacteria | 1485 |
| 328 | Ga0207657_10000269 | 3300025919 | Bacteria | 55259 |
| 329 | Ga0207657_10098200 | 3300025919 | Bacteria | 2434 |
| 330 | Ga0207649_10000961 | 3300025920 | Bacteria | 17881 |
| 331 | Ga0207649_10020123 | 3300025920 | Bacteria | 3822 |
| 332 | Ga0207649_10158264 | 3300025920 | Bacteria | 1567 |
| 333 | Ga0207652_10966040 | 3300025921 | Bacteria | 750 |
| 334 | Ga0207681_10032337 | 3300025923 | Bacteria | 3424 |
| 335 | Ga0207694_10190010 | 3300025924 | Bacteria | 1668 |
| 336 | Ga0207650_10038563 | 3300025925 | Bacteria | 3490 |
| 337 | Ga0207659_10359741 | 3300025926 | Bacteria | 1209 |
| 338 | Ga0207687_10663313 | 3300025927 | Bacteria | 883 |
| 339 | Ga0207644_10643905 | 3300025931 | Bacteria | 882 |
| 340 | Ga0207690_10043033 | 3300025932 | Bacteria | 2970 |
| 341 | Ga0207706_10144831 | 3300025933 | Bacteria | 2090 |
| 342 | Ga0207669_10231618 | 3300025937 | Bacteria | 1363 |
| 343 | Ga0207669_11558530 | 3300025937 | Bacteria | 564 |
| 344 | Ga0207704_10590083 | 3300025938 | Bacteria | 908 |
| 345 | Ga0207665_10232627 | 3300025939 | Bacteria | 1355 |
| 346 | Ga0207691_10004198 | 3300025940 | Bacteria | 13986 |
| 347 | Ga0207691_10049890 | 3300025940 | Bacteria | 3834 |
| 348 | Ga0207691_10118021 | 3300025940 | Bacteria | 2354 |
| 349 | Ga0207691_10594990 | 3300025940 | Bacteria | 936 |
| 350 | Ga0207711_10060874 | 3300025941 | Bacteria | 3254 |
| 351 | Ga0207661_10047911 | 3300025944 | Bacteria | 3394 |
| 352 | Ga0207679_10000020 | 3300025945 | Bacteria | 225727 |
| 353 | Ga0207679_10690529 | 3300025945 | Bacteria | 926 |
| 354 | Ga0207667_10005200 | 3300025949 | Bacteria | 15884 |
| 355 | Ga0207651_11314277 | 3300025960 | Bacteria | 650 |
| 356 | Ga0207712_11073339 | 3300025961 | Bacteria | 716 |
| 357 | Ga0207668_10000588 | 3300025972 | Bacteria | 22596 |
| 358 | Ga0207668_10019037 | 3300025972 | Bacteria | 4331 |
| 359 | Ga0207640_10000017 | 3300025981 | Bacteria | 208145 |
| 360 | Ga0207640_10110169 | 3300025981 | Bacteria | 1950 |
| 361 | Ga0207658_10707264 | 3300025986 | Bacteria | 911 |
| 362 | Ga0207677_10283532 | 3300026023 | Bacteria | 1361 |
| 363 | Ga0207703_10116406 | 3300026035 | Bacteria | 2288 |
| 364 | Ga0207639_10017592 | 3300026041 | Bacteria | 5068 |
| 365 | Ga0207639_10076238 | 3300026041 | Bacteria | 2639 |
| 366 | Ga0207639_10792064 | 3300026041 | Bacteria | 883 |
| 367 | Ga0207639_11263927 | 3300026041 | Bacteria | 693 |
| 368 | Ga0207678_10000008 | 3300026067 | Bacteria | 168926 |
| 369 | Ga0207678_10029369 | 3300026067 | Bacteria | 4798 |
| 370 | Ga0207678_10082857 | 3300026067 | Bacteria | 2744 |
| 371 | Ga0207678_10174048 | 3300026067 | Bacteria | 1838 |
| 372 | Ga0207708_10211272 | 3300026075 | Bacteria | 1551 |
| 373 | Ga0207708_10421817 | 3300026075 | Bacteria | 1106 |
| 374 | Ga0207702_10000017 | 3300026078 | Bacteria | 222964 |
| 375 | Ga0207702_10182684 | 3300026078 | Bacteria | 1932 |
| 376 | Ga0207702_11226531 | 3300026078 | Bacteria | 744 |
| 377 | Ga0207641_10018387 | 3300026088 | Bacteria | 5731 |
| 378 | Ga0207641_10918642 | 3300026088 | Bacteria | 870 |
| 379 | Ga0207674_10007727 | 3300026116 | Bacteria | 12517 |
| 380 | Ga0207674_10017042 | 3300026116 | Bacteria | 7930 |
| 381 | Ga0207674_10069277 | 3300026116 | Bacteria | 3549 |
| 382 | Ga0207675_100122841 | 3300026118 | Bacteria | 2458 |
| 383 | Ga0207675_101831227 | 3300026118 | Unclassified | 626 |
| 384 | Ga0207683_10034065 | 3300026121 | Bacteria | 4425 |
| 385 | Ga0207683_10150855 | 3300026121 | Bacteria | 2097 |
| 386 | Ga0207698_10047635 | 3300026142 | Bacteria | 3249 |
| 387 | Ga0207698_10081738 | 3300026142 | Bacteria | 2609 |
| 388 | Ga0207698_10860891 | 3300026142 | Bacteria | 912 |
| 389 | Ga0209371_1024030 | 3300027312 | Bacteria | 1424 |
| 390 | Ga0209371_1033628 | 3300027312 | Bacteria | 1093 |
| 391 | Ga0209282_1000099 | 3300027666 | Bacteria | 59643 |
| 392 | Ga0207428_10156290 | 3300027907 | Bacteria | 1734 |
| 393 | Ga0268266_10030298 | 3300028379 | Bacteria | 4598 |
| 394 | Ga0268266_10131138 | 3300028379 | Bacteria | 2242 |
| 395 | Ga0268266_10789748 | 3300028379 | Bacteria | 917 |
| 396 | Ga0268265_10060496 | 3300028380 | Bacteria | 2903 |
| 397 | Ga0268264_10123127 | 3300028381 | Bacteria | 2288 |
| 398 | Ga0268264_10215530 | 3300028381 | Bacteria | 1765 |
| 399 | Ga0268264_10445207 | 3300028381 | Bacteria | 1254 |
| 400 | Ga0265338_10000373 | 3300028800 | Bacteria | 80312 |
| 401 | Ga0268256_1024210 | 3300030500 | Bacteria | 1561 |
| 402 | Ga0268256_1027733 | 3300030500 | Bacteria | 1407 |
| 403 | Ga0316177_1219224 | 3300030731 | Bacteria | 1867 |
| 404 | Ga0314311_1209785 | 3300030733 | Bacteria | 821 |
| 405 | Ga0316178_1077292 | 3300030735 | Bacteria | 2304 |
| 406 | Ga0316180_1107170 | 3300030736 | Bacteria | 2671 |
| 407 | Ga0316183_1149106 | 3300030742 | Bacteria | 1155 |
| 408 | Ga0316181_1028793 | 3300030744 | Bacteria | 1565 |
| 409 | Ga0316182_1026372 | 3300030745 | Bacteria | 782 |
| 410 | Ga0316182_1379610 | 3300030745 | Bacteria | 1639 |
| 411 | Ga0307408_100176938 | 3300031548 | Bacteria | 1708 |
| 412 | Ga0265342_10067675 | 3300031712 | Bacteria | 2089 |
| 413 | Ga0307405_10426478 | 3300031731 | Bacteria | 1045 |
| 414 | Ga0307413_10085260 | 3300031824 | Bacteria | 2039 |
| 415 | Ga0307413_10198044 | 3300031824 | Bacteria | 1448 |
| 416 | Ga0307413_10322876 | 3300031824 | Bacteria | 1180 |
| 417 | Ga0307413_10862344 | 3300031824 | Bacteria | 766 |
| 418 | Ga0307410_10044476 | 3300031852 | Bacteria | 2950 |
| 419 | Ga0307410_10113174 | 3300031852 | Bacteria | 1967 |
| 420 | Ga0307410_10144592 | 3300031852 | Bacteria | 1763 |
| 421 | Ga0307410_10751249 | 3300031852 | Bacteria | 826 |
| 422 | Ga0307406_10265779 | 3300031901 | Bacteria | 1300 |
| 423 | Ga0307407_10025812 | 3300031903 | Bacteria | 3103 |
| 424 | Ga0307407_10247560 | 3300031903 | Bacteria | 1219 |
| 425 | Ga0307412_10000024 | 3300031911 | Bacteria | 235467 |
| 426 | Ga0307412_10000436 | 3300031911 | Bacteria | 25202 |
| 427 | Ga0307412_10463729 | 3300031911 | Bacteria | 1047 |
| 428 | Ga0307412_10666180 | 3300031911 | Bacteria | 889 |
| 429 | Ga0307409_100092316 | 3300031995 | Bacteria | 2484 |
| 430 | Ga0307409_100125404 | 3300031995 | Bacteria | 2183 |
| 431 | Ga0307416_100215162 | 3300032002 | Bacteria | 1837 |
| 432 | Ga0307416_100684568 | 3300032002 | Bacteria | 1113 |
| 433 | Ga0307416_100848664 | 3300032002 | Bacteria | 1011 |
| 434 | Ga0307416_102814189 | 3300032002 | Bacteria | 582 |
| 435 | Ga0307414_10708395 | 3300032004 | Bacteria | 912 |
| 436 | Ga0307415_100028072 | 3300032126 | Bacteria | 3575 |
| 437 | Ga0307415_100329315 | 3300032126 | Bacteria | 1277 |
| 438 | Ga0307415_101008967 | 3300032126 | Bacteria | 774 |
| 439 | Ga0373931_0512054 | 3300035691 | Bacteria | 775 |
| 440 | Ga0373947_0586766 | 3300035725 | Bacteria | 759 |
| 441 | Ga0395900_0038650 | 3300037418 | Bacteria | 4919 |
| 442 | Ga0395900_0093007 | 3300037418 | Bacteria | 3098 |
| 443 | Ga0395900_0095421 | 3300037418 | Bacteria | 3056 |
| 444 | Ga0395900_0526780 | 3300037418 | Bacteria | 1129 |
| 445 | Ga0395898_0010083 | 3300037466 | Bacteria | 9888 |
| 446 | Ga0395898_0266435 | 3300037466 | Bacteria | 1634 |
| 447 | Ga0395905_0000139 | 3300037471 | Bacteria | 120342 |
| 448 | Ga0395905_0025569 | 3300037471 | Bacteria | 5567 |
| 449 | Ga0436364_1537887 | 3300037853 | Bacteria | 657 |
| 450 | Ga0395901_0643803 | 3300038443 | Bacteria | 1064 |
| 451 | Ga0436365_1306015 | 3300039437 | Bacteria | 804 |
| 452 | Ga0436361_0480554 | 3300039447 | Bacteria | 8546 |
| 453 | Ga0436361_0509700 | 3300039447 | Bacteria | 920 |
| 454 | Ga0451853_1606758 | 3300041512 | Bacteria | 999 |
| 455 | Ga0451853_2182218 | 3300041512 | Bacteria | 719 |
| 456 | Ga0439448_0000015 | 3300042005 | Bacteria | 28886 |
| 457 | Ga0450913_004827 | 3300042117 | Bacteria | 940 |
| 458 | Ga0450888_007942 | 3300042126 | Bacteria | 1186 |
| 459 | Ga0451577_0381618 | 3300042876 | Bacteria | 1279 |
| 460 | Ga0466986_0041101 | 3300044650 | Bacteria | 3181 |
| 461 | Ga0466969_0004373 | 3300044656 | Bacteria | 7519 |
| 462 | Ga0466969_0008360 | 3300044656 | Bacteria | 5487 |
| 463 | Ga0466972_0008336 | 3300044658 | Bacteria | 5194 |
| 464 | Ga0466973_0278332 | 3300044659 | Bacteria | 1146 |
| 465 | Ga0466980_0332424 | 3300044668 | Bacteria | 895 |
| 466 | Ga0466978_0053880 | 3300044671 | Bacteria | 2508 |
| 467 | Ga0466982_0101071 | 3300044672 | Bacteria | 1786 |
| 468 | Ga0466965_0000467 | 3300044683 | Bacteria | 14283 |
| 469 | Ga0466965_0025797 | 3300044683 | Bacteria | 2847 |
| 470 | Ga0466965_0043109 | 3300044683 | Bacteria | 2227 |
| 471 | Ga0466966_0011232 | 3300044684 | Bacteria | 5941 |
| 472 | Ga0466961_0000202 | 3300044693 | Bacteria | 40048 |
| 473 | Ga0466961_0014067 | 3300044693 | Bacteria | 5132 |
| 474 | Ga0466961_0020105 | 3300044693 | Bacteria | 4297 |
| 475 | Ga0466961_0309204 | 3300044693 | Bacteria | 964 |
| 476 | Ga0466961_0469565 | 3300044693 | Bacteria | 761 |
| 477 | Ga0466963_0001290 | 3300044694 | Bacteria | 13298 |
| 478 | Ga0466964_0002827 | 3300044706 | Bacteria | 6254 |
| 479 | Ga0466968_0027309 | 3300044735 | Bacteria | 2348 |
| 480 | Ga0466970_0023594 | 3300044765 | Bacteria | 3213 |
| 481 | Ga0466970_0031675 | 3300044765 | Bacteria | 2793 |
| 482 | Ga0466970_0037006 | 3300044765 | Bacteria | 2586 |
| 483 | Ga0466970_0056263 | 3300044765 | Bacteria | 2102 |
| 484 | Ga0466960_0037268 | 3300044901 | Bacteria | 2281 |
| 485 | Ga0466959_0000534 | 3300045049 | Bacteria | 22033 |
| 486 | Ga0466959_0014413 | 3300045049 | Bacteria | 5742 |
| 487 | Ga0466959_0019887 | 3300045049 | Bacteria | 4941 |
| 488 | Ga0451576_1944497 | 3300045051 | Bacteria | 606 |
| 489 | Ga0466958_0000819 | 3300045836 | Bacteria | 13738 |
| 490 | Ga0466958_0185133 | 3300045836 | Bacteria | 1322 |
| 491 | Ga0466967_0099476 | 3300045976 | Bacteria | 2656 |
| 492 | Ga0466967_1055759 | 3300045976 | Bacteria | 809 |
| 493 | Ga0495592_0034124 | 3300046454 | Bacteria | 3836 |
| 494 | Ga0495592_0154430 | 3300046454 | Bacteria | 1584 |
| 495 | Ga0495603_0003816 | 3300046455 | Bacteria | 8973 |
| 496 | Ga0495603_0005929 | 3300046455 | Bacteria | 7303 |
| 497 | Ga0495603_0029084 | 3300046455 | Bacteria | 3333 |
| 498 | Ga0495590_0020740 | 3300046457 | Bacteria | 2333 |
| 499 | Ga0495590_0099860 | 3300046457 | Bacteria | 1031 |
| 500 | Ga0495591_001325 | 3300046458 | Bacteria | 15572 |
| 501 | Ga0495629_0000621 | 3300046459 | Bacteria | 28828 |
| 502 | Ga0495629_0003554 | 3300046459 | Bacteria | 11771 |
| 503 | Ga0495629_0040683 | 3300046459 | Bacteria | 3270 |
| 504 | Ga0495629_0057326 | 3300046459 | Bacteria | 2724 |
| 505 | Ga0495629_0351169 | 3300046459 | Bacteria | 1006 |
| 506 | Ga0495638_0014232 | 3300046460 | Bacteria | 5384 |
| 507 | Ga0495641_0028838 | 3300046461 | Bacteria | 2681 |
| 508 | Ga0495651_0088256 | 3300046462 | Bacteria | 2330 |
| 509 | Ga0495651_0242755 | 3300046462 | Bacteria | 1234 |
| 510 | Ga0495651_0381468 | 3300046462 | Bacteria | 924 |
| 511 | Ga0495653_0025199 | 3300046463 | Bacteria | 4784 |
| 512 | Ga0495653_0076410 | 3300046463 | Bacteria | 2490 |
| 513 | Ga0495653_0133708 | 3300046463 | Bacteria | 1752 |
| 514 | Ga0495653_0344286 | 3300046463 | Bacteria | 960 |
| 515 | Ga0495653_0604849 | 3300046463 | Bacteria | 673 |
| 516 | Ga0495650_0011793 | 3300046471 | Bacteria | 4750 |
| 517 | Ga0495650_0176951 | 3300046471 | Bacteria | 752 |
| 518 | Ga0495580_0002750 | 3300046472 | Bacteria | 15155 |
| 519 | Ga0495580_0013455 | 3300046472 | Bacteria | 6240 |
| 520 | Ga0495580_0029257 | 3300046472 | Bacteria | 3999 |
| 521 | Ga0495580_0035932 | 3300046472 | Bacteria | 3561 |
| 522 | Ga0495580_0036611 | 3300046472 | Bacteria | 3523 |
| 523 | Ga0495580_0054160 | 3300046472 | Bacteria | 2830 |
| 524 | Ga0495582_0016270 | 3300046473 | Bacteria | 4074 |
| 525 | Ga0495582_0033980 | 3300046473 | Bacteria | 2804 |
| 526 | Ga0495605_0010467 | 3300046474 | Bacteria | 5187 |
| 527 | Ga0495605_0017315 | 3300046474 | Bacteria | 3884 |
| 528 | Ga0495605_0017609 | 3300046474 | Bacteria | 3842 |
| 529 | Ga0495605_0017825 | 3300046474 | Bacteria | 3815 |
| 530 | Ga0495662_0023002 | 3300046476 | Bacteria | 3009 |
| 531 | Ga0495662_0363601 | 3300046476 | Bacteria | 711 |
| 532 | Ga0495664_0035726 | 3300046477 | Bacteria | 2927 |
| 533 | Ga0495664_0036436 | 3300046477 | Bacteria | 2900 |
| 534 | Ga0495664_0083549 | 3300046477 | Bacteria | 1916 |
| 535 | Ga0495584_0089198 | 3300046491 | Bacteria | 1555 |
| 536 | Ga0495596_0001108 | 3300046500 | Bacteria | 15956 |
| 537 | Ga0495596_0003240 | 3300046500 | Bacteria | 8328 |
| 538 | Ga0495596_0048457 | 3300046500 | Bacteria | 1666 |
| 539 | Ga0495596_0085457 | 3300046500 | Bacteria | 1224 |
| 540 | Ga0495596_0127958 | 3300046500 | Bacteria | 986 |
| 541 | Ga0495607_0012078 | 3300046501 | Bacteria | 5714 |
| 542 | Ga0495583_0000068 | 3300046506 | Bacteria | 188922 |
| 543 | Ga0495583_0018710 | 3300046506 | Bacteria | 3640 |
| 544 | Ga0495583_0027207 | 3300046506 | Bacteria | 2825 |
| 545 | Ga0495583_0032336 | 3300046506 | Bacteria | 2526 |
| 546 | Ga0495583_0043440 | 3300046506 | Bacteria | 2093 |
| 547 | Ga0495606_0034153 | 3300046507 | Bacteria | 3495 |
| 548 | Ga0495606_0043724 | 3300046507 | Bacteria | 2984 |
| 549 | Ga0495606_0075935 | 3300046507 | Bacteria | 2101 |
| 550 | Ga0495606_0264250 | 3300046507 | Bacteria | 948 |
| 551 | Ga0495608_0017666 | 3300046511 | Bacteria | 4932 |
| 552 | Ga0495608_0166695 | 3300046511 | Bacteria | 1399 |
| 553 | Ga0495608_0448456 | 3300046511 | Bacteria | 785 |
| 554 | Ga0495610_0013689 | 3300046512 | Bacteria | 4806 |
| 555 | Ga0495610_0014902 | 3300046512 | Bacteria | 4545 |
| 556 | Ga0495616_0007070 | 3300046513 | Bacteria | 6742 |
| 557 | Ga0495616_0250338 | 3300046513 | Bacteria | 761 |
| 558 | Ga0495618_0126221 | 3300046514 | Bacteria | 1638 |
| 559 | Ga0495618_0324787 | 3300046514 | Bacteria | 952 |
| 560 | Ga0495618_0527002 | 3300046514 | Bacteria | 710 |
| 561 | Ga0495620_0049235 | 3300046515 | Bacteria | 1804 |
| 562 | Ga0495628_0002857 | 3300046516 | Bacteria | 15477 |
| 563 | Ga0495628_0029333 | 3300046516 | Bacteria | 4462 |
| 564 | Ga0495628_0136832 | 3300046516 | Bacteria | 1871 |
| 565 | Ga0495628_0250843 | 3300046516 | Bacteria | 1321 |
| 566 | Ga0495628_0327447 | 3300046516 | Bacteria | 1129 |
| 567 | Ga0495630_0014598 | 3300046517 | Bacteria | 5724 |
| 568 | Ga0495630_0027944 | 3300046517 | Bacteria | 4190 |
| 569 | Ga0495630_0075991 | 3300046517 | Bacteria | 2530 |
| 570 | Ga0495643_0104551 | 3300046522 | Bacteria | 1447 |
| 571 | Ga0495643_0360632 | 3300046522 | Bacteria | 649 |
| 572 | Ga0495644_0194917 | 3300046523 | Bacteria | 780 |
| 573 | Ga0495648_0029844 | 3300046524 | Bacteria | 3613 |
| 574 | Ga0495648_0047663 | 3300046524 | Bacteria | 2646 |
| 575 | Ga0495648_0069197 | 3300046524 | Bacteria | 2055 |
| 576 | Ga0495648_0073286 | 3300046524 | Bacteria | 1978 |
| 577 | Ga0495648_0089245 | 3300046524 | Bacteria | 1730 |
| 578 | Ga0495648_0093375 | 3300046524 | Bacteria | 1678 |
| 579 | Ga0495663_0003587 | 3300046525 | Bacteria | 4461 |
| 580 | Ga0495666_0012383 | 3300046526 | Bacteria | 4251 |
| 581 | Ga0495666_0016881 | 3300046526 | Bacteria | 3635 |
| 582 | Ga0495666_0077062 | 3300046526 | Bacteria | 1580 |
| 583 | Ga0495642_0008709 | 3300046528 | Bacteria | 3876 |
| 584 | Ga0495642_0088947 | 3300046528 | Bacteria | 1306 |
| 585 | Ga0495642_0295768 | 3300046528 | Bacteria | 709 |
| 586 | Ga0495652_0034961 | 3300046529 | Bacteria | 4375 |
| 587 | Ga0495652_0183910 | 3300046529 | Bacteria | 1601 |
| 588 | Ga0495652_0185574 | 3300046529 | Bacteria | 1592 |
| 589 | Ga0495654_0026546 | 3300046530 | Bacteria | 2976 |
| 590 | Ga0495665_0009569 | 3300046531 | Bacteria | 5250 |
| 591 | Ga0495665_0012689 | 3300046531 | Bacteria | 4560 |
| 592 | Ga0495665_0078242 | 3300046531 | Bacteria | 1740 |
| 593 | Ga0495640_0009173 | 3300046533 | Bacteria | 7721 |
| 594 | Ga0495640_0022060 | 3300046533 | Bacteria | 4662 |
| 595 | Ga0495640_0046438 | 3300046533 | Bacteria | 3009 |
| 596 | Ga0495586_0001230 | 3300046535 | Bacteria | 14363 |
| 597 | Ga0495586_0022072 | 3300046535 | Bacteria | 3397 |
| 598 | Ga0495587_0001551 | 3300046536 | Bacteria | 15275 |
| 599 | Ga0495587_0033824 | 3300046536 | Bacteria | 3084 |
| 600 | Ga0495609_0003326 | 3300046538 | Bacteria | 9268 |
| 601 | Ga0495621_0245748 | 3300046539 | Bacteria | 730 |
| 602 | Ga0495597_0044386 | 3300046542 | Bacteria | 1977 |
| 603 | Ga0495597_0153302 | 3300046542 | Bacteria | 944 |
| 604 | Ga0495597_0175169 | 3300046542 | Bacteria | 869 |
| 605 | Ga0495645_0001069 | 3300046543 | Bacteria | 18628 |
| 606 | Ga0495645_0001820 | 3300046543 | Bacteria | 14497 |
| 607 | Ga0495645_0016349 | 3300046543 | Bacteria | 5295 |
| 608 | Ga0495645_0166677 | 3300046543 | Bacteria | 1519 |
| 609 | Ga0495622_0000298 | 3300046557 | Bacteria | 37422 |
| 610 | Ga0495622_0082588 | 3300046557 | Bacteria | 1478 |
| 611 | Ga0495667_0010583 | 3300046559 | Bacteria | 6242 |
| 612 | Ga0495667_0375985 | 3300046559 | Bacteria | 896 |
| 613 | Ga0495656_0028681 | 3300046615 | Bacteria | 2234 |
| 614 | Ga0495656_0085707 | 3300046615 | Bacteria | 1431 |
| 615 | Ga0495656_0091825 | 3300046615 | Bacteria | 1389 |
| 616 | Ga0495656_0326919 | 3300046615 | Bacteria | 791 |
| 617 | Ga0495668_0601798 | 3300046616 | Bacteria | 607 |
| 618 | Ga0495634_0003726 | 3300046642 | Bacteria | 12143 |
| 619 | Ga0495634_0010925 | 3300046642 | Bacteria | 6625 |
| 620 | Ga0495634_0330265 | 3300046642 | Bacteria | 916 |
| 621 | Ga0495611_0045239 | 3300046648 | Bacteria | 1971 |
| 622 | Ga0495625_0359796 | 3300046660 | Bacteria | 918 |
| 623 | Ga0495625_0406136 | 3300046660 | Bacteria | 850 |
| 624 | Ga0495635_0053654 | 3300046663 | Bacteria | 2777 |
| 625 | Ga0495635_0061583 | 3300046663 | Bacteria | 2577 |
| 626 | Ga0495659_0207905 | 3300046664 | Bacteria | 804 |
| 627 | Ga0495661_0001700 | 3300046665 | Bacteria | 17828 |
| 628 | Ga0495661_0016395 | 3300046665 | Bacteria | 4911 |
| 629 | Ga0495661_0052048 | 3300046665 | Bacteria | 2469 |
| 630 | Ga0495588_0038490 | 3300046674 | Bacteria | 2433 |
| 631 | Ga0495599_0011522 | 3300046678 | Bacteria | 5434 |
| 632 | Ga0495599_0104590 | 3300046678 | Bacteria | 1763 |
| 633 | Ga0495599_0456226 | 3300046678 | Bacteria | 756 |
| 634 | Ga0495623_0046998 | 3300046679 | Bacteria | 2739 |
| 635 | Ga0495623_0104644 | 3300046679 | Bacteria | 1721 |
| 636 | Ga0495623_0122849 | 3300046679 | Bacteria | 1561 |
| 637 | Ga0495646_0004121 | 3300046680 | Bacteria | 9124 |
| 638 | Ga0495646_0066398 | 3300046680 | Bacteria | 2133 |
| 639 | Ga0495646_0108096 | 3300046680 | Bacteria | 1586 |
| 640 | Ga0495646_0144927 | 3300046680 | Bacteria | 1325 |
| 641 | Ga0495669_0024369 | 3300046684 | Bacteria | 2635 |
| 642 | Ga0495669_0075831 | 3300046684 | Bacteria | 1539 |
| 643 | Ga0495624_0006224 | 3300046690 | Bacteria | 8483 |
| 644 | Ga0495624_0029504 | 3300046690 | Bacteria | 3578 |
| 645 | Ga0495624_0131339 | 3300046690 | Bacteria | 1535 |
| 646 | Ga0495624_0145352 | 3300046690 | Bacteria | 1451 |
| 647 | Ga0495670_0253363 | 3300046691 | Bacteria | 939 |
| 648 | Ga0495671_0013958 | 3300046692 | Bacteria | 4332 |
| 649 | Ga0495671_0082832 | 3300046692 | Bacteria | 1572 |
| 650 | Ga0495649_0013958 | 3300046694 | Bacteria | 4621 |
| 651 | Ga0495649_0015869 | 3300046694 | Bacteria | 4279 |
| 652 | Ga0495649_0159382 | 3300046694 | Bacteria | 1183 |
| 653 | Ga0495589_0082395 | 3300046794 | Bacteria | 1564 |
| 654 | Ga0495589_0098603 | 3300046794 | Bacteria | 1415 |
| 655 | Ga0495589_0102386 | 3300046794 | Bacteria | 1385 |
| 656 | Ga0495589_0127612 | 3300046794 | Bacteria | 1223 |
| 657 | Ga0495600_0053478 | 3300046809 | Bacteria | 2637 |
| 658 | Ga0495660_0307469 | 3300046810 | Bacteria | 716 |
| 659 | Ga0495581_0016676 | 3300047315 | Bacteria | 4270 |
| 660 | Ga0495581_0078534 | 3300047315 | Bacteria | 1910 |
| 661 | Ga0495604_0024415 | 3300047317 | Bacteria | 4822 |
| 662 | Ga0495604_0027217 | 3300047317 | Bacteria | 4549 |
| 663 | Ga0495604_0027396 | 3300047317 | Bacteria | 4533 |
| 664 | Ga0495604_0109534 | 3300047317 | Bacteria | 2016 |
| 665 | Ga0495604_0231095 | 3300047317 | Bacteria | 1268 |
| 666 | Ga0495636_0009413 | 3300047318 | Bacteria | 3847 |
| 667 | Ga0495636_0271226 | 3300047318 | Bacteria | 788 |
| 668 | Ga0495636_0305354 | 3300047318 | Bacteria | 745 |
| 669 | Ga0495636_0419735 | 3300047318 | Bacteria | 639 |
| 670 | Ga0495674_0019899 | 3300047319 | Bacteria | 6222 |
| 671 | Ga0495674_0083337 | 3300047319 | Bacteria | 2741 |
| 672 | Ga0495674_0097625 | 3300047319 | Bacteria | 2502 |
| 673 | Ga0495674_0147654 | 3300047319 | Bacteria | 1973 |
| 674 | Ga0495674_0322751 | 3300047319 | Bacteria | 1257 |
| 675 | Ga0495674_0364118 | 3300047319 | Bacteria | 1172 |
| 676 | Ga0495674_0604560 | 3300047319 | Bacteria | 868 |
| 677 | Ga0495672_0004572 | 3300047320 | Bacteria | 11247 |
| 678 | Ga0495672_0012791 | 3300047320 | Bacteria | 5831 |
| 679 | Ga0495676_0052189 | 3300047321 | Bacteria | 3266 |
| 680 | Ga0495676_0085740 | 3300047321 | Bacteria | 2372 |
| 681 | Ga0495680_0038431 | 3300047322 | Bacteria | 3824 |
| 682 | Ga0495680_0042668 | 3300047322 | Bacteria | 3597 |
| 683 | Ga0495680_0043740 | 3300047322 | Bacteria | 3544 |
| 684 | Ga0495683_0000695 | 3300047323 | Bacteria | 24629 |
| 685 | Ga0495683_0016227 | 3300047323 | Bacteria | 3868 |
| 686 | Ga0495687_000022 | 3300047443 | Bacteria | 327353 |
| 687 | Ga0495687_004505 | 3300047443 | Bacteria | 9365 |
| 688 | Ga0495687_039957 | 3300047443 | Bacteria | 2071 |
| 689 | Ga0495687_045290 | 3300047443 | Bacteria | 1906 |
| 690 | Ga0495687_056596 | 3300047443 | Bacteria | 1635 |
| 691 | Ga0495687_179169 | 3300047443 | Bacteria | 693 |
| 692 | Ga0495675_0002394 | 3300047444 | Bacteria | 11205 |
| 693 | Ga0495675_0007474 | 3300047444 | Bacteria | 6728 |
| 694 | Ga0495675_0052046 | 3300047444 | Bacteria | 2600 |
| 695 | Ga0495675_0295225 | 3300047444 | Bacteria | 964 |
| 696 | Ga0495675_0360931 | 3300047444 | Bacteria | 853 |
| 697 | Ga0495679_011806 | 3300047446 | Bacteria | 3355 |
| 698 | Ga0495679_019342 | 3300047446 | Bacteria | 2394 |
| 699 | Ga0495685_032742 | 3300047447 | Bacteria | 1786 |
| 700 | Ga0495685_036773 | 3300047447 | Bacteria | 1680 |
| 701 | Ga0495685_056395 | 3300047447 | Bacteria | 1328 |
| 702 | Ga0495685_177379 | 3300047447 | Bacteria | 687 |
| 703 | Ga0495673_0024843 | 3300047469 | Bacteria | 2886 |
| 704 | Ga0495681_0026216 | 3300047470 | Bacteria | 3039 |
| 705 | Ga0495684_0066135 | 3300047471 | Bacteria | 2748 |
| 706 | Ga0495684_0281827 | 3300047471 | Bacteria | 1199 |
| 707 | Ga0495684_0414072 | 3300047471 | Bacteria | 943 |
| 708 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 709 | Ga0495686_0253002 | 3300047472 | Bacteria | 989 |
| 710 | Ga0495593_0003104 | 3300047673 | Bacteria | 9996 |
| 711 | Ga0495593_0020827 | 3300047673 | Bacteria | 3668 |
| 712 | Ga0495593_0035609 | 3300047673 | Bacteria | 2702 |
| 713 | Ga0495593_0036881 | 3300047673 | Bacteria | 2648 |
| 714 | Ga0495593_0100051 | 3300047673 | Bacteria | 1487 |
| 715 | Ga0495602_0008283 | 3300048088 | Bacteria | 10861 |
| 716 | Ga0495602_0015149 | 3300048088 | Bacteria | 7792 |
| 717 | Ga0495602_0027929 | 3300048088 | Bacteria | 5411 |
| 718 | Ga0495602_0299734 | 3300048088 | Bacteria | 1176 |
| 719 | Ga0495614_0002622 | 3300048089 | Bacteria | 7994 |
| 720 | Ga0495614_0010514 | 3300048089 | Bacteria | 4081 |
| 721 | Ga0496100_0000180 | 3300048903 | Bacteria | 35187 |
| 722 | Ga0496100_0000207 | 3300048903 | Bacteria | 32379 |
| 723 | Ga0496100_0524419 | 3300048903 | Bacteria | 914 |
| 724 | Ga0496100_0554497 | 3300048903 | Bacteria | 889 |
| 725 | Ga0496101_0000547 | 3300048904 | Bacteria | 23007 |
| 726 | Ga0496101_0003927 | 3300048904 | Bacteria | 9290 |
| 727 | Ga0496101_0289396 | 3300048904 | Bacteria | 1281 |
| 728 | Ga0496101_0788419 | 3300048904 | Bacteria | 749 |
| 729 | Ga0496102_0000216 | 3300048905 | Bacteria | 76017 |
| 730 | Ga0496102_0000717 | 3300048905 | Bacteria | 32796 |
| 731 | Ga0496102_0004936 | 3300048905 | Bacteria | 11300 |
| 732 | Ga0496102_0052125 | 3300048905 | Bacteria | 3727 |
| 733 | Ga0496102_0064982 | 3300048905 | Bacteria | 3343 |
| 734 | Ga0496102_0132084 | 3300048905 | Bacteria | 2338 |
| 735 | Ga0496102_0431688 | 3300048905 | Bacteria | 1237 |
| 736 | Ga0496102_0551840 | 3300048905 | Bacteria | 1075 |
| 737 | Ga0496103_0002758 | 3300048906 | Bacteria | 10952 |
| 738 | Ga0496103_0006474 | 3300048906 | Bacteria | 6985 |
| 739 | Ga0496103_0015874 | 3300048906 | Bacteria | 4490 |
| 740 | Ga0496103_0018054 | 3300048906 | Bacteria | 4229 |
| 741 | Ga0496104_0138053 | 3300048907 | Bacteria | 2342 |
| 742 | Ga0496104_0166174 | 3300048907 | Bacteria | 2116 |
| 743 | Ga0496104_0168319 | 3300048907 | Bacteria | 2101 |
| 744 | Ga0496104_0286019 | 3300048907 | Bacteria | 1561 |
| 745 | Ga0496104_0365963 | 3300048907 | Bacteria | 1354 |
| 746 | Ga0496104_0414213 | 3300048907 | Bacteria | 1260 |
| 747 | Ga0496104_0539220 | 3300048907 | Bacteria | 1078 |
| 748 | Ga0496105_0205744 | 3300048908 | Bacteria | 1605 |
| 749 | Ga0496105_0316558 | 3300048908 | Bacteria | 1251 |
| 750 | Ga0496105_0318627 | 3300048908 | Bacteria | 1247 |
| 751 | Ga0496105_0337689 | 3300048908 | Bacteria | 1205 |
| 752 | Ga0496106_0000057 | 3300048909 | Bacteria | 90192 |
| 753 | Ga0496106_0002634 | 3300048909 | Bacteria | 13342 |
| 754 | Ga0496106_0072982 | 3300048909 | Bacteria | 2625 |
| 755 | Ga0496107_0019485 | 3300048910 | Bacteria | 4786 |
| 756 | Ga0496107_0094452 | 3300048910 | Bacteria | 2188 |
| 757 | Ga0496107_0788302 | 3300048910 | Bacteria | 696 |
| 758 | Ga0496107_0805852 | 3300048910 | Bacteria | 687 |
| 759 | Ga0496108_0239564 | 3300048911 | Bacteria | 1578 |
| 760 | Ga0496108_0735661 | 3300048911 | Bacteria | 854 |
| 761 | Ga0496109_0020152 | 3300048912 | Bacteria | 5892 |
| 762 | Ga0496109_0214370 | 3300048912 | Bacteria | 1811 |
| 763 | Ga0496110_0001136 | 3300048913 | Bacteria | 18823 |
| 764 | Ga0496110_0311365 | 3300048913 | Bacteria | 1434 |
| 765 | Ga0496110_0369896 | 3300048913 | Bacteria | 1306 |
| 766 | Ga0496111_0005793 | 3300048914 | Bacteria | 7968 |
| 767 | Ga0496112_0010662 | 3300048915 | Bacteria | 8350 |
| 768 | Ga0496113_0002190 | 3300048916 | Bacteria | 11269 |
| 769 | Ga0496113_0024086 | 3300048916 | Bacteria | 4322 |
| 770 | Ga0496114_0013131 | 3300048917 | Bacteria | 6637 |
| 771 | Ga0496114_0224626 | 3300048917 | Bacteria | 1649 |
| 772 | Ga0496114_0263616 | 3300048917 | Bacteria | 1518 |
| 773 | Ga0496114_0373515 | 3300048917 | Bacteria | 1262 |
| 774 | Ga0496115_0074020 | 3300048918 | Bacteria | 2765 |
| 775 | Ga0496115_0090935 | 3300048918 | Bacteria | 2494 |
| 776 | Ga0496115_0117860 | 3300048918 | Bacteria | 2184 |
| 777 | Ga0496115_0629342 | 3300048918 | Bacteria | 850 |
| 778 | Ga0496116_0001131 | 3300048919 | Bacteria | 31790 |
| 779 | Ga0496116_0019204 | 3300048919 | Bacteria | 5239 |
| 780 | Ga0496116_0019804 | 3300048919 | Bacteria | 5138 |
| 781 | Ga0496116_0052426 | 3300048919 | Bacteria | 2703 |
| 782 | Ga0496116_0084861 | 3300048919 | Bacteria | 1949 |
| 783 | Ga0496116_0099329 | 3300048919 | Bacteria | 1743 |
| 784 | Ga0496116_0151762 | 3300048919 | Bacteria | 1285 |
| 785 | Ga0496116_0165712 | 3300048919 | Bacteria | 1205 |
| 786 | Ga0496117_0001224 | 3300048920 | Bacteria | 38444 |
| 787 | Ga0496117_0006835 | 3300048920 | Bacteria | 11351 |
| 788 | Ga0496117_0007476 | 3300048920 | Bacteria | 10657 |
| 789 | Ga0496117_0008109 | 3300048920 | Bacteria | 10047 |
| 790 | Ga0496117_0016751 | 3300048920 | Bacteria | 6161 |
| 791 | Ga0496117_0083071 | 3300048920 | Bacteria | 2096 |
| 792 | Ga0496117_0100557 | 3300048920 | Bacteria | 1831 |
| 793 | Ga0496117_0477750 | 3300048920 | Bacteria | 610 |
| 794 | Ga0496118_0003743 | 3300048921 | Bacteria | 18807 |
| 795 | Ga0496118_0004212 | 3300048921 | Bacteria | 17280 |
| 796 | Ga0496118_0008399 | 3300048921 | Bacteria | 10682 |
| 797 | Ga0496118_0013944 | 3300048921 | Bacteria | 7559 |
| 798 | Ga0496118_0024474 | 3300048921 | Bacteria | 5207 |
| 799 | Ga0496118_0025276 | 3300048921 | Bacteria | 5098 |
| 800 | Ga0496118_0034131 | 3300048921 | Bacteria | 4158 |
| 801 | Ga0496118_0039332 | 3300048921 | Bacteria | 3776 |
| 802 | Ga0496118_0051436 | 3300048921 | Bacteria | 3151 |
| 803 | Ga0496118_0188849 | 3300048921 | Bacteria | 1235 |
| 804 | Ga0496119_0012281 | 3300048922 | Bacteria | 6979 |
| 805 | Ga0496119_0061704 | 3300048922 | Bacteria | 2237 |
| 806 | Ga0496121_0000446 | 3300048924 | Bacteria | 81530 |
| 807 | Ga0496121_0001895 | 3300048924 | Bacteria | 33514 |
| 808 | Ga0496121_0002624 | 3300048924 | Bacteria | 27116 |
| 809 | Ga0496121_0016560 | 3300048924 | Bacteria | 7603 |
| 810 | Ga0496121_0054867 | 3300048924 | Bacteria | 3326 |
| 811 | Ga0496121_0057297 | 3300048924 | Bacteria | 3231 |
| 812 | Ga0496121_0336263 | 3300048924 | Bacteria | 1011 |
| 813 | Ga0496121_0449482 | 3300048924 | Bacteria | 831 |
| 814 | Ga0496122_0005474 | 3300048925 | Bacteria | 15112 |
| 815 | Ga0496122_0005675 | 3300048925 | Bacteria | 14729 |
| 816 | Ga0496122_0013800 | 3300048925 | Bacteria | 7870 |
| 817 | Ga0496123_0002852 | 3300048926 | Bacteria | 20402 |
| 818 | Ga0496123_0002953 | 3300048926 | Bacteria | 19834 |
| 819 | Ga0496123_0024705 | 3300048926 | Bacteria | 4557 |
| 820 | Ga0496123_0226540 | 3300048926 | Bacteria | 939 |
| 821 | Ga0496124_0143127 | 3300048927 | Bacteria | 1884 |
| 822 | Ga0496124_0155636 | 3300048927 | Bacteria | 1788 |
| 823 | Ga0496124_0294913 | 3300048927 | Bacteria | 1174 |
| 824 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 825 | Ga0496125_0002367 | 3300048928 | Bacteria | 24660 |
| 826 | Ga0496125_0017544 | 3300048928 | Bacteria | 6819 |
| 827 | Ga0496125_0053414 | 3300048928 | Bacteria | 3312 |
| 828 | Ga0496125_0062439 | 3300048928 | Bacteria | 2979 |
| 829 | Ga0496125_0328314 | 3300048928 | Bacteria | 924 |
| 830 | Ga0496126_0000083 | 3300048929 | Bacteria | 217567 |
| 831 | Ga0496126_0001580 | 3300048929 | Bacteria | 34787 |
| 832 | Ga0496126_0005065 | 3300048929 | Bacteria | 15289 |
| 833 | Ga0496126_0045036 | 3300048929 | Bacteria | 4058 |
| 834 | Ga0496126_0097518 | 3300048929 | Bacteria | 2576 |
| 835 | Ga0496126_0116147 | 3300048929 | Bacteria | 2326 |
| 836 | Ga0496126_0175925 | 3300048929 | Bacteria | 1820 |
| 837 | Ga0501306_035685 | 3300049127 | Bacteria | 755 |
| 838 | Ga0501310_031526 | 3300049130 | Bacteria | 706 |
| 839 | Ga0495682_0046321 | 3300049460 | Bacteria | 1587 |
| 840 | Ga0501323_004450 | 3300049539 | Bacteria | 1484 |
| 841 | Ga0501032_0587797 | 3300049569 | Bacteria | 709 |
| 842 | Ga0501033_0191769 | 3300049570 | Bacteria | 1462 |
| 843 | Ga0501034_0001301 | 3300049571 | Bacteria | 33743 |
| 844 | Ga0501034_0009210 | 3300049571 | Bacteria | 10357 |
| 845 | Ga0501036_0457068 | 3300049572 | Bacteria | 1064 |
| 846 | Ga0501037_0282163 | 3300049573 | Bacteria | 1157 |
| 847 | Ga0501041_0923807 | 3300049577 | Bacteria | 561 |
| 848 | Ga0501047_0014543 | 3300049581 | Bacteria | 7486 |
| 849 | Ga0501067_0084924 | 3300049583 | Bacteria | 1756 |
| 850 | Ga0501068_0743598 | 3300049584 | Bacteria | 642 |
| 851 | Ga0501073_0004765 | 3300049589 | Bacteria | 10180 |
| 852 | Ga0501074_0217964 | 3300049590 | Bacteria | 1359 |
| 853 | Ga0501075_0294295 | 3300049591 | Bacteria | 1237 |
| 854 | Ga0501080_0007643 | 3300049742 | Bacteria | 9775 |
| 855 | Ga0501083_0631773 | 3300049744 | Bacteria | 696 |
| 856 | Ga0501035_0032407 | 3300049822 | Bacteria | 4754 |
| 857 | Ga0501035_0524287 | 3300049822 | Bacteria | 973 |
| 858 | Ga0501044_0003960 | 3300049823 | Bacteria | 16586 |
| 859 | nmdc:mga00v17_654_c1 | 3300050491 | Bacteria | 19164 |
| 860 | nmdc:mga0k408_215_c1 | 3300050493 | Bacteria | 31065 |
| 861 | nmdc:mga05p37_74663_c1 | 3300050507 | Bacteria | 4173 |
| 862 | nmdc:mga09592_14494_c1 | 3300050508 | Bacteria | 6434 |
| 863 | nmdc:mga0qj67_252320_c1 | 3300050509 | Bacteria | 1431 |
| 864 | nmdc:mga0qj67_40779_c1 | 3300050509 | Bacteria | 3649 |
| 865 | nmdc:mga06r32_6465_c1 | 3300050510 | Bacteria | 10528 |
| 866 | nmdc:mga08y16_602363_c1 | 3300050511 | Bacteria | 1107 |
| 867 | nmdc:mga08y16_62468_c1 | 3300050511 | Bacteria | 3890 |
| 868 | nmdc:mga0n895_256036_c1 | 3300050512 | Bacteria | 1776 |
| 869 | nmdc:mga0n895_384868_c1 | 3300050512 | Bacteria | 1419 |
| 870 | nmdc:mga0rr50_403615_c1 | 3300050513 | Bacteria | 1155 |
| 871 | Ga0500608_095042 | 3300053122 | Bacteria | 1387 |
| 872 | Ga0500634_0048967 | 3300053161 | Bacteria | 2279 |
| 873 | Ga0587073_0013272 | 3300059492 | Bacteria | 1444 |
| 874 | Ga0587082_007883 | 3300059504 | Bacteria | 1467 |
| 875 | Ga0587088_004885 | 3300059508 | Bacteria | 1728 |
| 876 | Ga0587098_001030 | 3300059604 | Bacteria | 2008 |
| 877 | Ga0587106_005715 | 3300059605 | Bacteria | 1435 |
| 878 | Ga0587067_003793 | 3300059640 | Bacteria | 1916 |
| 879 | Ga0587072_000120 | 3300059643 | Bacteria | 6424 |
| 880 | Ga0587111_0013030 | 3300060346 | Bacteria | 1479 |
| 881 | Ga0501082_0241986 | 3300060353 | Bacteria | 1570 |
| 882 | Ga0501082_0249398 | 3300060353 | Bacteria | 1545 |
| 883 | Ga0466962_0013110 | 3300061719 | Bacteria | 3988 |
| 884 | Ga0466962_0059381 | 3300061719 | Bacteria | 1825 |
| 885 | 2509128752 | 2508501125 | Bacteria | 7208311 |
| 886 | 2513957541 | 2513237150 | Bacteria | 6553639 |
| 887 | 2513960854 | 2513237151 | Bacteria | 6309801 |
| 888 | 2514044968 | 2513237165 | Bacteria | 6771773 |
| 889 | 2514048492 | 2513237166 | Bacteria | 10373764 |
| 890 | 2515689246 | 2515154123 | Bacteria | 6387382 |
| 891 | 2527075094 | 2526164713 | Bacteria | 6780608 |
| 892 | 2563062921 | 2562617112 | Bacteria | 10918404 |
| 893 | 2597032309 | 2596583598 | Bacteria | 5251611 |
| 894 | 2599444300 | 2599185178 | Bacteria | 5365746 |
| 895 | 2599903148 | 2599185292 | Bacteria | 6290804 |
| 896 | 2600809681 | 2600255067 | Bacteria | 6795583 |
| 897 | 2643862359 | 2643221569 | Bacteria | 6064337 |
| 898 | 2643980635 | 2643221594 | Bacteria | 5811388 |
| 899 | 2644122062 | 2643221621 | Bacteria | 6212786 |
| 900 | 2713477119 | 2711768613 | Bacteria | 11048459 |
| 901 | 2723877912 | 2721755763 | Bacteria | 4464185 |
| 902 | 2738820836 | 2738541296 | Bacteria | 7285013 |
| 903 | 2738833316 | 2738541298 | Bacteria | 7286732 |
| 904 | 2738874844 | 2738541306 | Bacteria | 7284992 |
| 905 | 2739186473 | 2738543002 | Bacteria | 7284546 |
| 906 | 2739221442 | 2738543008 | Bacteria | 7282815 |
| 907 | 2739612138 | 2739367655 | Bacteria | 4051151 |
| 908 | 2753570280 | 2751185846 | Bacteria | 7242164 |
| 909 | 2792836365 | 2791355137 | Bacteria | 9654227 |
| 910 | 2809032048 | 2808606395 | Bacteria | 6020352 |
| 911 | 2819620274 | 2818991450 | Bacteria | 6962147 |
| 912 | 2834641997 | 2834641062 | Bacteria | 5559922 |
| 913 | 2857538548 | 2857537821 | Bacteria | 5248181 |
| 914 | 2858693066 | 2858688981 | Bacteria | 8184122 |
| 915 | 2858955805 | 2858950400 | Bacteria | 6783797 |
| 916 | 2881416651 | 2881412998 | Bacteria | 6492157 |
| 917 | 2881930243 | 2881927736 | Bacteria | 3993927 |
| 918 | 2887377844 | 2887375801 | Bacteria | 5334027 |
| 919 | 2900581000 | 2900577576 | Bacteria | 5438534 |
| 920 | 2901300773 | 2901300506 | Bacteria | 8463898 |
| 921 | 2904484994 | 2904483920 | Bacteria | 7545285 |
| 922 | 2904617187 | 2904615490 | Bacteria | 10047340 |
| 923 | 2919530717 | 2919527303 | Bacteria | 7718827 |
| 924 | 2921651249 | 2921643360 | Bacteria | 11448031 |
| 925 | 2928063217 | 2928058823 | Bacteria | 5520022 |
| 926 | 2928505211 | 2928503688 | Bacteria | 7268108 |
| 927 | 2941481872 | |||
| 928 | 2945936878 | 2945934425 | Bacteria | 7444609 |
| 929 | 2990706396 | 2990703756 | Bacteria | 7715990 |
| 930 | 642423216 | 641736151 | Bacteria | 7477263 |
| 931 | 642592776 | 642555112 | Bacteria | 8676562 |
| 932 | 644747685 | 644736347 | Bacteria | 6476522 |
| 933 | 8003404461 | 8003400568 | Bacteria | 5535898 |
| 934 | 8055271068 | 8055266321 | Bacteria | 7999742 |
| 935 | 8055302477 | 8055301274 | Bacteria | 8587385 |
| 936 | Ga0496105_0309145 | |||
| 937 | JGI24741J21665_1003361 | |||
| 938 | JGI24740J21852_10000041 | |||
| 939 | JGI24740J21852_10001633 | |||
| 940 | JGI24740J21852_10008694 | |||
| 941 | JGI24739J22299_10013904 | |||
| 942 | JGI24739J22299_10033143 | |||
| 943 | JGI24739J22299_10105049 | |||
| 944 | JGI24737J22298_10041748 | |||
| 945 | JGI24737J22298_10053319 | |||
| 946 | JGI24735J21928_10000091 | |||
| 947 | JGI24735J21928_10001866 | |||
| 948 | JGI24735J21928_10011992 | |||
| 949 | JGI24735J21928_10018104 | |||
| 950 | JGI25156J39149_1000646 | |||
| 951 | JGI25156J39149_1001062 | |||
| 952 | JGI25156J39149_1002962 | |||
| 953 | JGI25156J39149_1006575 | |||
| 954 | JGI25154J39366_1002233 | |||
| 955 | JGI25151J46595_10001673 | |||
| 956 | JGI25151J46595_10002590 | |||
| 957 | JGI25151J46595_10018669 | |||
| 958 | JGI25151J46595_10124825 | |||
| 959 | JGI25165J46597_1001137 | |||
| 960 | rootH1_10098837 | |||
| 961 | rootL2_10098015 | |||
| 962 | rootL2_10382709 | |||
| 963 | rootH1_10134737 | |||
| 964 | JGI25160J50197_1000185 | |||
| 965 | Ga0006554J51385_1020631 | |||
| 966 | Ga0055538_1003408 | |||
| 967 | Ga0055539_1000062 | |||
| 968 | Ga0055533_1000298 | |||
| 969 | Ga0055533_1002564 | |||
| 970 | Ga0055533_1002709 | |||
| 971 | Ga0055532_1000019 | |||
| 972 | Ga0055532_1000027 | |||
| 973 | Ga0055525_1000275 | |||
| 974 | Ga0055527_1000019 | |||
| 975 | Ga0055527_1001040 | |||
| 976 | Ga0055535_1000014 | |||
| 977 | Ga0055535_1000021 | |||
| 978 | Ga0055542_1000032 | |||
| 979 | Ga0055542_1000961 | |||
| 980 | Ga0055529_1000038 | |||
| 981 | Ga0055529_1000086 | |||
| 982 | Ga0055526_1001285 | |||
| 983 | Ga0055526_1015718 | |||
| 984 | Ga0055526_1018400 | |||
| 985 | Ga0055537_1004036 | |||
| 986 | Ga0055524_1001113 | |||
| 987 | Ga0055524_1018331 | |||
| 988 | Ga0055536_1000034 | |||
| 989 | Ga0055534_1000550 | |||
| 990 | Ga0055534_1008796 | |||
| 991 | Ga0055534_1022196 | |||
| 992 | Ga0055541_1001800 | |||
| 993 | Ga0065165_1000591 | |||
| 994 | Ga0070658_10052963 | |||
| 995 | Ga0070676_10428585 | |||
| 996 | Ga0070683_100020025 | |||
| 997 | Ga0068869_100940323 | |||
| 998 | Ga0070666_10076945 | |||
| 999 | Ga0070682_100331390 | |||
| 1000 | Ga0070682_100719310 | |||
| 1001 | Ga0068868_100255852 | |||
| 1002 | Ga0070660_100007556 | |||
| 1003 | Ga0070660_100027436 | |||
| 1004 | Ga0070661_100001754 | |||
| 1005 | Ga0070661_100044368 | |||
| 1006 | Ga0070661_100155113 | |||
| 1007 | Ga0070661_100376018 | |||
| 1008 | Ga0070668_100040327 | |||
| 1009 | Ga0070669_100173220 | |||
| 1010 | Ga0070675_100570982 | |||
| 1011 | Ga0070675_101024806 | |||
| 1012 | Ga0070671_100587557 | |||
| 1013 | Ga0070674_100625632 | |||
| 1014 | Ga0070674_100700696 | |||
| 1015 | Ga0070659_100008608 | |||
| 1016 | Ga0070659_100078029 | |||
| 1017 | Ga0070667_100075887 | |||
| 1018 | Ga0070667_100452928 | |||
| 1019 | Ga0070700_100827326 | |||
| 1020 | Ga0070663_100000010 | |||
| 1021 | Ga0070663_100104717 | |||
| 1022 | Ga0070663_100118664 | |||
| 1023 | Ga0070663_100741213 | |||
| 1024 | Ga0070681_10002686 | |||
| 1025 | Ga0070681_10083560 | |||
| 1026 | Ga0070681_10395393 | |||
| 1027 | Ga0068867_100027566 | |||
| 1028 | Ga0070706_100016789 | |||
| 1029 | Ga0070679_100001227 | |||
| 1030 | Ga0070679_100435654 | |||
| 1031 | Ga0070684_100025198 | |||
| 1032 | Ga0070697_100028393 | |||
| 1033 | Ga0068853_100002964 | |||
| 1034 | Ga0068853_100138624 | |||
| 1035 | Ga0068853_100907792 | |||
| 1036 | Ga0068853_101135642 | |||
| 1037 | Ga0070672_100171161 | |||
| 1038 | Ga0070672_100315765 | |||
| 1039 | Ga0070695_101095228 | |||
| 1040 | Ga0070693_100092541 | |||
| 1041 | Ga0070665_100033702 | |||
| 1042 | Ga0070665_100164076 | |||
| 1043 | Ga0070665_101480114 | |||
| 1044 | Ga0068855_100006598 | |||
| 1045 | Ga0070664_100000005 | |||
| 1046 | Ga0070664_100026844 | |||
| 1047 | Ga0068857_100002812 | |||
| 1048 | Ga0068857_100042621 | |||
| 1049 | Ga0068857_100243267 | |||
| 1050 | Ga0068854_100000032 | |||
| 1051 | Ga0068854_100045605 | |||
| 1052 | Ga0068856_100000054 | |||
| 1053 | Ga0068856_100131828 | |||
| 1054 | Ga0068856_100246623 | |||
| 1055 | Ga0070702_100147969 | |||
| 1056 | Ga0068852_100181895 | |||
| 1057 | Ga0068852_100501879 | |||
| 1058 | Ga0068859_100107183 | |||
| 1059 | Ga0068864_100017172 | |||
| 1060 | Ga0068866_10143062 | |||
| 1061 | Ga0068861_101014595 | |||
| 1062 | Ga0068861_101228088 | |||
| 1063 | Ga0068863_100018468 | |||
| 1064 | Ga0068863_100272170 | |||
| 1065 | Ga0068858_100012259 | |||
| 1066 | Ga0068858_100968759 | |||
| 1067 | Ga0068860_100010416 | |||
| 1068 | Ga0068860_100557196 | |||
| 1069 | Ga0068860_100625279 | |||
| 1070 | Ga0068862_100062324 | |||
| 1071 | Ga0068862_100577406 | |||
| 1072 | Ga0075364_10000343 | |||
| 1073 | Ga0075432_10116710 | |||
| 1074 | Ga0075366_10000330 | |||
| 1075 | Ga0068871_100359419 | |||
| 1076 | Ga0075428_100442582 | |||
| 1077 | Ga0075428_101201855 | |||
| 1078 | Ga0075430_100028691 | |||
| 1079 | Ga0075431_100002878 | |||
| 1080 | Ga0075433_10785549 | |||
| 1081 | Ga0075434_100129275 | |||
| 1082 | Ga0075434_100158926 | |||
| 1083 | Ga0075429_100031889 | |||
| 1084 | Ga0068865_100031584 | |||
| 1085 | Ga0097620_100107187 | |||
| 1086 | Ga0099826_10000004 | |||
| 1087 | Ga0075435_100122314 | |||
| 1088 | Ga0105251_10000184 | |||
| 1089 | Ga0105251_10000293 | |||
| 1090 | Ga0105251_10054901 | |||
| 1091 | Ga0105251_10080456 | |||
| 1092 | Ga0105244_10022984 | |||
| 1093 | Ga0105250_10148471 | |||
| 1094 | Ga0105250_10292130 | |||
| 1095 | Ga0105240_10002359 | |||
| 1096 | Ga0105240_10003095 | |||
| 1097 | Ga0105240_10268140 | |||
| 1098 | Ga0105240_10280953 | |||
| 1099 | Ga0105240_10329382 | |||
| 1100 | Ga0105240_10442198 | |||
| 1101 | Ga0105240_10484586 | |||
| 1102 | Ga0105240_11365160 | |||
| 1103 | Ga0105240_12134227 | |||
| 1104 | Ga0111539_10044921 | |||
| 1105 | Ga0111539_10571517 | |||
| 1106 | Ga0105245_10765471 | |||
| 1107 | Ga0114129_10034281 | |||
| 1108 | Ga0114129_10533803 | |||
| 1109 | Ga0105243_10191622 | |||
| 1110 | Ga0105243_11454611 | |||
| 1111 | Ga0105242_10055147 | |||
| 1112 | Ga0105248_10095583 | |||
| 1113 | Ga0105248_10174075 | |||
| 1114 | Ga0105237_10002731 | |||
| 1115 | Ga0105238_10211276 | |||
| 1116 | Ga0105238_10236796 | |||
| 1117 | Ga0105238_10787334 | |||
| 1118 | Ga0105239_10008498 | |||
| 1119 | Ga0157373_10016456 | |||
| 1120 | Ga0157373_10026736 | |||
| 1121 | Ga0157373_10033207 | |||
| 1122 | Ga0157373_10065116 | |||
| 1123 | Ga0157371_10000103 | |||
| 1124 | Ga0157371_10030892 | |||
| 1125 | Ga0157371_10035498 | |||
| 1126 | Ga0157370_10002609 | |||
| 1127 | Ga0157370_10003769 | |||
| 1128 | Ga0157370_10007198 | |||
| 1129 | Ga0157369_10000515 | |||
| 1130 | Ga0157369_10011140 | |||
| 1131 | Ga0157369_10025592 | |||
| 1132 | Ga0157369_10073047 | |||
| 1133 | Ga0157369_10340967 | |||
| 1134 | Ga0157374_10000033 | |||
| 1135 | Ga0157374_10000479 | |||
| 1136 | Ga0157374_10116452 | |||
| 1137 | Ga0157378_10471636 | |||
| 1138 | Ga0157378_10999567 | |||
| 1139 | Ga0163162_10004991 | |||
| 1140 | Ga0163162_10012206 | |||
| 1141 | Ga0163162_10105166 | |||
| 1142 | Ga0163162_10470033 | |||
| 1143 | Ga0157372_10000151 | |||
| 1144 | Ga0157372_10001075 | |||
| 1145 | Ga0157372_10020411 | |||
| 1146 | Ga0157372_10053129 | |||
| 1147 | Ga0157375_10015180 | |||
| 1148 | Ga0157375_10721043 | |||
| 1149 | Ga0157380_10013954 | |||
| 1150 | Ga0157380_10078162 | |||
| 1151 | Ga0157380_10205274 | |||
| 1152 | Ga0157380_11496058 | |||
| 1153 | Ga0182008_10054527 | |||
| 1154 | Ga0182008_10392561 | |||
| 1155 | Ga0157379_10017358 | |||
| 1156 | Ga0157376_10044386 | |||
| 1157 | Ga0157376_10869359 | |||
| 1158 | Ga0182006_1084630 | |||
| 1159 | Ga0182006_1109578 | |||
| 1160 | Ga0182007_10000413 | |||
| 1161 | Ga0182007_10005838 | |||
| 1162 | Ga0183361_10032 | |||
| 1163 | Ga0163161_10037887 | |||
| 1164 | Ga0197907_10353847 | |||
| 1165 | Ga0206349_1032392 | |||
| 1166 | Ga0206355_1153515 | |||
| 1167 | Ga0206351_10069195 | |||
| 1168 | Ga0206350_11308327 | |||
| 1169 | Ga0154015_1423277 | |||
| 1170 | Ga0213875_10397355 | |||
| 1171 | Ga0224712_10059727 | |||
| 1172 | Ga0224712_10085225 | |||
| 1173 | Ga0209435_105095 | |||
| 1174 | Ga0209784_100003 | |||
| 1175 | Ga0209784_100445 | |||
| 1176 | Ga0209566_100002 | |||
| 1177 | Ga0209566_100540 | |||
| 1178 | Ga0209566_100748 | |||
| 1179 | Ga0209566_104256 | |||
| 1180 | Ga0209674_100005 | |||
| 1181 | Ga0209674_100008 | |||
| 1182 | Ga0209674_100103 | |||
| 1183 | Ga0209674_100239 | |||
| 1184 | Ga0209674_103676 | |||
| 1185 | Ga0209672_100001 | |||
| 1186 | Ga0209672_100787 | |||
| 1187 | Ga0209672_100814 | |||
| 1188 | Ga0209147_100001 | |||
| 1189 | Ga0209147_100002 | |||
| 1190 | Ga0209563_100004 | |||
| 1191 | Ga0209563_100316 | |||
| 1192 | Ga0207427_103128 | |||
| 1193 | Ga0209258_100001 | |||
| 1194 | Ga0209258_100002 | |||
| 1195 | Ga0209646_1000019 | |||
| 1196 | Ga0209646_1023233 | |||
| 1197 | Ga0209026_1001789 | |||
| 1198 | Ga0209026_1017300 | |||
| 1199 | Ga0209677_100009 | |||
| 1200 | Ga0209148_1000003 | |||
| 1201 | Ga0209148_1000193 | |||
| 1202 | Ga0209148_1011092 | |||
| 1203 | Ga0209759_1000219 | |||
| 1204 | Ga0209759_1000653 | |||
| 1205 | Ga0209759_1001904 | |||
| 1206 | Ga0209759_1007353 | |||
| 1207 | Ga0209759_1008171 | |||
| 1208 | Ga0209759_1008442 | |||
| 1209 | Ga0209759_1013403 | |||
| 1210 | Ga0209233_1000043 | |||
| 1211 | Ga0209565_1000066 | |||
| 1212 | Ga0209565_1000191 | |||
| 1213 | Ga0209455_1000001 | |||
| 1214 | Ga0209455_1000076 | |||
| 1215 | Ga0209673_1020940 | |||
| 1216 | Ga0209673_1036990 | |||
| 1217 | Ga0209130_1016805 | |||
| 1218 | Ga0209675_1000084 | |||
| 1219 | Ga0209675_1002190 | |||
| 1220 | Ga0209675_1003512 | |||
| 1221 | Ga0209676_1000014 | |||
| 1222 | Ga0209676_1003152 | |||
| 1223 | Ga0209025_1000323 | |||
| 1224 | Ga0209025_1001111 | |||
| 1225 | Ga0209025_1001574 | |||
| 1226 | Ga0209025_1003707 | |||
| 1227 | Ga0209025_1044106 | |||
| 1228 | Ga0209564_1000182 | |||
| 1229 | Ga0209564_1000679 | |||
| 1230 | Ga0209564_1001564 | |||
| 1231 | Ga0209564_1004920 | |||
| 1232 | Ga0209758_1015621 | |||
| 1233 | Ga0209050_1005244 | |||
| 1234 | Ga0209256_1000272 | |||
| 1235 | Ga0209256_1005003 | |||
| 1236 | Ga0207426_1000128 | |||
| 1237 | Ga0207426_1004287 | |||
| 1238 | Ga0209051_1003658 | |||
| 1239 | Ga0209051_1026672 | |||
| 1240 | Ga0207656_10254436 | |||
| 1241 | Ga0207713_1000402 | |||
| 1242 | Ga0207713_1000487 | |||
| 1243 | Ga0207713_1148885 | |||
| 1244 | Ga0207642_10115236 | |||
| 1245 | Ga0207642_10304153 | |||
| 1246 | Ga0207688_10181543 | |||
| 1247 | Ga0207680_10053262 | |||
| 1248 | Ga0207680_10180824 | |||
| 1249 | Ga0207645_10008397 | |||
| 1250 | Ga0207705_10013924 | |||
| 1251 | Ga0207705_10074011 | |||
| 1252 | Ga0207684_10090207 | |||
| 1253 | Ga0207707_10097964 | |||
| 1254 | Ga0207707_10110834 | |||
| 1255 | Ga0207695_10000879 | |||
| 1256 | Ga0207695_10002741 | |||
| 1257 | Ga0207695_10013750 | |||
| 1258 | Ga0207695_10297466 | |||
| 1259 | Ga0207695_10420309 | |||
| 1260 | Ga0207671_10135085 | |||
| 1261 | Ga0207662_10076088 | |||
| 1262 | Ga0207662_10149400 | |||
| 1263 | Ga0207657_10000269 | |||
| 1264 | Ga0207657_10098200 | |||
| 1265 | Ga0207649_10000961 | |||
| 1266 | Ga0207649_10020123 | |||
| 1267 | Ga0207649_10158264 | |||
| 1268 | Ga0207652_10966040 | |||
| 1269 | Ga0207681_10032337 | |||
| 1270 | Ga0207694_10190010 | |||
| 1271 | Ga0207650_10038563 | |||
| 1272 | Ga0207659_10359741 | |||
| 1273 | Ga0207687_10663313 | |||
| 1274 | Ga0207644_10643905 | |||
| 1275 | Ga0207690_10043033 | |||
| 1276 | Ga0207706_10144831 | |||
| 1277 | Ga0207669_10231618 | |||
| 1278 | Ga0207669_11558530 | |||
| 1279 | Ga0207704_10590083 | |||
| 1280 | Ga0207665_10232627 | |||
| 1281 | Ga0207691_10004198 | |||
| 1282 | Ga0207691_10049890 | |||
| 1283 | Ga0207691_10118021 | |||
| 1284 | Ga0207691_10594990 | |||
| 1285 | Ga0207711_10060874 | |||
| 1286 | Ga0207661_10047911 | |||
| 1287 | Ga0207679_10000020 | |||
| 1288 | Ga0207679_10690529 | |||
| 1289 | Ga0207667_10005200 | |||
| 1290 | Ga0207651_11314277 | |||
| 1291 | Ga0207712_11073339 | |||
| 1292 | Ga0207668_10000588 | |||
| 1293 | Ga0207668_10019037 | |||
| 1294 | Ga0207640_10000017 | |||
| 1295 | Ga0207640_10110169 | |||
| 1296 | Ga0207658_10707264 | |||
| 1297 | Ga0207677_10283532 | |||
| 1298 | Ga0207703_10116406 | |||
| 1299 | Ga0207639_10017592 | |||
| 1300 | Ga0207639_10076238 | |||
| 1301 | Ga0207639_10792064 | |||
| 1302 | Ga0207639_11263927 | |||
| 1303 | Ga0207678_10000008 | |||
| 1304 | Ga0207678_10029369 | |||
| 1305 | Ga0207678_10082857 | |||
| 1306 | Ga0207678_10174048 | |||
| 1307 | Ga0207708_10211272 | |||
| 1308 | Ga0207708_10421817 | |||
| 1309 | Ga0207702_10000017 | |||
| 1310 | Ga0207702_10182684 | |||
| 1311 | Ga0207702_11226531 | |||
| 1312 | Ga0207641_10018387 | |||
| 1313 | Ga0207641_10918642 | |||
| 1314 | Ga0207674_10007727 | |||
| 1315 | Ga0207674_10017042 | |||
| 1316 | Ga0207674_10069277 | |||
| 1317 | Ga0207675_100122841 | |||
| 1318 | Ga0207675_101831227 | |||
| 1319 | Ga0207683_10034065 | |||
| 1320 | Ga0207683_10150855 | |||
| 1321 | Ga0207698_10047635 | |||
| 1322 | Ga0207698_10081738 | |||
| 1323 | Ga0207698_10860891 | |||
| 1324 | Ga0209371_1024030 | |||
| 1325 | Ga0209371_1033628 | |||
| 1326 | Ga0209282_1000099 | |||
| 1327 | Ga0207428_10156290 | |||
| 1328 | Ga0268266_10030298 | |||
| 1329 | Ga0268266_10131138 | |||
| 1330 | Ga0268266_10789748 | |||
| 1331 | Ga0268265_10060496 | |||
| 1332 | Ga0268264_10123127 | |||
| 1333 | Ga0268264_10215530 | |||
| 1334 | Ga0268264_10445207 | |||
| 1335 | Ga0265338_10000373 | |||
| 1336 | Ga0268256_1024210 | |||
| 1337 | Ga0268256_1027733 | |||
| 1338 | Ga0316177_1219224 | |||
| 1339 | Ga0314311_1209785 | |||
| 1340 | Ga0316178_1077292 | |||
| 1341 | Ga0316180_1107170 | |||
| 1342 | Ga0316183_1149106 | |||
| 1343 | Ga0316181_1028793 | |||
| 1344 | Ga0316182_1026372 | |||
| 1345 | Ga0316182_1379610 | |||
| 1346 | Ga0307408_100176938 | |||
| 1347 | Ga0265342_10067675 | |||
| 1348 | Ga0307405_10426478 | |||
| 1349 | Ga0307413_10085260 | |||
| 1350 | Ga0307413_10198044 | |||
| 1351 | Ga0307413_10322876 | |||
| 1352 | Ga0307413_10862344 | |||
| 1353 | Ga0307410_10044476 | |||
| 1354 | Ga0307410_10113174 | |||
| 1355 | Ga0307410_10144592 | |||
| 1356 | Ga0307410_10751249 | |||
| 1357 | Ga0307406_10265779 | |||
| 1358 | Ga0307407_10025812 | |||
| 1359 | Ga0307407_10247560 | |||
| 1360 | Ga0307412_10000024 | |||
| 1361 | Ga0307412_10000436 | |||
| 1362 | Ga0307412_10463729 | |||
| 1363 | Ga0307412_10666180 | |||
| 1364 | Ga0307409_100092316 | |||
| 1365 | Ga0307409_100125404 | |||
| 1366 | Ga0307416_100215162 | |||
| 1367 | Ga0307416_100684568 | |||
| 1368 | Ga0307416_100848664 | |||
| 1369 | Ga0307416_102814189 | |||
| 1370 | Ga0307414_10708395 | |||
| 1371 | Ga0307415_100028072 | |||
| 1372 | Ga0307415_100329315 | |||
| 1373 | Ga0307415_101008967 | |||
| 1374 | Ga0373931_0512054 | |||
| 1375 | Ga0373947_0586766 | |||
| 1376 | Ga0395900_0038650 | |||
| 1377 | Ga0395900_0093007 | |||
| 1378 | Ga0395900_0095421 | |||
| 1379 | Ga0395900_0526780 | |||
| 1380 | Ga0395898_0010083 | |||
| 1381 | Ga0395898_0266435 | |||
| 1382 | Ga0395905_0000139 | |||
| 1383 | Ga0395905_0025569 | |||
| 1384 | Ga0436364_1537887 | |||
| 1385 | Ga0395901_0643803 | |||
| 1386 | Ga0436365_1306015 | |||
| 1387 | Ga0436361_0480554 | |||
| 1388 | Ga0436361_0509700 | |||
| 1389 | Ga0451853_1606758 | |||
| 1390 | Ga0451853_2182218 | |||
| 1391 | Ga0439448_0000015 | |||
| 1392 | Ga0450913_004827 | |||
| 1393 | Ga0450888_007942 | |||
| 1394 | Ga0451577_0381618 | |||
| 1395 | Ga0466986_0041101 | |||
| 1396 | Ga0466969_0004373 | |||
| 1397 | Ga0466969_0008360 | |||
| 1398 | Ga0466972_0008336 | |||
| 1399 | Ga0466973_0278332 | |||
| 1400 | Ga0466980_0332424 | |||
| 1401 | Ga0466978_0053880 | |||
| 1402 | Ga0466982_0101071 | |||
| 1403 | Ga0466965_0000467 | |||
| 1404 | Ga0466965_0025797 | |||
| 1405 | Ga0466965_0043109 | |||
| 1406 | Ga0466966_0011232 | |||
| 1407 | Ga0466961_0000202 | |||
| 1408 | Ga0466961_0014067 | |||
| 1409 | Ga0466961_0020105 | |||
| 1410 | Ga0466961_0309204 | |||
| 1411 | Ga0466961_0469565 | |||
| 1412 | Ga0466963_0001290 | |||
| 1413 | Ga0466964_0002827 | |||
| 1414 | Ga0466968_0027309 | |||
| 1415 | Ga0466970_0023594 | |||
| 1416 | Ga0466970_0031675 | |||
| 1417 | Ga0466970_0037006 | |||
| 1418 | Ga0466970_0056263 | |||
| 1419 | Ga0466960_0037268 | |||
| 1420 | Ga0466959_0000534 | |||
| 1421 | Ga0466959_0014413 | |||
| 1422 | Ga0466959_0019887 | |||
| 1423 | Ga0451576_1944497 | |||
| 1424 | Ga0466958_0000819 | |||
| 1425 | Ga0466958_0185133 | |||
| 1426 | Ga0466967_0099476 | |||
| 1427 | Ga0466967_1055759 | |||
| 1428 | Ga0495592_0034124 | |||
| 1429 | Ga0495592_0154430 | |||
| 1430 | Ga0495603_0003816 | |||
| 1431 | Ga0495603_0005929 | |||
| 1432 | Ga0495603_0029084 | |||
| 1433 | Ga0495590_0020740 | |||
| 1434 | Ga0495590_0099860 | |||
| 1435 | Ga0495591_001325 | |||
| 1436 | Ga0495629_0000621 | |||
| 1437 | Ga0495629_0003554 | |||
| 1438 | Ga0495629_0040683 | |||
| 1439 | Ga0495629_0057326 | |||
| 1440 | Ga0495629_0351169 | |||
| 1441 | Ga0495638_0014232 | |||
| 1442 | Ga0495641_0028838 | |||
| 1443 | Ga0495651_0088256 | |||
| 1444 | Ga0495651_0242755 | |||
| 1445 | Ga0495651_0381468 | |||
| 1446 | Ga0495653_0025199 | |||
| 1447 | Ga0495653_0076410 | |||
| 1448 | Ga0495653_0133708 | |||
| 1449 | Ga0495653_0344286 | |||
| 1450 | Ga0495653_0604849 | |||
| 1451 | Ga0495650_0011793 | |||
| 1452 | Ga0495650_0176951 | |||
| 1453 | Ga0495580_0002750 | |||
| 1454 | Ga0495580_0013455 | |||
| 1455 | Ga0495580_0029257 | |||
| 1456 | Ga0495580_0035932 | |||
| 1457 | Ga0495580_0036611 | |||
| 1458 | Ga0495580_0054160 | |||
| 1459 | Ga0495582_0016270 | |||
| 1460 | Ga0495582_0033980 | |||
| 1461 | Ga0495605_0010467 | |||
| 1462 | Ga0495605_0017315 | |||
| 1463 | Ga0495605_0017609 | |||
| 1464 | Ga0495605_0017825 | |||
| 1465 | Ga0495662_0023002 | |||
| 1466 | Ga0495662_0363601 | |||
| 1467 | Ga0495664_0035726 | |||
| 1468 | Ga0495664_0036436 | |||
| 1469 | Ga0495664_0083549 | |||
| 1470 | Ga0495584_0089198 | |||
| 1471 | Ga0495596_0001108 | |||
| 1472 | Ga0495596_0003240 | |||
| 1473 | Ga0495596_0048457 | |||
| 1474 | Ga0495596_0085457 | |||
| 1475 | Ga0495596_0127958 | |||
| 1476 | Ga0495607_0012078 | |||
| 1477 | Ga0495583_0000068 | |||
| 1478 | Ga0495583_0018710 | |||
| 1479 | Ga0495583_0027207 | |||
| 1480 | Ga0495583_0032336 | |||
| 1481 | Ga0495583_0043440 | |||
| 1482 | Ga0495606_0034153 | |||
| 1483 | Ga0495606_0043724 | |||
| 1484 | Ga0495606_0075935 | |||
| 1485 | Ga0495606_0264250 | |||
| 1486 | Ga0495608_0017666 | |||
| 1487 | Ga0495608_0166695 | |||
| 1488 | Ga0495608_0448456 | |||
| 1489 | Ga0495610_0013689 | |||
| 1490 | Ga0495610_0014902 | |||
| 1491 | Ga0495616_0007070 | |||
| 1492 | Ga0495616_0250338 | |||
| 1493 | Ga0495618_0126221 | |||
| 1494 | Ga0495618_0324787 | |||
| 1495 | Ga0495618_0527002 | |||
| 1496 | Ga0495620_0049235 | |||
| 1497 | Ga0495628_0002857 | |||
| 1498 | Ga0495628_0029333 | |||
| 1499 | Ga0495628_0136832 | |||
| 1500 | Ga0495628_0250843 | |||
| 1501 | Ga0495628_0327447 | |||
| 1502 | Ga0495630_0014598 | |||
| 1503 | Ga0495630_0027944 | |||
| 1504 | Ga0495630_0075991 | |||
| 1505 | Ga0495643_0104551 | |||
| 1506 | Ga0495643_0360632 | |||
| 1507 | Ga0495644_0194917 | |||
| 1508 | Ga0495648_0029844 | |||
| 1509 | Ga0495648_0047663 | |||
| 1510 | Ga0495648_0069197 | |||
| 1511 | Ga0495648_0073286 | |||
| 1512 | Ga0495648_0089245 | |||
| 1513 | Ga0495648_0093375 | |||
| 1514 | Ga0495663_0003587 | |||
| 1515 | Ga0495666_0012383 | |||
| 1516 | Ga0495666_0016881 | |||
| 1517 | Ga0495666_0077062 | |||
| 1518 | Ga0495642_0008709 | |||
| 1519 | Ga0495642_0088947 | |||
| 1520 | Ga0495642_0295768 | |||
| 1521 | Ga0495652_0034961 | |||
| 1522 | Ga0495652_0183910 | |||
| 1523 | Ga0495652_0185574 | |||
| 1524 | Ga0495654_0026546 | |||
| 1525 | Ga0495665_0009569 | |||
| 1526 | Ga0495665_0012689 | |||
| 1527 | Ga0495665_0078242 | |||
| 1528 | Ga0495640_0009173 | |||
| 1529 | Ga0495640_0022060 | |||
| 1530 | Ga0495640_0046438 | |||
| 1531 | Ga0495586_0001230 | |||
| 1532 | Ga0495586_0022072 | |||
| 1533 | Ga0495587_0001551 | |||
| 1534 | Ga0495587_0033824 | |||
| 1535 | Ga0495609_0003326 | |||
| 1536 | Ga0495621_0245748 | |||
| 1537 | Ga0495597_0044386 | |||
| 1538 | Ga0495597_0153302 | |||
| 1539 | Ga0495597_0175169 | |||
| 1540 | Ga0495645_0001069 | |||
| 1541 | Ga0495645_0001820 | |||
| 1542 | Ga0495645_0016349 | |||
| 1543 | Ga0495645_0166677 | |||
| 1544 | Ga0495622_0000298 | |||
| 1545 | Ga0495622_0082588 | |||
| 1546 | Ga0495667_0010583 | |||
| 1547 | Ga0495667_0375985 | |||
| 1548 | Ga0495656_0028681 | |||
| 1549 | Ga0495656_0085707 | |||
| 1550 | Ga0495656_0091825 | |||
| 1551 | Ga0495656_0326919 | |||
| 1552 | Ga0495668_0601798 | |||
| 1553 | Ga0495634_0003726 | |||
| 1554 | Ga0495634_0010925 | |||
| 1555 | Ga0495634_0330265 | |||
| 1556 | Ga0495611_0045239 | |||
| 1557 | Ga0495625_0359796 | |||
| 1558 | Ga0495625_0406136 | |||
| 1559 | Ga0495635_0053654 | |||
| 1560 | Ga0495635_0061583 | |||
| 1561 | Ga0495659_0207905 | |||
| 1562 | Ga0495661_0001700 | |||
| 1563 | Ga0495661_0016395 | |||
| 1564 | Ga0495661_0052048 | |||
| 1565 | Ga0495588_0038490 | |||
| 1566 | Ga0495599_0011522 | |||
| 1567 | Ga0495599_0104590 | |||
| 1568 | Ga0495599_0456226 | |||
| 1569 | Ga0495623_0046998 | |||
| 1570 | Ga0495623_0104644 | |||
| 1571 | Ga0495623_0122849 | |||
| 1572 | Ga0495646_0004121 | |||
| 1573 | Ga0495646_0066398 | |||
| 1574 | Ga0495646_0108096 | |||
| 1575 | Ga0495646_0144927 | |||
| 1576 | Ga0495669_0024369 | |||
| 1577 | Ga0495669_0075831 | |||
| 1578 | Ga0495624_0006224 | |||
| 1579 | Ga0495624_0029504 | |||
| 1580 | Ga0495624_0131339 | |||
| 1581 | Ga0495624_0145352 | |||
| 1582 | Ga0495670_0253363 | |||
| 1583 | Ga0495671_0013958 | |||
| 1584 | Ga0495671_0082832 | |||
| 1585 | Ga0495649_0013958 | |||
| 1586 | Ga0495649_0015869 | |||
| 1587 | Ga0495649_0159382 | |||
| 1588 | Ga0495589_0082395 | |||
| 1589 | Ga0495589_0098603 | |||
| 1590 | Ga0495589_0102386 | |||
| 1591 | Ga0495589_0127612 | |||
| 1592 | Ga0495600_0053478 | |||
| 1593 | Ga0495660_0307469 | |||
| 1594 | Ga0495581_0016676 | |||
| 1595 | Ga0495581_0078534 | |||
| 1596 | Ga0495604_0024415 | |||
| 1597 | Ga0495604_0027217 | |||
| 1598 | Ga0495604_0027396 | |||
| 1599 | Ga0495604_0109534 | |||
| 1600 | Ga0495604_0231095 | |||
| 1601 | Ga0495636_0009413 | |||
| 1602 | Ga0495636_0271226 | |||
| 1603 | Ga0495636_0305354 | |||
| 1604 | Ga0495636_0419735 | |||
| 1605 | Ga0495674_0019899 | |||
| 1606 | Ga0495674_0083337 | |||
| 1607 | Ga0495674_0097625 | |||
| 1608 | Ga0495674_0147654 | |||
| 1609 | Ga0495674_0322751 | |||
| 1610 | Ga0495674_0364118 | |||
| 1611 | Ga0495674_0604560 | |||
| 1612 | Ga0495672_0004572 | |||
| 1613 | Ga0495672_0012791 | |||
| 1614 | Ga0495676_0052189 | |||
| 1615 | Ga0495676_0085740 | |||
| 1616 | Ga0495680_0038431 | |||
| 1617 | Ga0495680_0042668 | |||
| 1618 | Ga0495680_0043740 | |||
| 1619 | Ga0495683_0000695 | |||
| 1620 | Ga0495683_0016227 | |||
| 1621 | Ga0495687_000022 | |||
| 1622 | Ga0495687_004505 | |||
| 1623 | Ga0495687_039957 | |||
| 1624 | Ga0495687_045290 | |||
| 1625 | Ga0495687_056596 | |||
| 1626 | Ga0495687_179169 | |||
| 1627 | Ga0495675_0002394 | |||
| 1628 | Ga0495675_0007474 | |||
| 1629 | Ga0495675_0052046 | |||
| 1630 | Ga0495675_0295225 | |||
| 1631 | Ga0495675_0360931 | |||
| 1632 | Ga0495679_011806 | |||
| 1633 | Ga0495679_019342 | |||
| 1634 | Ga0495685_032742 | |||
| 1635 | Ga0495685_036773 | |||
| 1636 | Ga0495685_056395 | |||
| 1637 | Ga0495685_177379 | |||
| 1638 | Ga0495673_0024843 | |||
| 1639 | Ga0495681_0026216 | |||
| 1640 | Ga0495684_0066135 | |||
| 1641 | Ga0495684_0281827 | |||
| 1642 | Ga0495684_0414072 | |||
| 1643 | Ga0495686_0000002 | |||
| 1644 | Ga0495686_0253002 | |||
| 1645 | Ga0495593_0003104 | |||
| 1646 | Ga0495593_0020827 | |||
| 1647 | Ga0495593_0035609 | |||
| 1648 | Ga0495593_0036881 | |||
| 1649 | Ga0495593_0100051 | |||
| 1650 | Ga0495602_0008283 | |||
| 1651 | Ga0495602_0015149 | |||
| 1652 | Ga0495602_0027929 | |||
| 1653 | Ga0495602_0299734 | |||
| 1654 | Ga0495614_0002622 | |||
| 1655 | Ga0495614_0010514 | |||
| 1656 | Ga0496100_0000180 | |||
| 1657 | Ga0496100_0000207 | |||
| 1658 | Ga0496100_0524419 | |||
| 1659 | Ga0496100_0554497 | |||
| 1660 | Ga0496101_0000547 | |||
| 1661 | Ga0496101_0003927 | |||
| 1662 | Ga0496101_0289396 | |||
| 1663 | Ga0496101_0788419 | |||
| 1664 | Ga0496102_0000216 | |||
| 1665 | Ga0496102_0000717 | |||
| 1666 | Ga0496102_0004936 | |||
| 1667 | Ga0496102_0052125 | |||
| 1668 | Ga0496102_0064982 | |||
| 1669 | Ga0496102_0132084 | |||
| 1670 | Ga0496102_0431688 | |||
| 1671 | Ga0496102_0551840 | |||
| 1672 | Ga0496103_0002758 | |||
| 1673 | Ga0496103_0006474 | |||
| 1674 | Ga0496103_0015874 | |||
| 1675 | Ga0496103_0018054 | |||
| 1676 | Ga0496104_0138053 | |||
| 1677 | Ga0496104_0166174 | |||
| 1678 | Ga0496104_0168319 | |||
| 1679 | Ga0496104_0286019 | |||
| 1680 | Ga0496104_0365963 | |||
| 1681 | Ga0496104_0414213 | |||
| 1682 | Ga0496104_0539220 | |||
| 1683 | Ga0496105_0205744 | |||
| 1684 | Ga0496105_0316558 | |||
| 1685 | Ga0496105_0318627 | |||
| 1686 | Ga0496105_0337689 | |||
| 1687 | Ga0496106_0000057 | |||
| 1688 | Ga0496106_0002634 | |||
| 1689 | Ga0496106_0072982 | |||
| 1690 | Ga0496107_0019485 | |||
| 1691 | Ga0496107_0094452 | |||
| 1692 | Ga0496107_0788302 | |||
| 1693 | Ga0496107_0805852 | |||
| 1694 | Ga0496108_0239564 | |||
| 1695 | Ga0496108_0735661 | |||
| 1696 | Ga0496109_0020152 | |||
| 1697 | Ga0496109_0214370 | |||
| 1698 | Ga0496110_0001136 | |||
| 1699 | Ga0496110_0311365 | |||
| 1700 | Ga0496110_0369896 | |||
| 1701 | Ga0496111_0005793 | |||
| 1702 | Ga0496112_0010662 | |||
| 1703 | Ga0496113_0002190 | |||
| 1704 | Ga0496113_0024086 | |||
| 1705 | Ga0496114_0013131 | |||
| 1706 | Ga0496114_0224626 | |||
| 1707 | Ga0496114_0263616 | |||
| 1708 | Ga0496114_0373515 | |||
| 1709 | Ga0496115_0074020 | |||
| 1710 | Ga0496115_0090935 | |||
| 1711 | Ga0496115_0117860 | |||
| 1712 | Ga0496115_0629342 | |||
| 1713 | Ga0496116_0001131 | |||
| 1714 | Ga0496116_0019204 | |||
| 1715 | Ga0496116_0019804 | |||
| 1716 | Ga0496116_0052426 | |||
| 1717 | Ga0496116_0084861 | |||
| 1718 | Ga0496116_0099329 | |||
| 1719 | Ga0496116_0151762 | |||
| 1720 | Ga0496116_0165712 | |||
| 1721 | Ga0496117_0001224 | |||
| 1722 | Ga0496117_0006835 | |||
| 1723 | Ga0496117_0007476 | |||
| 1724 | Ga0496117_0008109 | |||
| 1725 | Ga0496117_0016751 | |||
| 1726 | Ga0496117_0083071 | |||
| 1727 | Ga0496117_0100557 | |||
| 1728 | Ga0496117_0477750 | |||
| 1729 | Ga0496118_0003743 | |||
| 1730 | Ga0496118_0004212 | |||
| 1731 | Ga0496118_0008399 | |||
| 1732 | Ga0496118_0013944 | |||
| 1733 | Ga0496118_0024474 | |||
| 1734 | Ga0496118_0025276 | |||
| 1735 | Ga0496118_0034131 | |||
| 1736 | Ga0496118_0039332 | |||
| 1737 | Ga0496118_0051436 | |||
| 1738 | Ga0496118_0188849 | |||
| 1739 | Ga0496119_0012281 | |||
| 1740 | Ga0496119_0061704 | |||
| 1741 | Ga0496121_0000446 | |||
| 1742 | Ga0496121_0001895 | |||
| 1743 | Ga0496121_0002624 | |||
| 1744 | Ga0496121_0016560 | |||
| 1745 | Ga0496121_0054867 | |||
| 1746 | Ga0496121_0057297 | |||
| 1747 | Ga0496121_0336263 | |||
| 1748 | Ga0496121_0449482 | |||
| 1749 | Ga0496122_0005474 | |||
| 1750 | Ga0496122_0005675 | |||
| 1751 | Ga0496122_0013800 | |||
| 1752 | Ga0496123_0002852 | |||
| 1753 | Ga0496123_0002953 | |||
| 1754 | Ga0496123_0024705 | |||
| 1755 | Ga0496123_0226540 | |||
| 1756 | Ga0496124_0143127 | |||
| 1757 | Ga0496124_0155636 | |||
| 1758 | Ga0496124_0294913 | |||
| 1759 | Ga0496125_0000011 | |||
| 1760 | Ga0496125_0002367 | |||
| 1761 | Ga0496125_0017544 | |||
| 1762 | Ga0496125_0053414 | |||
| 1763 | Ga0496125_0062439 | |||
| 1764 | Ga0496125_0328314 | |||
| 1765 | Ga0496126_0000083 | |||
| 1766 | Ga0496126_0001580 | |||
| 1767 | Ga0496126_0005065 | |||
| 1768 | Ga0496126_0045036 | |||
| 1769 | Ga0496126_0097518 | |||
| 1770 | Ga0496126_0116147 | |||
| 1771 | Ga0496126_0175925 | |||
| 1772 | Ga0501306_035685 | |||
| 1773 | Ga0501310_031526 | |||
| 1774 | Ga0495682_0046321 | |||
| 1775 | Ga0501323_004450 | |||
| 1776 | Ga0501032_0587797 | |||
| 1777 | Ga0501033_0191769 | |||
| 1778 | Ga0501034_0001301 | |||
| 1779 | Ga0501034_0009210 | |||
| 1780 | Ga0501036_0457068 | |||
| 1781 | Ga0501037_0282163 | |||
| 1782 | Ga0501041_0923807 | |||
| 1783 | Ga0501047_0014543 | |||
| 1784 | Ga0501067_0084924 | |||
| 1785 | Ga0501068_0743598 | |||
| 1786 | Ga0501073_0004765 | |||
| 1787 | Ga0501074_0217964 | |||
| 1788 | Ga0501075_0294295 | |||
| 1789 | Ga0501080_0007643 | |||
| 1790 | Ga0501083_0631773 | |||
| 1791 | Ga0501035_0032407 | |||
| 1792 | Ga0501035_0524287 | |||
| 1793 | Ga0501044_0003960 | |||
| 1794 | nmdc:mga00v17_654_c1 | |||
| 1795 | nmdc:mga0k408_215_c1 | |||
| 1796 | nmdc:mga05p37_74663_c1 | |||
| 1797 | nmdc:mga09592_14494_c1 | |||
| 1798 | nmdc:mga0qj67_252320_c1 | |||
| 1799 | nmdc:mga0qj67_40779_c1 | |||
| 1800 | nmdc:mga06r32_6465_c1 | |||
| 1801 | nmdc:mga08y16_602363_c1 | |||
| 1802 | nmdc:mga08y16_62468_c1 | |||
| 1803 | nmdc:mga0n895_256036_c1 | |||
| 1804 | nmdc:mga0n895_384868_c1 | |||
| 1805 | nmdc:mga0rr50_403615_c1 | |||
| 1806 | Ga0500608_095042 | |||
| 1807 | Ga0500634_0048967 | |||
| 1808 | Ga0587073_0013272 | |||
| 1809 | Ga0587082_007883 | |||
| 1810 | Ga0587088_004885 | |||
| 1811 | Ga0587098_001030 | |||
| 1812 | Ga0587106_005715 | |||
| 1813 | Ga0587067_003793 | |||
| 1814 | Ga0587072_000120 | |||
| 1815 | Ga0587111_0013030 | |||
| 1816 | Ga0501082_0241986 | |||
| 1817 | Ga0501082_0249398 | |||
| 1818 | Ga0466962_0013110 | |||
| 1819 | Ga0466962_0059381 | |||
| 1820 | 2509128752 | |||
| 1821 | 2513957541 | |||
| 1822 | 2513960854 | |||
| 1823 | 2514044968 | |||
| 1824 | 2514048492 | |||
| 1825 | 2515689246 | |||
| 1826 | 2527075094 | |||
| 1827 | 2563062921 | |||
| 1828 | 2597032309 | |||
| 1829 | 2599444300 | |||
| 1830 | 2599903148 | |||
| 1831 | 2600809681 | |||
| 1832 | 2643862359 | |||
| 1833 | 2643980635 | |||
| 1834 | 2644122062 | |||
| 1835 | 2713477119 | |||
| 1836 | 2723877912 | |||
| 1837 | 2738820836 | |||
| 1838 | 2738833316 | |||
| 1839 | 2738874844 | |||
| 1840 | 2739186473 | |||
| 1841 | 2739221442 | |||
| 1842 | 2739612138 | |||
| 1843 | 2753570280 | |||
| 1844 | 2792836365 | |||
| 1845 | 2809032048 | |||
| 1846 | 2819620274 | |||
| 1847 | 2834641997 | |||
| 1848 | 2857538548 | |||
| 1849 | 2858693066 | |||
| 1850 | 2858955805 | |||
| 1851 | 2881416651 | |||
| 1852 | 2881930243 | |||
| 1853 | 2887377844 | |||
| 1854 | 2900581000 | |||
| 1855 | 2901300773 | |||
| 1856 | 2904484994 | |||
| 1857 | 2904617187 | |||
| 1858 | 2919530717 | |||
| 1859 | 2921651249 | |||
| 1860 | 2928063217 | |||
| 1861 | 2928505211 | |||
| 1862 | 2941481872 | |||
| 1863 | 2945936878 | |||
| 1864 | 2990706396 | |||
| 1865 | 642423216 | |||
| 1866 | 642592776 | |||
| 1867 | 644747685 | |||
| 1868 | 8003404461 | |||
| 1869 | 8055271068 | |||
| 1870 | 8055302477 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lw1-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant | 0.9486 | 5 | 172 |
| 1me5-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant | 0.9431 | 5 | 172 |
| 1me5-assembly1.cif.gz_C | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant | 0.9368 | 5 | 173 |
| 1knc-assembly1.cif.gz_A | structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. | 0.928 | 4 | 172 |
| 1me5-assembly1.cif.gz_C | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant | 0.9261 | 5 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gu9D00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9224 | 6 | 172 | 1.20.1290.10 |
| 1gu9D00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8862 | 6 | 172 | 1.20.1290.10 |
| af_A0A1D6HIR6_965_1113_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5302 | 58 | 157 | 1.25.40.10 |
| af_A0A0R0J5W3_390_482_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5243 | 57 | 162 | 1.25.40.10 |
| af_A0A0R0JM00_163_267_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5225 | 73 | 161 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J9GM36-F1-model_v4 | deleted | 1.001 | 1 | 173 |
|
| AF-A0A418X0P8-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9975 | 41 | 172 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |
| AF-G3A7F0-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9971 | 1 | 138 |
GO:0006979
GO:0008785 GO:0032843 GO:0051920 |
| AF-A0A0J9GM36-F1-model_v4 | deleted | 0.9948 | 1 | 173 |
|
| AF-I3UB35-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9907 | 78 | 172 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |