F486174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 755 | 1870 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0000953|Ga0496125_0000953_44261_45346 |
| Length | 361 |
| Sequence | MLTSDFDFDLPDDCIALRPAEPRDSARLLVVKDGVLDDRIIRDLPDFLQPGDALVFNDTRVIPARLSGVRQRIGPEGETLTVEVEATLHHRDAPDVWSAFMKPGKRIKXXXRIHFGRNNAGACELGHLDATVEAKDEDGLITLRFDLAGPALDDAIRDVGVMPLPPYIAARRPEDDRDLKDYQTVFATYDGSVAAPTAGLHFTPELLDAIRARGVSTHAVTLHVGAGTFLPVKADDTTDHKMHSEWGEVSPETAAALNAVRAAGGRIVCVGTTSLRLLESATTEDGMVQPFHGDTAIFITPGYRFRACDVLMTNFHLPKSTLFMLVSAFAGLETMRAAYAHAIDSGYRFYSYGDGSLLFRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 40 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 55 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 56 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 57 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 60 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 61 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 92 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 93 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 102 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 104 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 112 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 113 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 114 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 115 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 116 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 117 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 118 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 119 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 120 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 121 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 122 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 176 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 177 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 178 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 179 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 182 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 183 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 184 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 187 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 188 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 189 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 191 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 193 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 194 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 195 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 196 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 197 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 198 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 199 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 200 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 201 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 202 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 203 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 204 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 205 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 206 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 207 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 208 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 209 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 210 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 211 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 212 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 213 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 214 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 215 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 216 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 217 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 218 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 219 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 220 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 221 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 222 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 223 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 224 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 225 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 226 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 227 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 228 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 229 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 230 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 231 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 232 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 233 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 234 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 235 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 236 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 237 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 238 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 239 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 240 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 241 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 242 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 243 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 244 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 245 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 246 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 247 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 248 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 249 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 250 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 251 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 252 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 253 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 254 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 255 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 256 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 257 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 258 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 259 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 260 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 261 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 262 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 263 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 264 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 265 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 266 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 267 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 268 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 269 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 270 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 271 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 272 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 273 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 274 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 275 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 276 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 277 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 278 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 279 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 280 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 281 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 282 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 283 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 284 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 285 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 286 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 287 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 288 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 289 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 290 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 291 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 292 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 293 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 294 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 295 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 296 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 297 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 298 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 299 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 300 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 301 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 302 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 303 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 304 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 305 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 306 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 307 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 308 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 309 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 310 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 311 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 312 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 313 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 314 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 315 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 316 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 317 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 318 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 319 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 320 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 321 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 322 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 323 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 324 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 325 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 326 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 327 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 328 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 329 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 330 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 331 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 332 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 333 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 334 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 335 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 336 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 337 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 338 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 339 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 340 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 341 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 342 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 343 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 344 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 345 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 346 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 347 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 348 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 349 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 350 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 351 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 352 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 353 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 354 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 355 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 356 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 357 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 358 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 359 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 360 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 361 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 362 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 363 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 364 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 365 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 366 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 367 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 368 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 369 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 370 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 371 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 372 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 373 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 374 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 375 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 376 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 377 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 378 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 379 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 380 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 381 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 382 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 383 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 384 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 385 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 386 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 387 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 388 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 389 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 390 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 391 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 392 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 393 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 394 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 395 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 396 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 397 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 398 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 399 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 400 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 401 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 402 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 403 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 404 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 405 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 406 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 407 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 408 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 409 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 410 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 411 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 412 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 413 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 414 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 415 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 416 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 417 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 418 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 419 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 420 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 421 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 422 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 423 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 424 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 425 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 426 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 427 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 428 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 429 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 430 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 431 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 432 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 433 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 434 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 435 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 436 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 437 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 438 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 439 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 440 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 441 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 442 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 443 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 444 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 445 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 446 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 447 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 448 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 449 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 450 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 451 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 452 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 453 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 454 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 455 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 456 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 457 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 458 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 459 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 460 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 461 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 462 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 463 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 464 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 465 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 466 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 467 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 468 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 469 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 470 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 471 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 472 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 473 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 474 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 475 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 476 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 477 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 478 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 479 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 480 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 481 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 482 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 483 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 484 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 485 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 486 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 487 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 488 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 489 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 490 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 491 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 492 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 493 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 494 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 495 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 496 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 497 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 498 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 499 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 500 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 501 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 502 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 503 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 504 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 505 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 506 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 507 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 508 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 509 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 510 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 511 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 512 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 513 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 514 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 515 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 516 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 517 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 518 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 519 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 520 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 521 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 522 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 523 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 524 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 525 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 526 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 527 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 528 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 529 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 530 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 531 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 532 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 533 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 534 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 535 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 536 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 537 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 538 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 539 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 540 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 541 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 542 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 543 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 544 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 545 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 546 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 547 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 548 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 549 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 550 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 551 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 552 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 553 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 554 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 555 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 556 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 557 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 558 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 559 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 560 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 561 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 562 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 563 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 564 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 565 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 566 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 567 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 568 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 569 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 570 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 571 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 572 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 573 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 574 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 575 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 576 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 577 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 578 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 579 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 580 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 581 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 582 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 583 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 584 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 585 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 586 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 587 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 588 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 589 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 590 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 591 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 592 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 593 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 594 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 595 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 596 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 597 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 598 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 599 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 600 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 601 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 602 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 603 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 604 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 605 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 606 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 607 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 608 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 609 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 610 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 611 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 612 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 613 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 614 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 615 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 616 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 617 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 618 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 619 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 620 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 621 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 622 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 623 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 624 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 625 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 626 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 627 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 628 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 629 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 630 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 631 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 632 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 633 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 634 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 635 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 636 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 637 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 638 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 639 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 640 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 641 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 642 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 643 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 644 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 645 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 646 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 647 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 648 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 649 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 650 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 651 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 652 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 653 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 654 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 655 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 656 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 657 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 658 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 659 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 660 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 661 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 662 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 663 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 664 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 665 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 666 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 667 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 668 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 669 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 670 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 671 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 672 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 673 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 674 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 675 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 676 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 677 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 678 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 679 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 680 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 681 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 682 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 683 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 684 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 685 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 686 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 687 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 688 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 689 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 690 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 691 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 692 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 693 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 694 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 695 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 696 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 697 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 698 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 699 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 700 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 701 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 702 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 703 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 704 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 705 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 706 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 707 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 708 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 709 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 710 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 711 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 712 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 713 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 714 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 715 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 716 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 717 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 718 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 719 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 720 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 721 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 722 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 723 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 724 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 725 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 726 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 727 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 728 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 729 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 730 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 731 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 732 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 733 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 734 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 735 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 736 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 737 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 738 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 739 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 740 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 741 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 742 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 743 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 744 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 745 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 746 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 747 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 748 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 749 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 750 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 751 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 752 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 753 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 754 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 755 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.25 |
| Metatranscriptomes | 0.32 |
| Isolates | 60.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 16.9 |
| Nodule | 45.99 |
| Rhizoplane | 1.28 |
| Rhizosphere | 17.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496125_0000953 | 3300048928 | Bacteria | 45480 |
| 2 | JGI24740J21852_10001389 | 3300001979 | Bacteria | 11052 |
| 3 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 4 | JGI25156J39149_1000030 | 3300002705 | Bacteria | 126029 |
| 5 | JGI25154J39366_1000289 | 3300002738 | Bacteria | 30213 |
| 6 | JGI25158J39367_1000167 | 3300002739 | Bacteria | 15671 |
| 7 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 8 | JGI25152J39213_1008181 | 3300002773 | Bacteria | 2621 |
| 9 | JGI25159J45721_1000029 | 3300002987 | Bacteria | 105868 |
| 10 | JGI25159J45721_1001125 | 3300002987 | Bacteria | 11424 |
| 11 | JGI25159J45721_1001806 | 3300002987 | Bacteria | 8584 |
| 12 | JGI25151J46595_10003454 | 3300003187 | Bacteria | 8727 |
| 13 | JGI25151J46595_10004048 | 3300003187 | Bacteria | 7862 |
| 14 | JGI25151J46595_10005052 | 3300003187 | Bacteria | 6869 |
| 15 | JGI25151J46595_10005103 | 3300003187 | Bacteria | 6822 |
| 16 | JGI25165J46597_1006781 | 3300003214 | Bacteria | 1987 |
| 17 | JGI25153J46596_10004316 | 3300003215 | Bacteria | 7687 |
| 18 | JGI25153J46596_10011346 | 3300003215 | Bacteria | 3943 |
| 19 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 20 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 21 | JGI25160J50197_1000593 | 3300003354 | Bacteria | 20289 |
| 22 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 23 | JGI25161J50226_1001956 | 3300003374 | Bacteria | 5662 |
| 24 | JGI25161J50226_1002628 | 3300003374 | Bacteria | 4505 |
| 25 | Ga0006562J51391_1060468 | 3300003578 | Bacteria | 3100 |
| 26 | Ga0055526_1001995 | 3300003771 | Bacteria | 14058 |
| 27 | Ga0055526_1003733 | 3300003771 | Bacteria | 9506 |
| 28 | Ga0055526_1006958 | 3300003771 | Bacteria | 6004 |
| 29 | Ga0055526_1010214 | 3300003771 | Bacteria | 4395 |
| 30 | Ga0055526_1010394 | 3300003771 | Bacteria | 4335 |
| 31 | Ga0055526_1021566 | 3300003771 | Bacteria | 2234 |
| 32 | Ga0055524_1003862 | 3300003775 | Bacteria | 7107 |
| 33 | Ga0055524_1013014 | 3300003775 | Bacteria | 3162 |
| 34 | Ga0055524_1020480 | 3300003775 | Bacteria | 2226 |
| 35 | Ga0055524_1028237 | 3300003775 | Bacteria | 1685 |
| 36 | Ga0055536_1000356 | 3300003781 | Bacteria | 34069 |
| 37 | Ga0055528_1001267 | 3300003790 | Bacteria | 15948 |
| 38 | Ga0055528_1001601 | 3300003790 | Bacteria | 13382 |
| 39 | Ga0055528_1005825 | 3300003790 | Bacteria | 5664 |
| 40 | Ga0055528_1013134 | 3300003790 | Bacteria | 3162 |
| 41 | Ga0055528_1015466 | 3300003790 | Bacteria | 2754 |
| 42 | Ga0055540_1000177 | 3300003792 | Bacteria | 62976 |
| 43 | Ga0055531_10003828 | 3300003794 | Bacteria | 9428 |
| 44 | Ga0055531_10003846 | 3300003794 | Bacteria | 9402 |
| 45 | Ga0058692_1002330 | 3300003856 | Bacteria | 6416 |
| 46 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 47 | Ga0055543_1000097 | 3300004625 | Bacteria | 75364 |
| 48 | Ga0055543_1000255 | 3300004625 | Bacteria | 40071 |
| 49 | Ga0055543_1001144 | 3300004625 | Bacteria | 11331 |
| 50 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 51 | Ga0065165_1023781 | 3300005262 | Bacteria | 2070 |
| 52 | Ga0070658_10212360 | 3300005327 | Bacteria | 1635 |
| 53 | Ga0070670_100000535 | 3300005331 | Bacteria | 30434 |
| 54 | Ga0070670_100065176 | 3300005331 | Bacteria | 3126 |
| 55 | Ga0070671_100033264 | 3300005355 | Bacteria | 4263 |
| 56 | Ga0070665_100107355 | 3300005548 | Bacteria | 2794 |
| 57 | Ga0068855_100109341 | 3300005563 | Bacteria | 3175 |
| 58 | Ga0068856_100032523 | 3300005614 | Bacteria | 5106 |
| 59 | Ga0075365_10005053 | 3300006038 | Bacteria | 7078 |
| 60 | Ga0075365_10012329 | 3300006038 | Bacteria | 5071 |
| 61 | Ga0075368_10002095 | 3300006042 | Bacteria | 6447 |
| 62 | Ga0075364_10000043 | 3300006051 | Bacteria | 44079 |
| 63 | Ga0075364_10129542 | 3300006051 | Bacteria | 1693 |
| 64 | Ga0075362_10011839 | 3300006177 | Bacteria | 3446 |
| 65 | Ga0075362_10012116 | 3300006177 | Bacteria | 3416 |
| 66 | Ga0075367_10032147 | 3300006178 | Bacteria | 3017 |
| 67 | Ga0075369_10009230 | 3300006186 | Bacteria | 3825 |
| 68 | Ga0075366_10021694 | 3300006195 | Bacteria | 3734 |
| 69 | Ga0075370_10001750 | 3300006353 | Bacteria | 9672 |
| 70 | Ga0079104_1000022 | 3300006946 | Bacteria | 223522 |
| 71 | Ga0079104_1001402 | 3300006946 | Bacteria | 16290 |
| 72 | Ga0099826_10000090 | 3300006948 | Bacteria | 44830 |
| 73 | Ga0099826_10004510 | 3300006948 | Bacteria | 9777 |
| 74 | Ga0105251_10020317 | 3300009011 | Bacteria | 3491 |
| 75 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 76 | Ga0105243_10089667 | 3300009148 | Bacteria | 2529 |
| 77 | Ga0105237_10000773 | 3300009545 | Bacteria | 43739 |
| 78 | Ga0123341_1000049 | 3300009765 | Bacteria | 49561 |
| 79 | Ga0105239_10004008 | 3300010375 | Bacteria | 17836 |
| 80 | Ga0157373_10002285 | 3300013100 | Bacteria | 14521 |
| 81 | Ga0157373_10131447 | 3300013100 | Bacteria | 1760 |
| 82 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 83 | Ga0157371_10005986 | 3300013102 | Bacteria | 10143 |
| 84 | Ga0157370_10000992 | 3300013104 | Bacteria | 35815 |
| 85 | Ga0157370_10003013 | 3300013104 | Bacteria | 20000 |
| 86 | Ga0157370_10017734 | 3300013104 | Bacteria | 7177 |
| 87 | Ga0157369_10050141 | 3300013105 | Bacteria | 4522 |
| 88 | Ga0157369_10145335 | 3300013105 | Bacteria | 2508 |
| 89 | Ga0171463_1008 | 3300013249 | Bacteria | 299022 |
| 90 | Ga0182007_10000618 | 3300015262 | Bacteria | 20687 |
| 91 | Ga0182005_1018412 | 3300015265 | Bacteria | 1930 |
| 92 | Ga0183363_1281 | 3300015690 | Bacteria | 7689 |
| 93 | Ga0214544_1000129 | 3300021320 | Bacteria | 108948 |
| 94 | Ga0214542_1000828 | 3300021321 | Bacteria | 59640 |
| 95 | Ga0214542_1027439 | 3300021321 | Bacteria | 2608 |
| 96 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 97 | Ga0214543_1000134 | 3300021327 | Bacteria | 102056 |
| 98 | Ga0213872_10022695 | 3300021361 | Bacteria | 2888 |
| 99 | Ga0228711_1002680 | 3300022739 | Bacteria | 27471 |
| 100 | Ga0228710_1002851 | 3300022740 | Bacteria | 27471 |
| 101 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 102 | Ga0209436_100507 | 3300025208 | Bacteria | 17013 |
| 103 | Ga0209437_100122 | 3300025233 | Bacteria | 201364 |
| 104 | Ga0209437_100160 | 3300025233 | Bacteria | 149451 |
| 105 | Ga0207425_1008820 | 3300025245 | Bacteria | 2549 |
| 106 | Ga0207425_1009643 | 3300025245 | Bacteria | 2391 |
| 107 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 108 | Ga0209646_1003812 | 3300025246 | Bacteria | 2878 |
| 109 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 110 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 111 | Ga0209129_1000127 | 3300025258 | Bacteria | 133263 |
| 112 | Ga0209129_1001042 | 3300025258 | Bacteria | 16374 |
| 113 | Ga0209129_1001442 | 3300025258 | Bacteria | 13289 |
| 114 | Ga0209129_1002372 | 3300025258 | Bacteria | 9286 |
| 115 | Ga0209129_1012798 | 3300025258 | Bacteria | 1892 |
| 116 | Ga0209129_1012818 | 3300025258 | Bacteria | 1889 |
| 117 | Ga0209233_1000168 | 3300025261 | Bacteria | 149312 |
| 118 | Ga0209233_1000170 | 3300025261 | Bacteria | 147527 |
| 119 | Ga0209233_1001127 | 3300025261 | Bacteria | 10903 |
| 120 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 121 | Ga0209673_1001327 | 3300025273 | Bacteria | 24841 |
| 122 | Ga0209673_1002230 | 3300025273 | Bacteria | 14043 |
| 123 | Ga0209673_1003846 | 3300025273 | Bacteria | 8482 |
| 124 | Ga0209673_1004486 | 3300025273 | Bacteria | 7455 |
| 125 | Ga0209673_1004582 | 3300025273 | Bacteria | 7327 |
| 126 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 127 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 128 | Ga0209130_1000097 | 3300025284 | Bacteria | 143750 |
| 129 | Ga0209130_1008169 | 3300025284 | Bacteria | 3122 |
| 130 | Ga0209676_1000438 | 3300025292 | Bacteria | 71339 |
| 131 | Ga0209676_1007877 | 3300025292 | Bacteria | 4893 |
| 132 | Ga0209676_1016797 | 3300025292 | Bacteria | 2623 |
| 133 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 134 | Ga0209025_1000563 | 3300025294 | Bacteria | 68086 |
| 135 | Ga0209025_1001678 | 3300025294 | Bacteria | 27100 |
| 136 | Ga0209025_1001703 | 3300025294 | Bacteria | 26799 |
| 137 | Ga0209025_1003459 | 3300025294 | Bacteria | 14911 |
| 138 | Ga0209025_1010390 | 3300025294 | Bacteria | 6311 |
| 139 | Ga0209564_1000105 | 3300025295 | Bacteria | 218124 |
| 140 | Ga0209564_1000275 | 3300025295 | Bacteria | 107884 |
| 141 | Ga0209564_1000986 | 3300025295 | Bacteria | 35645 |
| 142 | Ga0209564_1001528 | 3300025295 | Bacteria | 22999 |
| 143 | Ga0209564_1001611 | 3300025295 | Bacteria | 21903 |
| 144 | Ga0209564_1022689 | 3300025295 | Bacteria | 2207 |
| 145 | Ga0209758_1000505 | 3300025297 | Bacteria | 63185 |
| 146 | Ga0209758_1000534 | 3300025297 | Bacteria | 60556 |
| 147 | Ga0209758_1000805 | 3300025297 | Bacteria | 44274 |
| 148 | Ga0209758_1001745 | 3300025297 | Bacteria | 24202 |
| 149 | Ga0209758_1003872 | 3300025297 | Bacteria | 13105 |
| 150 | Ga0209758_1007599 | 3300025297 | Bacteria | 7316 |
| 151 | Ga0209758_1020108 | 3300025297 | Bacteria | 3178 |
| 152 | Ga0209050_1000516 | 3300025298 | Bacteria | 64933 |
| 153 | Ga0209050_1004356 | 3300025298 | Bacteria | 9613 |
| 154 | Ga0209256_1001255 | 3300025299 | Bacteria | 27934 |
| 155 | Ga0209256_1001768 | 3300025299 | Bacteria | 20511 |
| 156 | Ga0209256_1002167 | 3300025299 | Bacteria | 16908 |
| 157 | Ga0209256_1003073 | 3300025299 | Bacteria | 12267 |
| 158 | Ga0209256_1008787 | 3300025299 | Bacteria | 4594 |
| 159 | Ga0209256_1009219 | 3300025299 | Bacteria | 4372 |
| 160 | Ga0209256_1042308 | 3300025299 | Bacteria | 1151 |
| 161 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 162 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 163 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 164 | Ga0207426_1000290 | 3300025302 | Bacteria | 99519 |
| 165 | Ga0207426_1000408 | 3300025302 | Bacteria | 72326 |
| 166 | Ga0209051_1000125 | 3300025303 | Bacteria | 142863 |
| 167 | Ga0209051_1003377 | 3300025303 | Bacteria | 10501 |
| 168 | Ga0209051_1004697 | 3300025303 | Bacteria | 8308 |
| 169 | Ga0209051_1036652 | 3300025303 | Bacteria | 1808 |
| 170 | Ga0209051_1039840 | 3300025303 | Bacteria | 1691 |
| 171 | Ga0209257_1009229 | 3300025304 | Bacteria | 5347 |
| 172 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 173 | Ga0207671_10004599 | 3300025914 | Bacteria | 13104 |
| 174 | Ga0207650_10014417 | 3300025925 | Bacteria | 5494 |
| 175 | Ga0207650_10118692 | 3300025925 | Bacteria | 2057 |
| 176 | Ga0207678_10064346 | 3300026067 | Bacteria | 3151 |
| 177 | Ga0207702_10009685 | 3300026078 | Bacteria | 8090 |
| 178 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 179 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 180 | Ga0209281_1000508 | 3300027111 | Bacteria | 51432 |
| 181 | Ga0209281_1004020 | 3300027111 | Bacteria | 4553 |
| 182 | Ga0209371_1000178 | 3300027312 | Bacteria | 93894 |
| 183 | Ga0209371_1000382 | 3300027312 | Bacteria | 47344 |
| 184 | Ga0209282_1000116 | 3300027666 | Bacteria | 51432 |
| 185 | Ga0209282_1000235 | 3300027666 | Bacteria | 28597 |
| 186 | Ga0209282_1075229 | 3300027666 | Bacteria | 1823 |
| 187 | Ga0268266_10059721 | 3300028379 | Bacteria | 3285 |
| 188 | Ga0268266_10076615 | 3300028379 | Bacteria | 2907 |
| 189 | Ga0268265_10077564 | 3300028380 | Bacteria | 2610 |
| 190 | Ga0265318_10031724 | 3300028577 | Bacteria | 2048 |
| 191 | Ga0307515_10000233 | 3300028794 | Bacteria | 137311 |
| 192 | Ga0307515_10000569 | 3300028794 | Bacteria | 87068 |
| 193 | Ga0307515_10013071 | 3300028794 | Bacteria | 15547 |
| 194 | Ga0307515_10095379 | 3300028794 | Bacteria | 3662 |
| 195 | Ga0268256_1000251 | 3300030500 | Bacteria | 56750 |
| 196 | Ga0268256_1006569 | 3300030500 | Bacteria | 4299 |
| 197 | Ga0265331_10001061 | 3300031250 | Bacteria | 21420 |
| 198 | Ga0307513_10000588 | 3300031456 | Bacteria | 52189 |
| 199 | Ga0307513_10021520 | 3300031456 | Bacteria | 7611 |
| 200 | Ga0307408_100129754 | 3300031548 | Bacteria | 1965 |
| 201 | Ga0265314_10091276 | 3300031711 | Bacteria | 1983 |
| 202 | Ga0307405_10026000 | 3300031731 | Bacteria | 3370 |
| 203 | Ga0307406_10006937 | 3300031901 | Bacteria | 6274 |
| 204 | Ga0307412_10000449 | 3300031911 | Bacteria | 24913 |
| 205 | Ga0315914_1002646 | 3300031967 | Bacteria | 27416 |
| 206 | Ga0316593_10020427 | 3300032168 | Bacteria | 2059 |
| 207 | Ga0315913_1001232 | 3300033430 | Bacteria | 27471 |
| 208 | Ga0315915_1000058 | 3300033464 | Bacteria | 72461 |
| 209 | Ga0373935_0084405 | 3300035692 | Bacteria | 2069 |
| 210 | Ga0373927_0002488 | 3300035695 | Bacteria | 13446 |
| 211 | Ga0316584_0168452 | 3300036712 | Bacteria | 1626 |
| 212 | Ga0373925_0001826 | 3300037068 | Bacteria | 17766 |
| 213 | Ga0395905_0000386 | 3300037471 | Bacteria | 62786 |
| 214 | Ga0395905_0011890 | 3300037471 | Bacteria | 8400 |
| 215 | Ga0436361_0388638 | 3300039447 | Bacteria | 3153 |
| 216 | Ga0439436_0020716 | 3300041404 | Bacteria | 1957 |
| 217 | Ga0439465_0002627 | 3300041413 | Bacteria | 5866 |
| 218 | Ga0439465_0012232 | 3300041413 | Bacteria | 2686 |
| 219 | Ga0451833_0326332 | 3300041491 | Bacteria | 2197 |
| 220 | Ga0451839_0624369 | 3300041496 | Bacteria | 1354 |
| 221 | Ga0451839_1171986 | 3300041496 | Bacteria | 5799 |
| 222 | Ga0451845_0406102 | 3300041501 | Bacteria | 4920 |
| 223 | Ga0451849_1391146 | 3300041505 | Bacteria | 4223 |
| 224 | Ga0451851_0083156 | 3300041507 | Bacteria | 1585 |
| 225 | Ga0451851_0085829 | 3300041507 | Bacteria | 2107 |
| 226 | Ga0451851_1152225 | 3300041507 | Bacteria | 1972 |
| 227 | Ga0451843_0892284 | 3300041509 | Bacteria | 2229 |
| 228 | Ga0439442_022028 | 3300042002 | Bacteria | 1322 |
| 229 | Ga0439449_0005586 | 3300042007 | Bacteria | 4813 |
| 230 | Ga0439449_0041569 | 3300042007 | Bacteria | 1709 |
| 231 | Ga0439462_0019440 | 3300042015 | Bacteria | 1768 |
| 232 | Ga0466968_0033665 | 3300044735 | Bacteria | 2136 |
| 233 | Ga0495638_0001886 | 3300046460 | Bacteria | 18129 |
| 234 | Ga0495638_0034607 | 3300046460 | Bacteria | 3225 |
| 235 | Ga0495662_0037834 | 3300046476 | Bacteria | 2331 |
| 236 | Ga0495585_0066062 | 3300046492 | Bacteria | 1981 |
| 237 | Ga0495585_0106093 | 3300046492 | Bacteria | 1498 |
| 238 | Ga0495607_0127700 | 3300046501 | Bacteria | 1327 |
| 239 | Ga0495583_0051972 | 3300046506 | Bacteria | 1866 |
| 240 | Ga0495583_0076388 | 3300046506 | Bacteria | 1463 |
| 241 | Ga0495606_0002073 | 3300046507 | Bacteria | 24490 |
| 242 | Ga0495606_0029987 | 3300046507 | Bacteria | 3809 |
| 243 | Ga0495620_0028632 | 3300046515 | Bacteria | 2588 |
| 244 | Ga0495628_0059749 | 3300046516 | Bacteria | 2992 |
| 245 | Ga0495631_0080968 | 3300046518 | Bacteria | 1401 |
| 246 | Ga0495632_0050841 | 3300046519 | Bacteria | 2042 |
| 247 | Ga0495643_0027844 | 3300046522 | Bacteria | 3172 |
| 248 | Ga0495643_0078683 | 3300046522 | Bacteria | 1720 |
| 249 | Ga0495654_0003690 | 3300046530 | Bacteria | 9293 |
| 250 | Ga0495622_0046432 | 3300046557 | Bacteria | 2018 |
| 251 | Ga0495633_0001025 | 3300046558 | Bacteria | 22844 |
| 252 | Ga0495668_0006310 | 3300046616 | Bacteria | 7806 |
| 253 | Ga0495611_0041726 | 3300046648 | Bacteria | 2047 |
| 254 | Ga0495625_0038361 | 3300046660 | Bacteria | 3508 |
| 255 | Ga0495625_0119427 | 3300046660 | Bacteria | 1795 |
| 256 | Ga0495625_0185123 | 3300046660 | Bacteria | 1382 |
| 257 | Ga0495635_0142511 | 3300046663 | Bacteria | 1632 |
| 258 | Ga0495588_0020089 | 3300046674 | Bacteria | 3277 |
| 259 | Ga0495658_0054226 | 3300046683 | Bacteria | 2280 |
| 260 | Ga0495613_0003033 | 3300046689 | Bacteria | 12563 |
| 261 | Ga0495649_0103253 | 3300046694 | Bacteria | 1514 |
| 262 | Ga0495660_0071744 | 3300046810 | Bacteria | 1835 |
| 263 | Ga0495604_0013679 | 3300047317 | Bacteria | 6471 |
| 264 | Ga0495687_068952 | 3300047443 | Bacteria | 1426 |
| 265 | Ga0495681_0077664 | 3300047470 | Bacteria | 1489 |
| 266 | Ga0495686_0002178 | 3300047472 | Bacteria | 19063 |
| 267 | Ga0495686_0005411 | 3300047472 | Bacteria | 10084 |
| 268 | Ga0496106_0000478 | 3300048909 | Bacteria | 28406 |
| 269 | Ga0496111_0003975 | 3300048914 | Bacteria | 9283 |
| 270 | Ga0496114_0335013 | 3300048917 | Bacteria | 1338 |
| 271 | Ga0496116_0000232 | 3300048919 | Bacteria | 103015 |
| 272 | Ga0496116_0019844 | 3300048919 | Bacteria | 5131 |
| 273 | Ga0496116_0083325 | 3300048919 | Bacteria | 1975 |
| 274 | Ga0496116_0097864 | 3300048919 | Bacteria | 1762 |
| 275 | Ga0496116_0101076 | 3300048919 | Bacteria | 1722 |
| 276 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 277 | Ga0496117_0002298 | 3300048920 | Bacteria | 24600 |
| 278 | Ga0496117_0011144 | 3300048920 | Bacteria | 8082 |
| 279 | Ga0496118_0000460 | 3300048921 | Bacteria | 67445 |
| 280 | Ga0496118_0003956 | 3300048921 | Bacteria | 18115 |
| 281 | Ga0496118_0020559 | 3300048921 | Bacteria | 5850 |
| 282 | Ga0496118_0071214 | 3300048921 | Bacteria | 2504 |
| 283 | Ga0496118_0109262 | 3300048921 | Bacteria | 1841 |
| 284 | Ga0496119_0012076 | 3300048922 | Bacteria | 7058 |
| 285 | Ga0496119_0012145 | 3300048922 | Bacteria | 7030 |
| 286 | Ga0496119_0023760 | 3300048922 | Bacteria | 4335 |
| 287 | Ga0496119_0047784 | 3300048922 | Bacteria | 2659 |
| 288 | Ga0496120_0000078 | 3300048923 | Bacteria | 162312 |
| 289 | Ga0496120_0006355 | 3300048923 | Bacteria | 9088 |
| 290 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 291 | Ga0496121_0002309 | 3300048924 | Bacteria | 29564 |
| 292 | Ga0496121_0005949 | 3300048924 | Bacteria | 15422 |
| 293 | Ga0496121_0009598 | 3300048924 | Bacteria | 11087 |
| 294 | Ga0496121_0010507 | 3300048924 | Bacteria | 10428 |
| 295 | Ga0496121_0081738 | 3300048924 | Bacteria | 2556 |
| 296 | Ga0496121_0087328 | 3300048924 | Bacteria | 2448 |
| 297 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 298 | Ga0496122_0006684 | 3300048925 | Bacteria | 13133 |
| 299 | Ga0496122_0011586 | 3300048925 | Bacteria | 8900 |
| 300 | Ga0496122_0012223 | 3300048925 | Bacteria | 8585 |
| 301 | Ga0496122_0052212 | 3300048925 | Bacteria | 3097 |
| 302 | Ga0496122_0100963 | 3300048925 | Bacteria | 1929 |
| 303 | Ga0496122_0113931 | 3300048925 | Bacteria | 1765 |
| 304 | Ga0496122_0118521 | 3300048925 | Bacteria | 1715 |
| 305 | Ga0496122_0124634 | 3300048925 | Bacteria | 1652 |
| 306 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 307 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 308 | Ga0496123_0000512 | 3300048926 | Bacteria | 67458 |
| 309 | Ga0496123_0005232 | 3300048926 | Bacteria | 13181 |
| 310 | Ga0496123_0050289 | 3300048926 | Bacteria | 2786 |
| 311 | Ga0496123_0076430 | 3300048926 | Bacteria | 2061 |
| 312 | Ga0496123_0076538 | 3300048926 | Bacteria | 2059 |
| 313 | Ga0496124_0000377 | 3300048927 | Bacteria | 81321 |
| 314 | Ga0496124_0004853 | 3300048927 | Bacteria | 15467 |
| 315 | Ga0496124_0014237 | 3300048927 | Bacteria | 7705 |
| 316 | Ga0496124_0093699 | 3300048927 | Bacteria | 2444 |
| 317 | Ga0496124_0127798 | 3300048927 | Bacteria | 2023 |
| 318 | Ga0496124_0231886 | 3300048927 | Bacteria | 1379 |
| 319 | Ga0496125_0000155 | 3300048928 | Bacteria | 151541 |
| 320 | Ga0496125_0053841 | 3300048928 | Bacteria | 3294 |
| 321 | Ga0496126_0001369 | 3300048929 | Bacteria | 38538 |
| 322 | Ga0496126_0052656 | 3300048929 | Bacteria | 3698 |
| 323 | Ga0496126_0230043 | 3300048929 | Bacteria | 1553 |
| 324 | Ga0501034_0254277 | 3300049571 | Bacteria | 1701 |
| 325 | Ga0501036_0201895 | 3300049572 | Bacteria | 1672 |
| 326 | Ga0501037_0154721 | 3300049573 | Bacteria | 1637 |
| 327 | Ga0501070_0084565 | 3300049586 | Bacteria | 2626 |
| 328 | Ga0501073_0017851 | 3300049589 | Bacteria | 5136 |
| 329 | Ga0501035_0029163 | 3300049822 | Bacteria | 5032 |
| 330 | Ga0501035_0208503 | 3300049822 | Bacteria | 1673 |
| 331 | Ga0501035_0348446 | 3300049822 | Bacteria | 1240 |
| 332 | nmdc:mga03683_3419_c1 | 3300050489 | Bacteria | 5117 |
| 333 | nmdc:mga03n38_26274_c1 | 3300050490 | Bacteria | 2403 |
| 334 | nmdc:mga00v17_203_c1 | 3300050491 | Bacteria | 35824 |
| 335 | nmdc:mga00v17_3726_c1 | 3300050491 | Bacteria | 7867 |
| 336 | nmdc:mga00v17_68969_c1 | 3300050491 | Bacteria | 2187 |
| 337 | nmdc:mga0yw44_697_c1 | 3300050492 | Bacteria | 12311 |
| 338 | nmdc:mga0yw44_95712_c1 | 3300050492 | Bacteria | 1884 |
| 339 | nmdc:mga0k408_112515_c1 | 3300050493 | Bacteria | 1610 |
| 340 | nmdc:mga0k408_25595_c1 | 3300050493 | Bacteria | 3342 |
| 341 | nmdc:mga0sz30_14502_c1 | 3300050516 | Bacteria | 3104 |
| 342 | nmdc:mga0sz30_16497_c1 | 3300050516 | Bacteria | 2935 |
| 343 | nmdc:mga0sz30_4182_c1 | 3300050516 | Bacteria | 5200 |
| 344 | Ga0500643_023318 | 3300053087 | Bacteria | 1978 |
| 345 | Ga0500556_0081163 | 3300053104 | Bacteria | 1226 |
| 346 | Ga0500560_001846 | 3300053107 | Bacteria | 3841 |
| 347 | Ga0500572_000849 | 3300053111 | Bacteria | 9526 |
| 348 | Ga0500572_003892 | 3300053111 | Bacteria | 3396 |
| 349 | Ga0500618_002786 | 3300053125 | Bacteria | 6338 |
| 350 | Ga0500618_009375 | 3300053125 | Bacteria | 2674 |
| 351 | Ga0500618_018902 | 3300053125 | Bacteria | 1700 |
| 352 | Ga0500658_0000485 | 3300053134 | Bacteria | 17014 |
| 353 | Ga0500658_0012162 | 3300053134 | Bacteria | 3170 |
| 354 | Ga0500559_0062107 | 3300053136 | Bacteria | 1667 |
| 355 | Ga0500561_0002360 | 3300053137 | Bacteria | 3169 |
| 356 | Ga0500568_0003249 | 3300053139 | Bacteria | 9186 |
| 357 | Ga0500577_0078061 | 3300053142 | Bacteria | 1314 |
| 358 | Ga0500616_0002587 | 3300053153 | Bacteria | 14874 |
| 359 | Ga0500616_0011140 | 3300053153 | Bacteria | 5338 |
| 360 | Ga0500622_0000378 | 3300053156 | Bacteria | 42912 |
| 361 | Ga0500622_0000778 | 3300053156 | Bacteria | 27680 |
| 362 | Ga0500622_0039798 | 3300053156 | Bacteria | 2451 |
| 363 | Ga0500622_0124327 | 3300053156 | Bacteria | 1247 |
| 364 | Ga0500624_001373 | 3300053157 | Bacteria | 4077 |
| 365 | Ga0500634_0010832 | 3300053161 | Bacteria | 4674 |
| 366 | Ga0500636_0000123 | 3300053177 | Bacteria | 40230 |
| 367 | Ga0500636_0001081 | 3300053177 | Bacteria | 14582 |
| 368 | Ga0500636_0059250 | 3300053177 | Bacteria | 2238 |
| 369 | Ga0500645_000972 | 3300053730 | Bacteria | 16288 |
| 370 | Ga0587090_000719 | 3300059510 | Bacteria | 2967 |
| 371 | 2509107650 | 2508501122 | Bacteria | 6292184 |
| 372 | 2509375988 | 2509276019 | Bacteria | 6802256 |
| 373 | 2509386920 | 2509276021 | Bacteria | 7634384 |
| 374 | 2509442448 | 2509276033 | Bacteria | 7180565 |
| 375 | 2510133052 | 2510065019 | Bacteria | 6903379 |
| 376 | 2510308661 | 2510065057 | Bacteria | 6649661 |
| 377 | 2510843005 | 2510461069 | Bacteria | 5505000 |
| 378 | 2510899441 | 2510461076 | Bacteria | 8618824 |
| 379 | 2511134929 | 2510917022 | Bacteria | 6504556 |
| 380 | 2511172608 | 2510917026 | Bacteria | 7046020 |
| 381 | 2511183744 | 2510917028 | Bacteria | 6185411 |
| 382 | 2511193389 | 2510917030 | Bacteria | 7460662 |
| 383 | 2511501507 | 2511231052 | Bacteria | 6974333 |
| 384 | 2512532933 | 2512047086 | Bacteria | 6850303 |
| 385 | 2512971740 | 2512875026 | Bacteria | 6861065 |
| 386 | 2513569867 | 2513237084 | Bacteria | 7231967 |
| 387 | 2513575135 | 2513237085 | Bacteria | 7695351 |
| 388 | 2513588110 | 2513237086 | Bacteria | 7265287 |
| 389 | 2513594390 | 2513237088 | Bacteria | 6927906 |
| 390 | 2513605270 | 2513237089 | Bacteria | 6553624 |
| 391 | 2513618701 | 2513237091 | Bacteria | 6900273 |
| 392 | 2513635602 | 2513237093 | Bacteria | 7545552 |
| 393 | 2513713454 | 2513237103 | Bacteria | 7647401 |
| 394 | 2513866995 | 2513237138 | Bacteria | 7368160 |
| 395 | 2513886969 | 2513237140 | Bacteria | 7076289 |
| 396 | 2513907204 | 2513237143 | Bacteria | 6664116 |
| 397 | 2513909862 | 2513237144 | Bacteria | 7530820 |
| 398 | 2513926641 | 2513237146 | Bacteria | 7166346 |
| 399 | 2513987068 | 2513237156 | Bacteria | 6402557 |
| 400 | 2513997346 | 2513237159 | Bacteria | 6810126 |
| 401 | 2514005288 | 2513237160 | Bacteria | 6650282 |
| 402 | 2514021856 | 2513237162 | Bacteria | 7468464 |
| 403 | 2515112002 | 2515075009 | Bacteria | 7288508 |
| 404 | 2515611352 | 2515154107 | Bacteria | 6795637 |
| 405 | 2515633798 | 2515154113 | Bacteria | 7807172 |
| 406 | 2515645037 | 2515154114 | Bacteria | 7848616 |
| 407 | 2515660179 | 2515154116 | Bacteria | 7552979 |
| 408 | 2515738816 | 2515154134 | Bacteria | 7220242 |
| 409 | 2516209510 | 2516143018 | Bacteria | 6951533 |
| 410 | 2516892825 | 2516653046 | Bacteria | 6989037 |
| 411 | 2517035738 | 2516653077 | Bacteria | 7555578 |
| 412 | 2517076162 | 2516653085 | Bacteria | 7346596 |
| 413 | 2517094906 | 2517093000 | Bacteria | 7412387 |
| 414 | 2517406535 | 2517287029 | Bacteria | 6905599 |
| 415 | 2517569600 | 2517487022 | Bacteria | 7227575 |
| 416 | 2524453661 | 2524023207 | Bacteria | 6813453 |
| 417 | 2524460459 | 2524023209 | Bacteria | 6679728 |
| 418 | 2530645302 | 2529292951 | Bacteria | 6916614 |
| 419 | 2535484818 | 2534681786 | Bacteria | 3308809 |
| 420 | 2535516275 | 2534681796 | Bacteria | 7146037 |
| 421 | 2537877784 | 2537561587 | Bacteria | 5425293 |
| 422 | 2551674252 | 2551306084 | Bacteria | 8942552 |
| 423 | 2551680404 | 2551306084 | Bacteria | 8942552 |
| 424 | 2551686544 | 2551306085 | Bacteria | 7347181 |
| 425 | 2551691823 | 2551306086 | Bacteria | 6843938 |
| 426 | 2551699773 | 2551306087 | Bacteria | 7351905 |
| 427 | 2551711741 | 2551306089 | Bacteria | 7162724 |
| 428 | 2551719508 | 2551306090 | Bacteria | 7953713 |
| 429 | 2551729148 | 2551306091 | Bacteria | 7086830 |
| 430 | 2551737098 | 2551306092 | Bacteria | 6992595 |
| 431 | 2551742525 | 2551306093 | Bacteria | 7064773 |
| 432 | 2554247754 | 2554235003 | Bacteria | 5877155 |
| 433 | 2558868261 | 2558860100 | Bacteria | 8458965 |
| 434 | 2559294887 | 2558860242 | Bacteria | 5568029 |
| 435 | 2561466505 | 2558860983 | Bacteria | 4133860 |
| 436 | 2585168470 | 2582581283 | Bacteria | 6030556 |
| 437 | 2585199960 | 2582581294 | Bacteria | 6626667 |
| 438 | 2585225792 | 2582581298 | Bacteria | 7315509 |
| 439 | 2585233553 | 2582581299 | Bacteria | 6518058 |
| 440 | 2585254507 | 2582581304 | Bacteria | 5831370 |
| 441 | 2585270044 | 2582581306 | Bacteria | 6450535 |
| 442 | 2585270669 | 2582581307 | Bacteria | 6597605 |
| 443 | 2585277010 | 2582581308 | Bacteria | 7413247 |
| 444 | 2585323984 | 2582581315 | Bacteria | 7318924 |
| 445 | 2585333619 | 2582581316 | Bacteria | 7774528 |
| 446 | 2585389749 | 2582581865 | Bacteria | 6644329 |
| 447 | 2585393716 | 2582581866 | Bacteria | 6859583 |
| 448 | 2585403453 | 2582581867 | Bacteria | 7184437 |
| 449 | 2585528318 | 2585427526 | Bacteria | 7258840 |
| 450 | 2585537020 | 2585427527 | Bacteria | 7273426 |
| 451 | 2585540495 | 2585427528 | Bacteria | 6842387 |
| 452 | 2585546752 | 2585427529 | Bacteria | 7395659 |
| 453 | 2585551871 | 2585427530 | Bacteria | 7383882 |
| 454 | 2585558372 | 2585427531 | Bacteria | 6992870 |
| 455 | 2585819579 | 2585427590 | Bacteria | 6824633 |
| 456 | 2585838711 | 2585427593 | Bacteria | 7141551 |
| 457 | 2585846561 | 2585427594 | Bacteria | 6180594 |
| 458 | 2585897767 | 2585427608 | Bacteria | 6544331 |
| 459 | 2585904639 | 2585427609 | Bacteria | 6667127 |
| 460 | 2585995875 | 2585427633 | Bacteria | 6413184 |
| 461 | 2586000440 | 2585427634 | Bacteria | 6455027 |
| 462 | 2587980245 | 2585428125 | Bacteria | 6662905 |
| 463 | 2599336303 | 2599185156 | Bacteria | 5403036 |
| 464 | 2599417930 | 2599185170 | Bacteria | 7295545 |
| 465 | 2599604148 | 2599185210 | Bacteria | 5624189 |
| 466 | 2599721501 | 2599185236 | Bacteria | 6875203 |
| 467 | 2600197125 | 2599185352 | Bacteria | 7228948 |
| 468 | 2600375810 | 2600254933 | Bacteria | 4750527 |
| 469 | 2601608059 | 2600255279 | Bacteria | 5605316 |
| 470 | 2601744834 | 2600255308 | Bacteria | 5611129 |
| 471 | 2616292685 | 2615840624 | Bacteria | 6557588 |
| 472 | 2616308384 | 2615840626 | Bacteria | 7921970 |
| 473 | 2616556548 | 2615840698 | Bacteria | 7319877 |
| 474 | 2617385873 | 2617270742 | Bacteria | 6808054 |
| 475 | 2643808722 | 2643221557 | Bacteria | 7184309 |
| 476 | 2643811901 | 2643221558 | Bacteria | 5460675 |
| 477 | 2643857685 | 2643221568 | Bacteria | 5187270 |
| 478 | 2643919378 | 2643221582 | Bacteria | 5804683 |
| 479 | 2644001960 | 2643221598 | Bacteria | 4578346 |
| 480 | 2644005060 | 2643221599 | Bacteria | 6292121 |
| 481 | 2644049364 | 2643221607 | Bacteria | 6314006 |
| 482 | 2644066256 | 2643221610 | Bacteria | 7480339 |
| 483 | 2644107978 | 2643221618 | Bacteria | 7717186 |
| 484 | 2644148350 | 2643221626 | Bacteria | 8069654 |
| 485 | 2644192901 | 2643221634 | Bacteria | 6705461 |
| 486 | 2644204297 | 2643221636 | Bacteria | 6583769 |
| 487 | 2644210481 | 2643221637 | Bacteria | 5345260 |
| 488 | 2644239387 | 2643221643 | Bacteria | 5749658 |
| 489 | 2644309372 | 2643221655 | Bacteria | 7722067 |
| 490 | 2644333198 | 2643221659 | Bacteria | 7890716 |
| 491 | 2644377796 | 2643221668 | Bacteria | 7306521 |
| 492 | 2644415531 | 2643221675 | Bacteria | 7473456 |
| 493 | 2644450067 | 2643221680 | Bacteria | 7473610 |
| 494 | 2644482398 | 2643221686 | Bacteria | 6310811 |
| 495 | 2644494478 | 2643221688 | Bacteria | 5260751 |
| 496 | 2644502051 | 2643221689 | Bacteria | 6042950 |
| 497 | 2644522280 | 2643221693 | Bacteria | 5513853 |
| 498 | 2644545630 | 2643221698 | Bacteria | 7756764 |
| 499 | 2644615314 | 2643221712 | Bacteria | 7729434 |
| 500 | 2644654033 | 2643221718 | Bacteria | 5345506 |
| 501 | 2644658693 | 2643221719 | Bacteria | 4568197 |
| 502 | 2644673621 | 2643221723 | Bacteria | 7095460 |
| 503 | 2644687624 | 2643221726 | Bacteria | 7455827 |
| 504 | 2657683822 | 2657244999 | Bacteria | 5946535 |
| 505 | 2671115785 | 2667528174 | Bacteria | 6435400 |
| 506 | 2692316028 | 2690316117 | Bacteria | 6800650 |
| 507 | 2719180960 | 2718217882 | Bacteria | 6556348 |
| 508 | 2719385560 | 2718217927 | Bacteria | 6972593 |
| 509 | 2719665382 | 2718217997 | Bacteria | 6740740 |
| 510 | 2719731709 | 2718218009 | Bacteria | 6478651 |
| 511 | 2720491802 | 2718218199 | Bacteria | 6740745 |
| 512 | 2720613071 | 2718218232 | Bacteria | 6720332 |
| 513 | 2720619924 | 2718218233 | Bacteria | 6662049 |
| 514 | 2720631350 | 2718218235 | Bacteria | 6630699 |
| 515 | 2720775077 | 2718218269 | Bacteria | 6906114 |
| 516 | 2721147054 | 2718218363 | Bacteria | 6524337 |
| 517 | 2721158582 | 2718218365 | Bacteria | 6274507 |
| 518 | 2721163972 | 2718218366 | Bacteria | 6425255 |
| 519 | 2721399308 | 2718218423 | Bacteria | 6438183 |
| 520 | 2722840142 | 2721755514 | Bacteria | 6424414 |
| 521 | 2723026714 | 2721755556 | Bacteria | 6745503 |
| 522 | 2723560331 | 2721755684 | Bacteria | 6859907 |
| 523 | 2723566897 | 2721755685 | Bacteria | 6704835 |
| 524 | 2724038121 | 2721755809 | Bacteria | 6438790 |
| 525 | 2724044465 | 2721755810 | Bacteria | 6479005 |
| 526 | 2724089684 | 2721755819 | Bacteria | 6906405 |
| 527 | 2724104162 | 2721755822 | Bacteria | 6726041 |
| 528 | 2724109971 | 2721755823 | Bacteria | 6752556 |
| 529 | 2725948736 | 2724679232 | Bacteria | 7646494 |
| 530 | 2730107650 | 2728369352 | Bacteria | 6745171 |
| 531 | 2730164197 | 2728369365 | Bacteria | 6555560 |
| 532 | 2730298214 | 2728369397 | Bacteria | 6274511 |
| 533 | 2738801925 | 2738541293 | Bacteria | 7065685 |
| 534 | 2738945592 | 2738541317 | Bacteria | 5340176 |
| 535 | 2739037991 | 2738541333 | Bacteria | 7106503 |
| 536 | 2739307891 | 2738543024 | Bacteria | 5603683 |
| 537 | 2753359426 | 2751185800 | Bacteria | 5467370 |
| 538 | 2753458334 | 2751185821 | Bacteria | 6189929 |
| 539 | 2758641686 | 2758568016 | Bacteria | 5645291 |
| 540 | 2766062931 | 2765235942 | Bacteria | 7445910 |
| 541 | 2776913375 | 2775507049 | Bacteria | 6284736 |
| 542 | 2778176524 | 2775507266 | Bacteria | 7392367 |
| 543 | 2792580744 | 2791355082 | Bacteria | 5973319 |
| 544 | 2792619981 | 2791355091 | Bacteria | 6135441 |
| 545 | 2792626601 | 2791355092 | Bacteria | 6248105 |
| 546 | 2792639537 | 2791355094 | Bacteria | 7011481 |
| 547 | 2793279680 | 2791355253 | Bacteria | 5171699 |
| 548 | 2793298262 | 2791355256 | Bacteria | 6798008 |
| 549 | 2793313743 | 2791355259 | Bacteria | 7254731 |
| 550 | 2793324325 | 2791355260 | Bacteria | 6598818 |
| 551 | 2793326463 | 2791355261 | Bacteria | 6661293 |
| 552 | 2793337048 | 2791355262 | Bacteria | 6774204 |
| 553 | 2793341299 | 2791355263 | Bacteria | 6872478 |
| 554 | 2793347523 | 2791355264 | Bacteria | 6429314 |
| 555 | 2793352412 | 2791355265 | Bacteria | 6539969 |
| 556 | 2793361397 | 2791355266 | Bacteria | 7116587 |
| 557 | 2793369668 | 2791355267 | Bacteria | 7222458 |
| 558 | 2802718738 | 2802428858 | Bacteria | 6636079 |
| 559 | 2802726350 | 2802428859 | Bacteria | 6667919 |
| 560 | 2802732890 | 2802428860 | Bacteria | 6525526 |
| 561 | 2802738245 | 2802428861 | Bacteria | 6534206 |
| 562 | 2802744579 | 2802428862 | Bacteria | 6633353 |
| 563 | 2802751215 | 2802428863 | Bacteria | 6410669 |
| 564 | 2804752085 | 2802429268 | Bacteria | 6094027 |
| 565 | 2805927740 | 2802429605 | Bacteria | 6875453 |
| 566 | 2805935646 | 2802429606 | Bacteria | 6346811 |
| 567 | 2806045384 | 2802429633 | Bacteria | 7341974 |
| 568 | 2806055423 | 2802429634 | Bacteria | 7083200 |
| 569 | 2806061466 | 2802429635 | Bacteria | 7650140 |
| 570 | 2806068040 | 2802429636 | Bacteria | 7597525 |
| 571 | 2806072612 | 2802429637 | Bacteria | 7067217 |
| 572 | 2808985343 | 2808606387 | Bacteria | 5697198 |
| 573 | 2819241893 | 2818991272 | Bacteria | 4622173 |
| 574 | 2819559776 | 2818991439 | Bacteria | 6907412 |
| 575 | 2819610359 | 2818991448 | Bacteria | 6772224 |
| 576 | 2819638101 | 2818991453 | Bacteria | 7181617 |
| 577 | 2819684693 | 2818991461 | Bacteria | 7026071 |
| 578 | 2821127924 | 2821123053 | Bacteria | 7836056 |
| 579 | 2838021143 | 2838016132 | Bacteria | 6577831 |
| 580 | 2838025374 | 2838022645 | Bacteria | 6494267 |
| 581 | 2838035091 | 2838029111 | Bacteria | 6603031 |
| 582 | 2838041556 | 2838035591 | Bacteria | 7166484 |
| 583 | 2838043206 | 2838042994 | Bacteria | 6046894 |
| 584 | 2838054200 | 2838048938 | Bacteria | 6044578 |
| 585 | 2838067853 | 2838061910 | Bacteria | 6794874 |
| 586 | 2838071483 | 2838068647 | Bacteria | 6208656 |
| 587 | 2838078756 | 2838074704 | Bacteria | 6785777 |
| 588 | 2838666301 | 2838661181 | Bacteria | 7385261 |
| 589 | 2838670188 | 2838668709 | Bacteria | 6671819 |
| 590 | 2838676187 | 2838675328 | Bacteria | 4909118 |
| 591 | 2838682462 | 2838680041 | Bacteria | 6545511 |
| 592 | 2838689234 | 2838686498 | Bacteria | 7807632 |
| 593 | 2838697033 | 2838694306 | Bacteria | 6853137 |
| 594 | 2838702559 | 2838701080 | Bacteria | 6669771 |
| 595 | 2838709726 | 2838707686 | Bacteria | 6619912 |
| 596 | 2838715069 | 2838714209 | Bacteria | 5525906 |
| 597 | 2838721131 | 2838719591 | Bacteria | 5523910 |
| 598 | 2838725828 | 2838724970 | Bacteria | 4908691 |
| 599 | 2838730582 | 2838729681 | Bacteria | 7400765 |
| 600 | 2838738348 | 2838736955 | Bacteria | 5760694 |
| 601 | 2838743523 | 2838742623 | Bacteria | 7396178 |
| 602 | 2841841282 | 2841840854 | Bacteria | 5761912 |
| 603 | 2841848088 | 2841846520 | Bacteria | 5345850 |
| 604 | 2841854801 | 2841851746 | Bacteria | 7532261 |
| 605 | 2841859361 | 2841859092 | Bacteria | 5436171 |
| 606 | 2842077900 | 2842077413 | Bacteria | 6508645 |
| 607 | 2842110744 | 2842110456 | Bacteria | 7656360 |
| 608 | 2842119592 | 2842118031 | Bacteria | 7033875 |
| 609 | 2842125882 | 2842124991 | Bacteria | 5346824 |
| 610 | 2842131081 | 2842130223 | Bacteria | 4909145 |
| 611 | 2842141060 | 2842140634 | Bacteria | 5759631 |
| 612 | 2842146896 | 2842146304 | Bacteria | 5957337 |
| 613 | 2842153749 | 2842152218 | Bacteria | 4908957 |
| 614 | 2842157664 | 2842156927 | Bacteria | 6894975 |
| 615 | 2842164861 | 2842163707 | Bacteria | 6916235 |
| 616 | 2842171312 | 2842170452 | Bacteria | 5525737 |
| 617 | 2842177369 | 2842175837 | Bacteria | 4908771 |
| 618 | 2842180751 | 2842180545 | Bacteria | 6888678 |
| 619 | 2842188177 | 2842187318 | Bacteria | 5524014 |
| 620 | 2842196879 | 2842192696 | Bacteria | 6147454 |
| 621 | 2842200942 | 2842198810 | Bacteria | 6608673 |
| 622 | 2842206277 | 2842205361 | Bacteria | 6340321 |
| 623 | 2842212488 | 2842211629 | Bacteria | 5523832 |
| 624 | 2842222968 | 2842217011 | Bacteria | 7497767 |
| 625 | 2842225893 | 2842224351 | Bacteria | 5524473 |
| 626 | 2842231191 | 2842229732 | Bacteria | 7475766 |
| 627 | 2842239139 | 2842237096 | Bacteria | 6620661 |
| 628 | 2842244702 | 2842243621 | Bacteria | 7421798 |
| 629 | 2842251961 | 2842250916 | Bacteria | 6579627 |
| 630 | 2842258515 | 2842257432 | Bacteria | 7401195 |
| 631 | 2842268042 | 2842264693 | Bacteria | 6472963 |
| 632 | 2842273254 | 2842271015 | Bacteria | 7807131 |
| 633 | 2842279734 | 2842278818 | Bacteria | 6340002 |
| 634 | 2842287379 | 2842285085 | Bacteria | 6011953 |
| 635 | 2842291562 | 2842291075 | Bacteria | 7076806 |
| 636 | 2842301789 | 2842298080 | Bacteria | 6123127 |
| 637 | 2842310084 | 2842304105 | Bacteria | 7023636 |
| 638 | 2842313685 | 2842311132 | Bacteria | 6616990 |
| 639 | 2842318145 | 2842317721 | Bacteria | 6793725 |
| 640 | 2842347275 | 2842341865 | Bacteria | 7003929 |
| 641 | 2842357292 | 2842357229 | Bacteria | 6485165 |
| 642 | 2842366540 | 2842363717 | Bacteria | 6844742 |
| 643 | 2842373029 | 2842370503 | Bacteria | 7038661 |
| 644 | 2842377958 | 2842377471 | Bacteria | 7140707 |
| 645 | 2842386101 | 2842384541 | Bacteria | 7057858 |
| 646 | 2842397424 | 2842395702 | Bacteria | 6780583 |
| 647 | 2842405091 | 2842402390 | Bacteria | 6681310 |
| 648 | 2842411674 | 2842409023 | Bacteria | 6687331 |
| 649 | 2842417876 | 2842415677 | Bacteria | 6596907 |
| 650 | 2842424859 | 2842422224 | Bacteria | 6239196 |
| 651 | 2842431739 | 2842428310 | Bacteria | 6767288 |
| 652 | 2842438318 | 2842434925 | Bacteria | 6502746 |
| 653 | 2842444949 | 2842441272 | Bacteria | 6769273 |
| 654 | 2842452267 | 2842447887 | Bacteria | 6754142 |
| 655 | 2842466093 | 2842462802 | Bacteria | 6588055 |
| 656 | 2842472934 | 2842469257 | Bacteria | 6752936 |
| 657 | 2842481857 | 2842475841 | Bacteria | 6603183 |
| 658 | 2842487085 | 2842482326 | Bacteria | 7212537 |
| 659 | 2842492890 | 2842489311 | Bacteria | 6620893 |
| 660 | 2842496415 | 2842495871 | Bacteria | 6820686 |
| 661 | 2842508732 | 2842502639 | Bacteria | 6604161 |
| 662 | 2842510258 | 2842509118 | Bacteria | 6850950 |
| 663 | 2842516145 | 2842515876 | Bacteria | 5436280 |
| 664 | 2842522409 | 2842521101 | Bacteria | 6569494 |
| 665 | 2842927724 | 2842922631 | Bacteria | 5824079 |
| 666 | 2844167286 | 2844163670 | Bacteria | 7266046 |
| 667 | 2844459411 | 2844454524 | Bacteria | 7952546 |
| 668 | 2847418907 | 2847417321 | Bacteria | 6913799 |
| 669 | 2848993944 | 2848992105 | Bacteria | 6810864 |
| 670 | 2850081893 | 2850079185 | Bacteria | 6848280 |
| 671 | 2852389676 | 2852387548 | Bacteria | 8025568 |
| 672 | 2855825602 | 2855825444 | Bacteria | 6785811 |
| 673 | 2855840979 | 2855839649 | Bacteria | 7135830 |
| 674 | 2855876577 | 2855872281 | Bacteria | 6964271 |
| 675 | 2857518469 | 2857516855 | Bacteria | 7787325 |
| 676 | 2857534335 | 2857531043 | Bacteria | 6754041 |
| 677 | 2858801519 | 2858800743 | Bacteria | 6603254 |
| 678 | 2896390625 | 2896384573 | Bacteria | 7700774 |
| 679 | 2899794165 | 2899792073 | Bacteria | 4926588 |
| 680 | 2899808863 | 2899803654 | Bacteria | 5577784 |
| 681 | 2899846536 | 2899845264 | Bacteria | 5672268 |
| 682 | 2913301097 | 2913295892 | Bacteria | 6333755 |
| 683 | 2913310301 | 2913308742 | Bacteria | 5350706 |
| 684 | 2915985346 | 2915980308 | Bacteria | 6624279 |
| 685 | 2915987993 | 2915986958 | Bacteria | 6739310 |
| 686 | 2915996321 | 2915993759 | Bacteria | 7016183 |
| 687 | 2916001462 | 2916000859 | Bacteria | 6865702 |
| 688 | 2916010351 | 2916007675 | Bacteria | 6898660 |
| 689 | 2916017089 | 2916014648 | Bacteria | 6946486 |
| 690 | 2916022488 | 2916021584 | Bacteria | 6854472 |
| 691 | 2916029018 | 2916028427 | Bacteria | 6748433 |
| 692 | 2916041674 | 2916035215 | Bacteria | 6755766 |
| 693 | 2916047886 | 2916041962 | Bacteria | 6820487 |
| 694 | 2916054114 | 2916048683 | Bacteria | 6543552 |
| 695 | 2916061632 | 2916055098 | Bacteria | 6758838 |
| 696 | 2916062311 | 2916061851 | Bacteria | 6737736 |
| 697 | 2916071974 | 2916068649 | Bacteria | 6943657 |
| 698 | 2916081967 | 2916076590 | Bacteria | 6596108 |
| 699 | 2917556789 | 2917554339 | Bacteria | 4987857 |
| 700 | 2919107874 | 2919100787 | Bacteria | 7710546 |
| 701 | 2919115160 | 2919114240 | Bacteria | 5700270 |
| 702 | 2919167865 | 2919166419 | Bacteria | 4952238 |
| 703 | 2919175093 | 2919171160 | Bacteria | 6499771 |
| 704 | 2919409839 | 2919408235 | Bacteria | 6149349 |
| 705 | 2920765913 | 2920760137 | Bacteria | 7427611 |
| 706 | 2920824445 | 2920822456 | Bacteria | 6897201 |
| 707 | 2921201569 | 2921201388 | Bacteria | 6926299 |
| 708 | 2921210265 | 2921208531 | Bacteria | 6745326 |
| 709 | 2921239101 | 2921237296 | Bacteria | 6876710 |
| 710 | 2921250407 | 2921244191 | Bacteria | 6568419 |
| 711 | 2921253991 | 2921250672 | Bacteria | 6677771 |
| 712 | 2921257377 | 2921257292 | Bacteria | 6808382 |
| 713 | 2921264601 | 2921263974 | Bacteria | 6864552 |
| 714 | 2921283378 | 2921282425 | Bacteria | 6826397 |
| 715 | 2921293218 | 2921289301 | Bacteria | 7316391 |
| 716 | 2923560808 | 2923556063 | Bacteria | 6793593 |
| 717 | 2924147431 | 2924144063 | Bacteria | 6883928 |
| 718 | 2924151676 | 2924150972 | Bacteria | 7169444 |
| 719 | 2924159053 | 2924158325 | Bacteria | 7188855 |
| 720 | 2924167818 | 2924165586 | Bacteria | 7260590 |
| 721 | 2924176528 | 2924172951 | Bacteria | 6749356 |
| 722 | 2924187599 | 2924186466 | Bacteria | 6876637 |
| 723 | 2924200312 | 2924193448 | Bacteria | 6955718 |
| 724 | 2924203858 | 2924200457 | Bacteria | 6757188 |
| 725 | 2924213804 | 2924207177 | Bacteria | 6917007 |
| 726 | 2924217102 | 2924214083 | Bacteria | 7080103 |
| 727 | 2924224041 | 2924221636 | Bacteria | 7113495 |
| 728 | 2924235069 | 2924228884 | Bacteria | 6633132 |
| 729 | 2926756206 | 2926754445 | Bacteria | 5964435 |
| 730 | 2926760437 | 2926760298 | Bacteria | 5505990 |
| 731 | 2929140426 | 2929138655 | Bacteria | 5810547 |
| 732 | 2933008395 | 2933006813 | Bacteria | 4912075 |
| 733 | 2933013211 | 2933011516 | Bacteria | 5439334 |
| 734 | 2933576555 | 2933570622 | Bacteria | 7023390 |
| 735 | 2933586770 | 2933586486 | Bacteria | 7667493 |
| 736 | 2933597900 | 2933594066 | Bacteria | 5594265 |
| 737 | 2933602282 | 2933599457 | Bacteria | 5858799 |
| 738 | 2935899101 | 2935894831 | Bacteria | 6620579 |
| 739 | 2935904493 | 2935901341 | Bacteria | 7341747 |
| 740 | 2936372985 | 2936367885 | Bacteria | 7324495 |
| 741 | 2936381136 | 2936375103 | Bacteria | 6652732 |
| 742 | 2936386055 | 2936381700 | Bacteria | 7006523 |
| 743 | 2936998015 | 2936996657 | Bacteria | 6298727 |
| 744 | 2937006150 | 2937002841 | Bacteria | 6934057 |
| 745 | 2937012649 | 2937009748 | Bacteria | 6746052 |
| 746 | 2937019724 | 2937016420 | Bacteria | 6782579 |
| 747 | 2937029344 | 2937023124 | Bacteria | 6815156 |
| 748 | 2937032701 | 2937029754 | Bacteria | 6424026 |
| 749 | 2937042032 | 2937036028 | Bacteria | 6846469 |
| 750 | 2937045847 | 2937042894 | Bacteria | 6741576 |
| 751 | 2937051299 | 2937049772 | Bacteria | 6757901 |
| 752 | 2937057708 | 2937056579 | Bacteria | 7107896 |
| 753 | 2937070789 | 2937063883 | Bacteria | 7199456 |
| 754 | 2937077581 | 2937071275 | Bacteria | 6984483 |
| 755 | 2937082641 | 2937078374 | Bacteria | 6610289 |
| 756 | 2937091439 | 2937084907 | Bacteria | 6618516 |
| 757 | 2937095871 | 2937091812 | Bacteria | 6979387 |
| 758 | 2937100127 | 2937098957 | Bacteria | 7249374 |
| 759 | 2937111902 | 2937106411 | Bacteria | 6947143 |
| 760 | 2937118407 | 2937113482 | Bacteria | 6505872 |
| 761 | 2937125679 | 2937119839 | Bacteria | 6597547 |
| 762 | 2937130342 | 2937126314 | Bacteria | 6771275 |
| 763 | 2937845932 | 2937843397 | Bacteria | 5256375 |
| 764 | 2941505042 | 2941499720 | Bacteria | 7599444 |
| 765 | 2957379424 | 2957375807 | Bacteria | 6425588 |
| 766 | 2957386433 | 2957382221 | Bacteria | 6737050 |
| 767 | 2957389831 | 2957388812 | Bacteria | 6778072 |
| 768 | 2957399872 | 2957395598 | Bacteria | 6822399 |
| 769 | 2957406755 | 2957402308 | Bacteria | 6741770 |
| 770 | 2957410210 | 2957408893 | Bacteria | 6558585 |
| 771 | 2957421728 | 2957415311 | Bacteria | 6991633 |
| 772 | 2957426182 | 2957422303 | Bacteria | 7172205 |
| 773 | 2957437168 | 2957430029 | Bacteria | 7022557 |
| 774 | 2957441880 | 2957437181 | Bacteria | 6568994 |
| 775 | 2957445461 | 2957443900 | Bacteria | 6869977 |
| 776 | 2957453884 | 2957450854 | Bacteria | 6765715 |
| 777 | 2957459745 | 2957457609 | Bacteria | 6967680 |
| 778 | 2957465738 | 2957464669 | Bacteria | 6568877 |
| 779 | 2957476555 | 2957471148 | Bacteria | 6797643 |
| 780 | 2957478612 | 2957478035 | Bacteria | 6756658 |
| 781 | 2957486136 | 2957484790 | Bacteria | 6703082 |
| 782 | 2957498186 | 2957491536 | Bacteria | 6695180 |
| 783 | 2957502580 | 2957498199 | Bacteria | 7126688 |
| 784 | 2957506633 | 2957505466 | Bacteria | 7253085 |
| 785 | 2960588929 | 2960584000 | Bacteria | 6864594 |
| 786 | 2960596282 | 2960591022 | Bacteria | 6622873 |
| 787 | 2960604485 | 2960603979 | Bacteria | 6898737 |
| 788 | 2960616527 | 2960610863 | Bacteria | 6691244 |
| 789 | 2960618877 | 2960617483 | Bacteria | 6727748 |
| 790 | 2960632644 | 2960631154 | Bacteria | 6732508 |
| 791 | 2960645194 | 2960637947 | Bacteria | 7296468 |
| 792 | 2960646299 | 2960645483 | Bacteria | 7211087 |
| 793 | 2960656287 | 2960652885 | Bacteria | 7083688 |
| 794 | 2960664215 | 2960660292 | Bacteria | 7041660 |
| 795 | 2960669594 | 2960667422 | Bacteria | 6763020 |
| 796 | 2960676824 | 2960674078 | Bacteria | 6609048 |
| 797 | 2960686977 | 2960680706 | Bacteria | 6624464 |
| 798 | 2960688762 | 2960687367 | Bacteria | 6535474 |
| 799 | 2960700136 | 2960693952 | Bacteria | 6749742 |
| 800 | 2964609320 | 2964607997 | Bacteria | 7101408 |
| 801 | 2964616150 | 2964615318 | Bacteria | 6809089 |
| 802 | 2964622914 | 2964621998 | Bacteria | 6834995 |
| 803 | 2964632098 | 2964628898 | Bacteria | 7083044 |
| 804 | 2964639308 | 2964636051 | Bacteria | 7091832 |
| 805 | 2964648889 | 2964643177 | Bacteria | 6820887 |
| 806 | 2964652088 | 2964649959 | Bacteria | 6675118 |
| 807 | 2964662790 | 2964656573 | Bacteria | 7100150 |
| 808 | 2964666845 | 2964663802 | Bacteria | 7019362 |
| 809 | 2964671280 | 2964670856 | Bacteria | 6851364 |
| 810 | 2964681064 | 2964678106 | Bacteria | 6792020 |
| 811 | 2964690095 | 2964685014 | Bacteria | 6839111 |
| 812 | 2964699355 | 2964698721 | Bacteria | 6765331 |
| 813 | 2964709017 | 2964705432 | Bacteria | 7114648 |
| 814 | 2964716204 | 2964712639 | Bacteria | 6695970 |
| 815 | 2964724373 | 2964719344 | Bacteria | 7286602 |
| 816 | 2967667077 | 2967664464 | Bacteria | 6948836 |
| 817 | 2967672801 | 2967671571 | Bacteria | 7021409 |
| 818 | 2967683897 | 2967678726 | Bacteria | 7264382 |
| 819 | 2967691232 | 2967686174 | Bacteria | 6678622 |
| 820 | 2967693512 | 2967693043 | Bacteria | 6804451 |
| 821 | 2967700730 | 2967699805 | Bacteria | 6854538 |
| 822 | 2967711706 | 2967706974 | Bacteria | 7186053 |
| 823 | 2967715650 | 2967714385 | Bacteria | 7000047 |
| 824 | 2967726793 | 2967721400 | Bacteria | 7073753 |
| 825 | 2967734419 | 2967728569 | Bacteria | 6641507 |
| 826 | 2967736513 | 2967735183 | Bacteria | 6827012 |
| 827 | 2967742392 | 2967742019 | Bacteria | 6794534 |
| 828 | 2967750524 | 2967748971 | Bacteria | 6733771 |
| 829 | 2967758257 | 2967755722 | Bacteria | 6814706 |
| 830 | 2967765198 | 2967762386 | Bacteria | 6923502 |
| 831 | 2967770678 | 2967769361 | Bacteria | 6587838 |
| 832 | 2967776543 | 2967775926 | Bacteria | 6738189 |
| 833 | 2970022529 | 2970019648 | Bacteria | 7072033 |
| 834 | 2970032754 | 2970026789 | Bacteria | 6785236 |
| 835 | 2970034408 | 2970033650 | Bacteria | 7118744 |
| 836 | 2970041585 | 2970040964 | Bacteria | 6731123 |
| 837 | 2970052525 | 2970047711 | Bacteria | 7088379 |
| 838 | 2970061299 | 2970054988 | Bacteria | 6611507 |
| 839 | 2970063075 | 2970061556 | Bacteria | 7099761 |
| 840 | 2970074646 | 2970068827 | Bacteria | 7123112 |
| 841 | 2970082408 | 2970076120 | Bacteria | 6697332 |
| 842 | 2970088196 | 2970082768 | Bacteria | 6183754 |
| 843 | 2970095691 | 2970088815 | Bacteria | 6933825 |
| 844 | 2970102339 | 2970095765 | Bacteria | 6936963 |
| 845 | 2970104188 | 2970102677 | Bacteria | 6812532 |
| 846 | 2970114987 | 2970109326 | Bacteria | 6863976 |
| 847 | 2970121468 | 2970116247 | Bacteria | 6501857 |
| 848 | 2970126905 | 2970122695 | Bacteria | 6625855 |
| 849 | 2970130211 | 2970129317 | Bacteria | 6806560 |
| 850 | 2970138420 | 2970136068 | Bacteria | 7207982 |
| 851 | 2970147726 | 2970143518 | Bacteria | 6446480 |
| 852 | 2970154332 | 2970149975 | Bacteria | 6779706 |
| 853 | 2970158078 | 2970156795 | Bacteria | 7168044 |
| 854 | 2970170444 | 2970164137 | Bacteria | 6861252 |
| 855 | 2970172112 | 2970170962 | Bacteria | 6876229 |
| 856 | 2970178241 | 2970177841 | Bacteria | 6768001 |
| 857 | 2970187248 | 2970184632 | Bacteria | 7054431 |
| 858 | 2970193859 | 2970191845 | Bacteria | 7032787 |
| 859 | 2977521180 | 2977516862 | Bacteria | 6940108 |
| 860 | 2977526801 | 2977523885 | Bacteria | 6960446 |
| 861 | 2977535700 | 2977530762 | Bacteria | 6951399 |
| 862 | 2977541717 | 2977537788 | Bacteria | 6929320 |
| 863 | 2977550762 | 2977544691 | Bacteria | 6875412 |
| 864 | 2977554488 | 2977551784 | Bacteria | 7125765 |
| 865 | 2977562630 | 2977558990 | Bacteria | 6863948 |
| 866 | 2977572333 | 2977565890 | Bacteria | 6901543 |
| 867 | 2977577383 | 2977572785 | Bacteria | 6763888 |
| 868 | 2977583692 | 2977579622 | Bacteria | 6772100 |
| 869 | 2978974317 | 2978969890 | Bacteria | 5400756 |
| 870 | 2979094287 | 2979089926 | Bacteria | 5670289 |
| 871 | 2979098332 | 2979095461 | Bacteria | 5669583 |
| 872 | 2979103520 | 2979100975 | Bacteria | 5423623 |
| 873 | 2984511911 | 2984509177 | Bacteria | 5274802 |
| 874 | 2984521729 | 2984518228 | Bacteria | 5277463 |
| 875 | 2984541026 | 2984537506 | Bacteria | 5277481 |
| 876 | 2984589659 | 2984587000 | Bacteria | 5263363 |
| 877 | 2984603307 | 2984601300 | Bacteria | 5455244 |
| 878 | 2989776117 | 2989771324 | Bacteria | 5605128 |
| 879 | 2989778818 | 2989776772 | Bacteria | 4843317 |
| 880 | 2996889911 | 2996887358 | Bacteria | 5795980 |
| 881 | 2996898357 | 2996893221 | Bacteria | 5823108 |
| 882 | 3005409571 | 3005409236 | Bacteria | 7188837 |
| 883 | 3005420298 | 3005416602 | Bacteria | 7064308 |
| 884 | 3005447321 | 3005445848 | Bacteria | 6906074 |
| 885 | 3005454082 | 3005452660 | Bacteria | 5889319 |
| 886 | 639648287 | 639633055 | Bacteria | 7751309 |
| 887 | 643825785 | 643692032 | Bacteria | 6891900 |
| 888 | 648740968 | 648276728 | Bacteria | 6968865 |
| 889 | 650740142 | 650716007 | Bacteria | 5573770 |
| 890 | 8003571203 | 8003570095 | Bacteria | 5747666 |
| 891 | 8003993472 | 8003992118 | Bacteria | 7266902 |
| 892 | 8004000735 | 8003999396 | Bacteria | 7063185 |
| 893 | 8005248368 | 8005246636 | Bacteria | 4933972 |
| 894 | 8005261631 | 8005258706 | Bacteria | 6184835 |
| 895 | 8005280334 | 8005275841 | Bacteria | 6929066 |
| 896 | 8005288402 | 8005282627 | Bacteria | 6675747 |
| 897 | 8005294911 | 8005289223 | Bacteria | 6634003 |
| 898 | 8005306923 | 8005301065 | Bacteria | 6614431 |
| 899 | 8005314280 | 8005307578 | Bacteria | 7395396 |
| 900 | 8005317249 | 8005314921 | Bacteria | 7072929 |
| 901 | 8005324438 | 8005321885 | Bacteria | 5795980 |
| 902 | 8005378936 | 8005376324 | Bacteria | 6590079 |
| 903 | 8005388120 | 8005382845 | Bacteria | 6732062 |
| 904 | 8005396923 | 8005395548 | Bacteria | 6806915 |
| 905 | 8005434618 | 8005430974 | Bacteria | 6689030 |
| 906 | 8005462661 | 8005460587 | Bacteria | 7157962 |
| 907 | 8005486690 | 8005484373 | Bacteria | 6297373 |
| 908 | 8005500026 | 8005497431 | Bacteria | 6477605 |
| 909 | 8005544922 | 8005542996 | Bacteria | 7077758 |
| 910 | 8005557982 | 8005556819 | Bacteria | 6908598 |
| 911 | 8005569155 | 8005563573 | Bacteria | 7153261 |
| 912 | 8005575563 | 8005570704 | Bacteria | 6957481 |
| 913 | 8005621394 | 8005619151 | Bacteria | 7030230 |
| 914 | 8005631319 | 8005626139 | Bacteria | 6534237 |
| 915 | 8005646170 | 8005645114 | Bacteria | 6950293 |
| 916 | 8005659386 | 8005658619 | Bacteria | 4500593 |
| 917 | 8005671443 | 8005668836 | Bacteria | 6953162 |
| 918 | 8005686300 | 8005682033 | Bacteria | 6726518 |
| 919 | 8005694841 | 8005688590 | Bacteria | 6610080 |
| 920 | 8005696018 | 8005695170 | Bacteria | 6912330 |
| 921 | 8018129680 | 8018127388 | Bacteria | 7351159 |
| 922 | 8018155441 | 8018150411 | Bacteria | 5549903 |
| 923 | 8018178010 | 8018176218 | Bacteria | 6896178 |
| 924 | 8023681097 | 8023680758 | Bacteria | 7729763 |
| 925 | 8024485890 | 8024479707 | Bacteria | 6954785 |
| 926 | 8024492636 | 8024486573 | Bacteria | 6540512 |
| 927 | 8024505352 | 8024501048 | Bacteria | 6427847 |
| 928 | 8046773946 | 8046767195 | Bacteria | 7547379 |
| 929 | 8049294627 | 8049293176 | Bacteria | 6128433 |
| 930 | 8054462278 | 8054460903 | Bacteria | 4872905 |
| 931 | 8055435180 | 8055431914 | Bacteria | 4551896 |
| 932 | 8056377186 | 8056375014 | Bacteria | 7006639 |
| 933 | 8056388308 | 8056382006 | Bacteria | 6408074 |
| 934 | 8057578326 | 8057575449 | Bacteria | 7367519 |
| 935 | 8057875342 | 8057874678 | Bacteria | 7494653 |
| 936 | Ga0496125_0000953 | |||
| 937 | JGI24740J21852_10001389 | |||
| 938 | JGI25155J39150_1000011 | |||
| 939 | JGI25156J39149_1000030 | |||
| 940 | JGI25154J39366_1000289 | |||
| 941 | JGI25158J39367_1000167 | |||
| 942 | JGI25157J39369_1000010 | |||
| 943 | JGI25152J39213_1008181 | |||
| 944 | JGI25159J45721_1000029 | |||
| 945 | JGI25159J45721_1001125 | |||
| 946 | JGI25159J45721_1001806 | |||
| 947 | JGI25151J46595_10003454 | |||
| 948 | JGI25151J46595_10004048 | |||
| 949 | JGI25151J46595_10005052 | |||
| 950 | JGI25151J46595_10005103 | |||
| 951 | JGI25165J46597_1006781 | |||
| 952 | JGI25153J46596_10004316 | |||
| 953 | JGI25153J46596_10011346 | |||
| 954 | JGI25160J50197_1000004 | |||
| 955 | JGI25160J50197_1000011 | |||
| 956 | JGI25160J50197_1000593 | |||
| 957 | JGI25161J50226_1000003 | |||
| 958 | JGI25161J50226_1001956 | |||
| 959 | JGI25161J50226_1002628 | |||
| 960 | Ga0006562J51391_1060468 | |||
| 961 | Ga0055526_1001995 | |||
| 962 | Ga0055526_1003733 | |||
| 963 | Ga0055526_1006958 | |||
| 964 | Ga0055526_1010214 | |||
| 965 | Ga0055526_1010394 | |||
| 966 | Ga0055526_1021566 | |||
| 967 | Ga0055524_1003862 | |||
| 968 | Ga0055524_1013014 | |||
| 969 | Ga0055524_1020480 | |||
| 970 | Ga0055524_1028237 | |||
| 971 | Ga0055536_1000356 | |||
| 972 | Ga0055528_1001267 | |||
| 973 | Ga0055528_1001601 | |||
| 974 | Ga0055528_1005825 | |||
| 975 | Ga0055528_1013134 | |||
| 976 | Ga0055528_1015466 | |||
| 977 | Ga0055540_1000177 | |||
| 978 | Ga0055531_10003828 | |||
| 979 | Ga0055531_10003846 | |||
| 980 | Ga0058692_1002330 | |||
| 981 | Ga0055543_1000001 | |||
| 982 | Ga0055543_1000097 | |||
| 983 | Ga0055543_1000255 | |||
| 984 | Ga0055543_1001144 | |||
| 985 | Ga0065165_1000018 | |||
| 986 | Ga0065165_1023781 | |||
| 987 | Ga0070658_10212360 | |||
| 988 | Ga0070670_100000535 | |||
| 989 | Ga0070670_100065176 | |||
| 990 | Ga0070671_100033264 | |||
| 991 | Ga0070665_100107355 | |||
| 992 | Ga0068855_100109341 | |||
| 993 | Ga0068856_100032523 | |||
| 994 | Ga0075365_10005053 | |||
| 995 | Ga0075365_10012329 | |||
| 996 | Ga0075368_10002095 | |||
| 997 | Ga0075364_10000043 | |||
| 998 | Ga0075364_10129542 | |||
| 999 | Ga0075362_10011839 | |||
| 1000 | Ga0075362_10012116 | |||
| 1001 | Ga0075367_10032147 | |||
| 1002 | Ga0075369_10009230 | |||
| 1003 | Ga0075366_10021694 | |||
| 1004 | Ga0075370_10001750 | |||
| 1005 | Ga0079104_1000022 | |||
| 1006 | Ga0079104_1001402 | |||
| 1007 | Ga0099826_10000090 | |||
| 1008 | Ga0099826_10004510 | |||
| 1009 | Ga0105251_10020317 | |||
| 1010 | Ga0105240_10000005 | |||
| 1011 | Ga0105243_10089667 | |||
| 1012 | Ga0105237_10000773 | |||
| 1013 | Ga0123341_1000049 | |||
| 1014 | Ga0105239_10004008 | |||
| 1015 | Ga0157373_10002285 | |||
| 1016 | Ga0157373_10131447 | |||
| 1017 | Ga0157371_10000015 | |||
| 1018 | Ga0157371_10005986 | |||
| 1019 | Ga0157370_10000992 | |||
| 1020 | Ga0157370_10003013 | |||
| 1021 | Ga0157370_10017734 | |||
| 1022 | Ga0157369_10050141 | |||
| 1023 | Ga0157369_10145335 | |||
| 1024 | Ga0171463_1008 | |||
| 1025 | Ga0182007_10000618 | |||
| 1026 | Ga0182005_1018412 | |||
| 1027 | Ga0183363_1281 | |||
| 1028 | Ga0214544_1000129 | |||
| 1029 | Ga0214542_1000828 | |||
| 1030 | Ga0214542_1027439 | |||
| 1031 | Ga0214543_1000010 | |||
| 1032 | Ga0214543_1000134 | |||
| 1033 | Ga0213872_10022695 | |||
| 1034 | Ga0228711_1002680 | |||
| 1035 | Ga0228710_1002851 | |||
| 1036 | Ga0209435_100022 | |||
| 1037 | Ga0209436_100507 | |||
| 1038 | Ga0209437_100122 | |||
| 1039 | Ga0209437_100160 | |||
| 1040 | Ga0207425_1008820 | |||
| 1041 | Ga0207425_1009643 | |||
| 1042 | Ga0209646_1000078 | |||
| 1043 | Ga0209646_1003812 | |||
| 1044 | Ga0209026_1000065 | |||
| 1045 | Ga0209759_1000055 | |||
| 1046 | Ga0209129_1000127 | |||
| 1047 | Ga0209129_1001042 | |||
| 1048 | Ga0209129_1001442 | |||
| 1049 | Ga0209129_1002372 | |||
| 1050 | Ga0209129_1012798 | |||
| 1051 | Ga0209129_1012818 | |||
| 1052 | Ga0209233_1000168 | |||
| 1053 | Ga0209233_1000170 | |||
| 1054 | Ga0209233_1001127 | |||
| 1055 | Ga0209673_1000139 | |||
| 1056 | Ga0209673_1001327 | |||
| 1057 | Ga0209673_1002230 | |||
| 1058 | Ga0209673_1003846 | |||
| 1059 | Ga0209673_1004486 | |||
| 1060 | Ga0209673_1004582 | |||
| 1061 | Ga0209130_1000012 | |||
| 1062 | Ga0209130_1000029 | |||
| 1063 | Ga0209130_1000097 | |||
| 1064 | Ga0209130_1008169 | |||
| 1065 | Ga0209676_1000438 | |||
| 1066 | Ga0209676_1007877 | |||
| 1067 | Ga0209676_1016797 | |||
| 1068 | Ga0209025_1000033 | |||
| 1069 | Ga0209025_1000563 | |||
| 1070 | Ga0209025_1001678 | |||
| 1071 | Ga0209025_1001703 | |||
| 1072 | Ga0209025_1003459 | |||
| 1073 | Ga0209025_1010390 | |||
| 1074 | Ga0209564_1000105 | |||
| 1075 | Ga0209564_1000275 | |||
| 1076 | Ga0209564_1000986 | |||
| 1077 | Ga0209564_1001528 | |||
| 1078 | Ga0209564_1001611 | |||
| 1079 | Ga0209564_1022689 | |||
| 1080 | Ga0209758_1000505 | |||
| 1081 | Ga0209758_1000534 | |||
| 1082 | Ga0209758_1000805 | |||
| 1083 | Ga0209758_1001745 | |||
| 1084 | Ga0209758_1003872 | |||
| 1085 | Ga0209758_1007599 | |||
| 1086 | Ga0209758_1020108 | |||
| 1087 | Ga0209050_1000516 | |||
| 1088 | Ga0209050_1004356 | |||
| 1089 | Ga0209256_1001255 | |||
| 1090 | Ga0209256_1001768 | |||
| 1091 | Ga0209256_1002167 | |||
| 1092 | Ga0209256_1003073 | |||
| 1093 | Ga0209256_1008787 | |||
| 1094 | Ga0209256_1009219 | |||
| 1095 | Ga0209256_1042308 | |||
| 1096 | Ga0207426_1000003 | |||
| 1097 | Ga0207426_1000010 | |||
| 1098 | Ga0207426_1000074 | |||
| 1099 | Ga0207426_1000290 | |||
| 1100 | Ga0207426_1000408 | |||
| 1101 | Ga0209051_1000125 | |||
| 1102 | Ga0209051_1003377 | |||
| 1103 | Ga0209051_1004697 | |||
| 1104 | Ga0209051_1036652 | |||
| 1105 | Ga0209051_1039840 | |||
| 1106 | Ga0209257_1009229 | |||
| 1107 | Ga0207695_10000011 | |||
| 1108 | Ga0207671_10004599 | |||
| 1109 | Ga0207650_10014417 | |||
| 1110 | Ga0207650_10118692 | |||
| 1111 | Ga0207678_10064346 | |||
| 1112 | Ga0207702_10009685 | |||
| 1113 | Ga0209281_1000036 | |||
| 1114 | Ga0209281_1000047 | |||
| 1115 | Ga0209281_1000508 | |||
| 1116 | Ga0209281_1004020 | |||
| 1117 | Ga0209371_1000178 | |||
| 1118 | Ga0209371_1000382 | |||
| 1119 | Ga0209282_1000116 | |||
| 1120 | Ga0209282_1000235 | |||
| 1121 | Ga0209282_1075229 | |||
| 1122 | Ga0268266_10059721 | |||
| 1123 | Ga0268266_10076615 | |||
| 1124 | Ga0268265_10077564 | |||
| 1125 | Ga0265318_10031724 | |||
| 1126 | Ga0307515_10000233 | |||
| 1127 | Ga0307515_10000569 | |||
| 1128 | Ga0307515_10013071 | |||
| 1129 | Ga0307515_10095379 | |||
| 1130 | Ga0268256_1000251 | |||
| 1131 | Ga0268256_1006569 | |||
| 1132 | Ga0265331_10001061 | |||
| 1133 | Ga0307513_10000588 | |||
| 1134 | Ga0307513_10021520 | |||
| 1135 | Ga0307408_100129754 | |||
| 1136 | Ga0265314_10091276 | |||
| 1137 | Ga0307405_10026000 | |||
| 1138 | Ga0307406_10006937 | |||
| 1139 | Ga0307412_10000449 | |||
| 1140 | Ga0315914_1002646 | |||
| 1141 | Ga0316593_10020427 | |||
| 1142 | Ga0315913_1001232 | |||
| 1143 | Ga0315915_1000058 | |||
| 1144 | Ga0373935_0084405 | |||
| 1145 | Ga0373927_0002488 | |||
| 1146 | Ga0316584_0168452 | |||
| 1147 | Ga0373925_0001826 | |||
| 1148 | Ga0395905_0000386 | |||
| 1149 | Ga0395905_0011890 | |||
| 1150 | Ga0436361_0388638 | |||
| 1151 | Ga0439436_0020716 | |||
| 1152 | Ga0439465_0002627 | |||
| 1153 | Ga0439465_0012232 | |||
| 1154 | Ga0451833_0326332 | |||
| 1155 | Ga0451839_0624369 | |||
| 1156 | Ga0451839_1171986 | |||
| 1157 | Ga0451845_0406102 | |||
| 1158 | Ga0451849_1391146 | |||
| 1159 | Ga0451851_0083156 | |||
| 1160 | Ga0451851_0085829 | |||
| 1161 | Ga0451851_1152225 | |||
| 1162 | Ga0451843_0892284 | |||
| 1163 | Ga0439442_022028 | |||
| 1164 | Ga0439449_0005586 | |||
| 1165 | Ga0439449_0041569 | |||
| 1166 | Ga0439462_0019440 | |||
| 1167 | Ga0466968_0033665 | |||
| 1168 | Ga0495638_0001886 | |||
| 1169 | Ga0495638_0034607 | |||
| 1170 | Ga0495662_0037834 | |||
| 1171 | Ga0495585_0066062 | |||
| 1172 | Ga0495585_0106093 | |||
| 1173 | Ga0495607_0127700 | |||
| 1174 | Ga0495583_0051972 | |||
| 1175 | Ga0495583_0076388 | |||
| 1176 | Ga0495606_0002073 | |||
| 1177 | Ga0495606_0029987 | |||
| 1178 | Ga0495620_0028632 | |||
| 1179 | Ga0495628_0059749 | |||
| 1180 | Ga0495631_0080968 | |||
| 1181 | Ga0495632_0050841 | |||
| 1182 | Ga0495643_0027844 | |||
| 1183 | Ga0495643_0078683 | |||
| 1184 | Ga0495654_0003690 | |||
| 1185 | Ga0495622_0046432 | |||
| 1186 | Ga0495633_0001025 | |||
| 1187 | Ga0495668_0006310 | |||
| 1188 | Ga0495611_0041726 | |||
| 1189 | Ga0495625_0038361 | |||
| 1190 | Ga0495625_0119427 | |||
| 1191 | Ga0495625_0185123 | |||
| 1192 | Ga0495635_0142511 | |||
| 1193 | Ga0495588_0020089 | |||
| 1194 | Ga0495658_0054226 | |||
| 1195 | Ga0495613_0003033 | |||
| 1196 | Ga0495649_0103253 | |||
| 1197 | Ga0495660_0071744 | |||
| 1198 | Ga0495604_0013679 | |||
| 1199 | Ga0495687_068952 | |||
| 1200 | Ga0495681_0077664 | |||
| 1201 | Ga0495686_0002178 | |||
| 1202 | Ga0495686_0005411 | |||
| 1203 | Ga0496106_0000478 | |||
| 1204 | Ga0496111_0003975 | |||
| 1205 | Ga0496114_0335013 | |||
| 1206 | Ga0496116_0000232 | |||
| 1207 | Ga0496116_0019844 | |||
| 1208 | Ga0496116_0083325 | |||
| 1209 | Ga0496116_0097864 | |||
| 1210 | Ga0496116_0101076 | |||
| 1211 | Ga0496117_0000002 | |||
| 1212 | Ga0496117_0002298 | |||
| 1213 | Ga0496117_0011144 | |||
| 1214 | Ga0496118_0000460 | |||
| 1215 | Ga0496118_0003956 | |||
| 1216 | Ga0496118_0020559 | |||
| 1217 | Ga0496118_0071214 | |||
| 1218 | Ga0496118_0109262 | |||
| 1219 | Ga0496119_0012076 | |||
| 1220 | Ga0496119_0012145 | |||
| 1221 | Ga0496119_0023760 | |||
| 1222 | Ga0496119_0047784 | |||
| 1223 | Ga0496120_0000078 | |||
| 1224 | Ga0496120_0006355 | |||
| 1225 | Ga0496121_0000001 | |||
| 1226 | Ga0496121_0002309 | |||
| 1227 | Ga0496121_0005949 | |||
| 1228 | Ga0496121_0009598 | |||
| 1229 | Ga0496121_0010507 | |||
| 1230 | Ga0496121_0081738 | |||
| 1231 | Ga0496121_0087328 | |||
| 1232 | Ga0496122_0000001 | |||
| 1233 | Ga0496122_0006684 | |||
| 1234 | Ga0496122_0011586 | |||
| 1235 | Ga0496122_0012223 | |||
| 1236 | Ga0496122_0052212 | |||
| 1237 | Ga0496122_0100963 | |||
| 1238 | Ga0496122_0113931 | |||
| 1239 | Ga0496122_0118521 | |||
| 1240 | Ga0496122_0124634 | |||
| 1241 | Ga0496123_0000001 | |||
| 1242 | Ga0496123_0000032 | |||
| 1243 | Ga0496123_0000512 | |||
| 1244 | Ga0496123_0005232 | |||
| 1245 | Ga0496123_0050289 | |||
| 1246 | Ga0496123_0076430 | |||
| 1247 | Ga0496123_0076538 | |||
| 1248 | Ga0496124_0000377 | |||
| 1249 | Ga0496124_0004853 | |||
| 1250 | Ga0496124_0014237 | |||
| 1251 | Ga0496124_0093699 | |||
| 1252 | Ga0496124_0127798 | |||
| 1253 | Ga0496124_0231886 | |||
| 1254 | Ga0496125_0000155 | |||
| 1255 | Ga0496125_0053841 | |||
| 1256 | Ga0496126_0001369 | |||
| 1257 | Ga0496126_0052656 | |||
| 1258 | Ga0496126_0230043 | |||
| 1259 | Ga0501034_0254277 | |||
| 1260 | Ga0501036_0201895 | |||
| 1261 | Ga0501037_0154721 | |||
| 1262 | Ga0501070_0084565 | |||
| 1263 | Ga0501073_0017851 | |||
| 1264 | Ga0501035_0029163 | |||
| 1265 | Ga0501035_0208503 | |||
| 1266 | Ga0501035_0348446 | |||
| 1267 | nmdc:mga03683_3419_c1 | |||
| 1268 | nmdc:mga03n38_26274_c1 | |||
| 1269 | nmdc:mga00v17_203_c1 | |||
| 1270 | nmdc:mga00v17_3726_c1 | |||
| 1271 | nmdc:mga00v17_68969_c1 | |||
| 1272 | nmdc:mga0yw44_697_c1 | |||
| 1273 | nmdc:mga0yw44_95712_c1 | |||
| 1274 | nmdc:mga0k408_112515_c1 | |||
| 1275 | nmdc:mga0k408_25595_c1 | |||
| 1276 | nmdc:mga0sz30_14502_c1 | |||
| 1277 | nmdc:mga0sz30_16497_c1 | |||
| 1278 | nmdc:mga0sz30_4182_c1 | |||
| 1279 | Ga0500643_023318 | |||
| 1280 | Ga0500556_0081163 | |||
| 1281 | Ga0500560_001846 | |||
| 1282 | Ga0500572_000849 | |||
| 1283 | Ga0500572_003892 | |||
| 1284 | Ga0500618_002786 | |||
| 1285 | Ga0500618_009375 | |||
| 1286 | Ga0500618_018902 | |||
| 1287 | Ga0500658_0000485 | |||
| 1288 | Ga0500658_0012162 | |||
| 1289 | Ga0500559_0062107 | |||
| 1290 | Ga0500561_0002360 | |||
| 1291 | Ga0500568_0003249 | |||
| 1292 | Ga0500577_0078061 | |||
| 1293 | Ga0500616_0002587 | |||
| 1294 | Ga0500616_0011140 | |||
| 1295 | Ga0500622_0000378 | |||
| 1296 | Ga0500622_0000778 | |||
| 1297 | Ga0500622_0039798 | |||
| 1298 | Ga0500622_0124327 | |||
| 1299 | Ga0500624_001373 | |||
| 1300 | Ga0500634_0010832 | |||
| 1301 | Ga0500636_0000123 | |||
| 1302 | Ga0500636_0001081 | |||
| 1303 | Ga0500636_0059250 | |||
| 1304 | Ga0500645_000972 | |||
| 1305 | Ga0587090_000719 | |||
| 1306 | 2509107650 | |||
| 1307 | 2509375988 | |||
| 1308 | 2509386920 | |||
| 1309 | 2509442448 | |||
| 1310 | 2510133052 | |||
| 1311 | 2510308661 | |||
| 1312 | 2510843005 | |||
| 1313 | 2510899441 | |||
| 1314 | 2511134929 | |||
| 1315 | 2511172608 | |||
| 1316 | 2511183744 | |||
| 1317 | 2511193389 | |||
| 1318 | 2511501507 | |||
| 1319 | 2512532933 | |||
| 1320 | 2512971740 | |||
| 1321 | 2513569867 | |||
| 1322 | 2513575135 | |||
| 1323 | 2513588110 | |||
| 1324 | 2513594390 | |||
| 1325 | 2513605270 | |||
| 1326 | 2513618701 | |||
| 1327 | 2513635602 | |||
| 1328 | 2513713454 | |||
| 1329 | 2513866995 | |||
| 1330 | 2513886969 | |||
| 1331 | 2513907204 | |||
| 1332 | 2513909862 | |||
| 1333 | 2513926641 | |||
| 1334 | 2513987068 | |||
| 1335 | 2513997346 | |||
| 1336 | 2514005288 | |||
| 1337 | 2514021856 | |||
| 1338 | 2515112002 | |||
| 1339 | 2515611352 | |||
| 1340 | 2515633798 | |||
| 1341 | 2515645037 | |||
| 1342 | 2515660179 | |||
| 1343 | 2515738816 | |||
| 1344 | 2516209510 | |||
| 1345 | 2516892825 | |||
| 1346 | 2517035738 | |||
| 1347 | 2517076162 | |||
| 1348 | 2517094906 | |||
| 1349 | 2517406535 | |||
| 1350 | 2517569600 | |||
| 1351 | 2524453661 | |||
| 1352 | 2524460459 | |||
| 1353 | 2530645302 | |||
| 1354 | 2535484818 | |||
| 1355 | 2535516275 | |||
| 1356 | 2537877784 | |||
| 1357 | 2551674252 | |||
| 1358 | 2551680404 | |||
| 1359 | 2551686544 | |||
| 1360 | 2551691823 | |||
| 1361 | 2551699773 | |||
| 1362 | 2551711741 | |||
| 1363 | 2551719508 | |||
| 1364 | 2551729148 | |||
| 1365 | 2551737098 | |||
| 1366 | 2551742525 | |||
| 1367 | 2554247754 | |||
| 1368 | 2558868261 | |||
| 1369 | 2559294887 | |||
| 1370 | 2561466505 | |||
| 1371 | 2585168470 | |||
| 1372 | 2585199960 | |||
| 1373 | 2585225792 | |||
| 1374 | 2585233553 | |||
| 1375 | 2585254507 | |||
| 1376 | 2585270044 | |||
| 1377 | 2585270669 | |||
| 1378 | 2585277010 | |||
| 1379 | 2585323984 | |||
| 1380 | 2585333619 | |||
| 1381 | 2585389749 | |||
| 1382 | 2585393716 | |||
| 1383 | 2585403453 | |||
| 1384 | 2585528318 | |||
| 1385 | 2585537020 | |||
| 1386 | 2585540495 | |||
| 1387 | 2585546752 | |||
| 1388 | 2585551871 | |||
| 1389 | 2585558372 | |||
| 1390 | 2585819579 | |||
| 1391 | 2585838711 | |||
| 1392 | 2585846561 | |||
| 1393 | 2585897767 | |||
| 1394 | 2585904639 | |||
| 1395 | 2585995875 | |||
| 1396 | 2586000440 | |||
| 1397 | 2587980245 | |||
| 1398 | 2599336303 | |||
| 1399 | 2599417930 | |||
| 1400 | 2599604148 | |||
| 1401 | 2599721501 | |||
| 1402 | 2600197125 | |||
| 1403 | 2600375810 | |||
| 1404 | 2601608059 | |||
| 1405 | 2601744834 | |||
| 1406 | 2616292685 | |||
| 1407 | 2616308384 | |||
| 1408 | 2616556548 | |||
| 1409 | 2617385873 | |||
| 1410 | 2643808722 | |||
| 1411 | 2643811901 | |||
| 1412 | 2643857685 | |||
| 1413 | 2643919378 | |||
| 1414 | 2644001960 | |||
| 1415 | 2644005060 | |||
| 1416 | 2644049364 | |||
| 1417 | 2644066256 | |||
| 1418 | 2644107978 | |||
| 1419 | 2644148350 | |||
| 1420 | 2644192901 | |||
| 1421 | 2644204297 | |||
| 1422 | 2644210481 | |||
| 1423 | 2644239387 | |||
| 1424 | 2644309372 | |||
| 1425 | 2644333198 | |||
| 1426 | 2644377796 | |||
| 1427 | 2644415531 | |||
| 1428 | 2644450067 | |||
| 1429 | 2644482398 | |||
| 1430 | 2644494478 | |||
| 1431 | 2644502051 | |||
| 1432 | 2644522280 | |||
| 1433 | 2644545630 | |||
| 1434 | 2644615314 | |||
| 1435 | 2644654033 | |||
| 1436 | 2644658693 | |||
| 1437 | 2644673621 | |||
| 1438 | 2644687624 | |||
| 1439 | 2657683822 | |||
| 1440 | 2671115785 | |||
| 1441 | 2692316028 | |||
| 1442 | 2719180960 | |||
| 1443 | 2719385560 | |||
| 1444 | 2719665382 | |||
| 1445 | 2719731709 | |||
| 1446 | 2720491802 | |||
| 1447 | 2720613071 | |||
| 1448 | 2720619924 | |||
| 1449 | 2720631350 | |||
| 1450 | 2720775077 | |||
| 1451 | 2721147054 | |||
| 1452 | 2721158582 | |||
| 1453 | 2721163972 | |||
| 1454 | 2721399308 | |||
| 1455 | 2722840142 | |||
| 1456 | 2723026714 | |||
| 1457 | 2723560331 | |||
| 1458 | 2723566897 | |||
| 1459 | 2724038121 | |||
| 1460 | 2724044465 | |||
| 1461 | 2724089684 | |||
| 1462 | 2724104162 | |||
| 1463 | 2724109971 | |||
| 1464 | 2725948736 | |||
| 1465 | 2730107650 | |||
| 1466 | 2730164197 | |||
| 1467 | 2730298214 | |||
| 1468 | 2738801925 | |||
| 1469 | 2738945592 | |||
| 1470 | 2739037991 | |||
| 1471 | 2739307891 | |||
| 1472 | 2753359426 | |||
| 1473 | 2753458334 | |||
| 1474 | 2758641686 | |||
| 1475 | 2766062931 | |||
| 1476 | 2776913375 | |||
| 1477 | 2778176524 | |||
| 1478 | 2792580744 | |||
| 1479 | 2792619981 | |||
| 1480 | 2792626601 | |||
| 1481 | 2792639537 | |||
| 1482 | 2793279680 | |||
| 1483 | 2793298262 | |||
| 1484 | 2793313743 | |||
| 1485 | 2793324325 | |||
| 1486 | 2793326463 | |||
| 1487 | 2793337048 | |||
| 1488 | 2793341299 | |||
| 1489 | 2793347523 | |||
| 1490 | 2793352412 | |||
| 1491 | 2793361397 | |||
| 1492 | 2793369668 | |||
| 1493 | 2802718738 | |||
| 1494 | 2802726350 | |||
| 1495 | 2802732890 | |||
| 1496 | 2802738245 | |||
| 1497 | 2802744579 | |||
| 1498 | 2802751215 | |||
| 1499 | 2804752085 | |||
| 1500 | 2805927740 | |||
| 1501 | 2805935646 | |||
| 1502 | 2806045384 | |||
| 1503 | 2806055423 | |||
| 1504 | 2806061466 | |||
| 1505 | 2806068040 | |||
| 1506 | 2806072612 | |||
| 1507 | 2808985343 | |||
| 1508 | 2819241893 | |||
| 1509 | 2819559776 | |||
| 1510 | 2819610359 | |||
| 1511 | 2819638101 | |||
| 1512 | 2819684693 | |||
| 1513 | 2821127924 | |||
| 1514 | 2838021143 | |||
| 1515 | 2838025374 | |||
| 1516 | 2838035091 | |||
| 1517 | 2838041556 | |||
| 1518 | 2838043206 | |||
| 1519 | 2838054200 | |||
| 1520 | 2838067853 | |||
| 1521 | 2838071483 | |||
| 1522 | 2838078756 | |||
| 1523 | 2838666301 | |||
| 1524 | 2838670188 | |||
| 1525 | 2838676187 | |||
| 1526 | 2838682462 | |||
| 1527 | 2838689234 | |||
| 1528 | 2838697033 | |||
| 1529 | 2838702559 | |||
| 1530 | 2838709726 | |||
| 1531 | 2838715069 | |||
| 1532 | 2838721131 | |||
| 1533 | 2838725828 | |||
| 1534 | 2838730582 | |||
| 1535 | 2838738348 | |||
| 1536 | 2838743523 | |||
| 1537 | 2841841282 | |||
| 1538 | 2841848088 | |||
| 1539 | 2841854801 | |||
| 1540 | 2841859361 | |||
| 1541 | 2842077900 | |||
| 1542 | 2842110744 | |||
| 1543 | 2842119592 | |||
| 1544 | 2842125882 | |||
| 1545 | 2842131081 | |||
| 1546 | 2842141060 | |||
| 1547 | 2842146896 | |||
| 1548 | 2842153749 | |||
| 1549 | 2842157664 | |||
| 1550 | 2842164861 | |||
| 1551 | 2842171312 | |||
| 1552 | 2842177369 | |||
| 1553 | 2842180751 | |||
| 1554 | 2842188177 | |||
| 1555 | 2842196879 | |||
| 1556 | 2842200942 | |||
| 1557 | 2842206277 | |||
| 1558 | 2842212488 | |||
| 1559 | 2842222968 | |||
| 1560 | 2842225893 | |||
| 1561 | 2842231191 | |||
| 1562 | 2842239139 | |||
| 1563 | 2842244702 | |||
| 1564 | 2842251961 | |||
| 1565 | 2842258515 | |||
| 1566 | 2842268042 | |||
| 1567 | 2842273254 | |||
| 1568 | 2842279734 | |||
| 1569 | 2842287379 | |||
| 1570 | 2842291562 | |||
| 1571 | 2842301789 | |||
| 1572 | 2842310084 | |||
| 1573 | 2842313685 | |||
| 1574 | 2842318145 | |||
| 1575 | 2842347275 | |||
| 1576 | 2842357292 | |||
| 1577 | 2842366540 | |||
| 1578 | 2842373029 | |||
| 1579 | 2842377958 | |||
| 1580 | 2842386101 | |||
| 1581 | 2842397424 | |||
| 1582 | 2842405091 | |||
| 1583 | 2842411674 | |||
| 1584 | 2842417876 | |||
| 1585 | 2842424859 | |||
| 1586 | 2842431739 | |||
| 1587 | 2842438318 | |||
| 1588 | 2842444949 | |||
| 1589 | 2842452267 | |||
| 1590 | 2842466093 | |||
| 1591 | 2842472934 | |||
| 1592 | 2842481857 | |||
| 1593 | 2842487085 | |||
| 1594 | 2842492890 | |||
| 1595 | 2842496415 | |||
| 1596 | 2842508732 | |||
| 1597 | 2842510258 | |||
| 1598 | 2842516145 | |||
| 1599 | 2842522409 | |||
| 1600 | 2842927724 | |||
| 1601 | 2844167286 | |||
| 1602 | 2844459411 | |||
| 1603 | 2847418907 | |||
| 1604 | 2848993944 | |||
| 1605 | 2850081893 | |||
| 1606 | 2852389676 | |||
| 1607 | 2855825602 | |||
| 1608 | 2855840979 | |||
| 1609 | 2855876577 | |||
| 1610 | 2857518469 | |||
| 1611 | 2857534335 | |||
| 1612 | 2858801519 | |||
| 1613 | 2896390625 | |||
| 1614 | 2899794165 | |||
| 1615 | 2899808863 | |||
| 1616 | 2899846536 | |||
| 1617 | 2913301097 | |||
| 1618 | 2913310301 | |||
| 1619 | 2915985346 | |||
| 1620 | 2915987993 | |||
| 1621 | 2915996321 | |||
| 1622 | 2916001462 | |||
| 1623 | 2916010351 | |||
| 1624 | 2916017089 | |||
| 1625 | 2916022488 | |||
| 1626 | 2916029018 | |||
| 1627 | 2916041674 | |||
| 1628 | 2916047886 | |||
| 1629 | 2916054114 | |||
| 1630 | 2916061632 | |||
| 1631 | 2916062311 | |||
| 1632 | 2916071974 | |||
| 1633 | 2916081967 | |||
| 1634 | 2917556789 | |||
| 1635 | 2919107874 | |||
| 1636 | 2919115160 | |||
| 1637 | 2919167865 | |||
| 1638 | 2919175093 | |||
| 1639 | 2919409839 | |||
| 1640 | 2920765913 | |||
| 1641 | 2920824445 | |||
| 1642 | 2921201569 | |||
| 1643 | 2921210265 | |||
| 1644 | 2921239101 | |||
| 1645 | 2921250407 | |||
| 1646 | 2921253991 | |||
| 1647 | 2921257377 | |||
| 1648 | 2921264601 | |||
| 1649 | 2921283378 | |||
| 1650 | 2921293218 | |||
| 1651 | 2923560808 | |||
| 1652 | 2924147431 | |||
| 1653 | 2924151676 | |||
| 1654 | 2924159053 | |||
| 1655 | 2924167818 | |||
| 1656 | 2924176528 | |||
| 1657 | 2924187599 | |||
| 1658 | 2924200312 | |||
| 1659 | 2924203858 | |||
| 1660 | 2924213804 | |||
| 1661 | 2924217102 | |||
| 1662 | 2924224041 | |||
| 1663 | 2924235069 | |||
| 1664 | 2926756206 | |||
| 1665 | 2926760437 | |||
| 1666 | 2929140426 | |||
| 1667 | 2933008395 | |||
| 1668 | 2933013211 | |||
| 1669 | 2933576555 | |||
| 1670 | 2933586770 | |||
| 1671 | 2933597900 | |||
| 1672 | 2933602282 | |||
| 1673 | 2935899101 | |||
| 1674 | 2935904493 | |||
| 1675 | 2936372985 | |||
| 1676 | 2936381136 | |||
| 1677 | 2936386055 | |||
| 1678 | 2936998015 | |||
| 1679 | 2937006150 | |||
| 1680 | 2937012649 | |||
| 1681 | 2937019724 | |||
| 1682 | 2937029344 | |||
| 1683 | 2937032701 | |||
| 1684 | 2937042032 | |||
| 1685 | 2937045847 | |||
| 1686 | 2937051299 | |||
| 1687 | 2937057708 | |||
| 1688 | 2937070789 | |||
| 1689 | 2937077581 | |||
| 1690 | 2937082641 | |||
| 1691 | 2937091439 | |||
| 1692 | 2937095871 | |||
| 1693 | 2937100127 | |||
| 1694 | 2937111902 | |||
| 1695 | 2937118407 | |||
| 1696 | 2937125679 | |||
| 1697 | 2937130342 | |||
| 1698 | 2937845932 | |||
| 1699 | 2941505042 | |||
| 1700 | 2957379424 | |||
| 1701 | 2957386433 | |||
| 1702 | 2957389831 | |||
| 1703 | 2957399872 | |||
| 1704 | 2957406755 | |||
| 1705 | 2957410210 | |||
| 1706 | 2957421728 | |||
| 1707 | 2957426182 | |||
| 1708 | 2957437168 | |||
| 1709 | 2957441880 | |||
| 1710 | 2957445461 | |||
| 1711 | 2957453884 | |||
| 1712 | 2957459745 | |||
| 1713 | 2957465738 | |||
| 1714 | 2957476555 | |||
| 1715 | 2957478612 | |||
| 1716 | 2957486136 | |||
| 1717 | 2957498186 | |||
| 1718 | 2957502580 | |||
| 1719 | 2957506633 | |||
| 1720 | 2960588929 | |||
| 1721 | 2960596282 | |||
| 1722 | 2960604485 | |||
| 1723 | 2960616527 | |||
| 1724 | 2960618877 | |||
| 1725 | 2960632644 | |||
| 1726 | 2960645194 | |||
| 1727 | 2960646299 | |||
| 1728 | 2960656287 | |||
| 1729 | 2960664215 | |||
| 1730 | 2960669594 | |||
| 1731 | 2960676824 | |||
| 1732 | 2960686977 | |||
| 1733 | 2960688762 | |||
| 1734 | 2960700136 | |||
| 1735 | 2964609320 | |||
| 1736 | 2964616150 | |||
| 1737 | 2964622914 | |||
| 1738 | 2964632098 | |||
| 1739 | 2964639308 | |||
| 1740 | 2964648889 | |||
| 1741 | 2964652088 | |||
| 1742 | 2964662790 | |||
| 1743 | 2964666845 | |||
| 1744 | 2964671280 | |||
| 1745 | 2964681064 | |||
| 1746 | 2964690095 | |||
| 1747 | 2964699355 | |||
| 1748 | 2964709017 | |||
| 1749 | 2964716204 | |||
| 1750 | 2964724373 | |||
| 1751 | 2967667077 | |||
| 1752 | 2967672801 | |||
| 1753 | 2967683897 | |||
| 1754 | 2967691232 | |||
| 1755 | 2967693512 | |||
| 1756 | 2967700730 | |||
| 1757 | 2967711706 | |||
| 1758 | 2967715650 | |||
| 1759 | 2967726793 | |||
| 1760 | 2967734419 | |||
| 1761 | 2967736513 | |||
| 1762 | 2967742392 | |||
| 1763 | 2967750524 | |||
| 1764 | 2967758257 | |||
| 1765 | 2967765198 | |||
| 1766 | 2967770678 | |||
| 1767 | 2967776543 | |||
| 1768 | 2970022529 | |||
| 1769 | 2970032754 | |||
| 1770 | 2970034408 | |||
| 1771 | 2970041585 | |||
| 1772 | 2970052525 | |||
| 1773 | 2970061299 | |||
| 1774 | 2970063075 | |||
| 1775 | 2970074646 | |||
| 1776 | 2970082408 | |||
| 1777 | 2970088196 | |||
| 1778 | 2970095691 | |||
| 1779 | 2970102339 | |||
| 1780 | 2970104188 | |||
| 1781 | 2970114987 | |||
| 1782 | 2970121468 | |||
| 1783 | 2970126905 | |||
| 1784 | 2970130211 | |||
| 1785 | 2970138420 | |||
| 1786 | 2970147726 | |||
| 1787 | 2970154332 | |||
| 1788 | 2970158078 | |||
| 1789 | 2970170444 | |||
| 1790 | 2970172112 | |||
| 1791 | 2970178241 | |||
| 1792 | 2970187248 | |||
| 1793 | 2970193859 | |||
| 1794 | 2977521180 | |||
| 1795 | 2977526801 | |||
| 1796 | 2977535700 | |||
| 1797 | 2977541717 | |||
| 1798 | 2977550762 | |||
| 1799 | 2977554488 | |||
| 1800 | 2977562630 | |||
| 1801 | 2977572333 | |||
| 1802 | 2977577383 | |||
| 1803 | 2977583692 | |||
| 1804 | 2978974317 | |||
| 1805 | 2979094287 | |||
| 1806 | 2979098332 | |||
| 1807 | 2979103520 | |||
| 1808 | 2984511911 | |||
| 1809 | 2984521729 | |||
| 1810 | 2984541026 | |||
| 1811 | 2984589659 | |||
| 1812 | 2984603307 | |||
| 1813 | 2989776117 | |||
| 1814 | 2989778818 | |||
| 1815 | 2996889911 | |||
| 1816 | 2996898357 | |||
| 1817 | 3005409571 | |||
| 1818 | 3005420298 | |||
| 1819 | 3005447321 | |||
| 1820 | 3005454082 | |||
| 1821 | 639648287 | |||
| 1822 | 643825785 | |||
| 1823 | 648740968 | |||
| 1824 | 650740142 | |||
| 1825 | 8003571203 | |||
| 1826 | 8003993472 | |||
| 1827 | 8004000735 | |||
| 1828 | 8005248368 | |||
| 1829 | 8005261631 | |||
| 1830 | 8005280334 | |||
| 1831 | 8005288402 | |||
| 1832 | 8005294911 | |||
| 1833 | 8005306923 | |||
| 1834 | 8005314280 | |||
| 1835 | 8005317249 | |||
| 1836 | 8005324438 | |||
| 1837 | 8005378936 | |||
| 1838 | 8005388120 | |||
| 1839 | 8005396923 | |||
| 1840 | 8005434618 | |||
| 1841 | 8005462661 | |||
| 1842 | 8005486690 | |||
| 1843 | 8005500026 | |||
| 1844 | 8005544922 | |||
| 1845 | 8005557982 | |||
| 1846 | 8005569155 | |||
| 1847 | 8005575563 | |||
| 1848 | 8005621394 | |||
| 1849 | 8005631319 | |||
| 1850 | 8005646170 | |||
| 1851 | 8005659386 | |||
| 1852 | 8005671443 | |||
| 1853 | 8005686300 | |||
| 1854 | 8005694841 | |||
| 1855 | 8005696018 | |||
| 1856 | 8018129680 | |||
| 1857 | 8018155441 | |||
| 1858 | 8018178010 | |||
| 1859 | 8023681097 | |||
| 1860 | 8024485890 | |||
| 1861 | 8024492636 | |||
| 1862 | 8024505352 | |||
| 1863 | 8046773946 | |||
| 1864 | 8049294627 | |||
| 1865 | 8054462278 | |||
| 1866 | 8055435180 | |||
| 1867 | 8056377186 | |||
| 1868 | 8056388308 | |||
| 1869 | 8057578326 | |||
| 1870 | 8057875342 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fks-assembly1.cif.gz_D | yeast f1 atpase in the absence of bound nucleotides | 0.7441 | 72 | 147 |
| 6q45-assembly1.cif.gz_F | f1-atpase from fusobacterium nucleatum | 0.743 | 86 | 151 |
| 6re2-assembly1.cif.gz_X | cryo-em structure of polytomella f-atp synthase, rotary substate 2b, composite map | 0.7389 | 86 | 147 |
| 3oaa-assembly4.cif.gz_b | structure of the e.coli f1-atp synthase inhibited by subunit epsilon | 0.7344 | 86 | 151 |
| 6foc-assembly1.cif.gz_D | f1-atpase from mycobacterium smegmatis | 0.734 | 86 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vkyA01 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.9371 | 5 | 356 | 3.40.1780.10 |
| 1vkyA01 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.9193 | 5 | 356 | 3.40.1780.10 |
| af_P0A7F9_64_163_3.40.1780.10 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.8244 | 66 | 178 | 3.40.1780.10 |
| af_P0A7F9_64_163_3.40.1780.10 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.8097 | 66 | 178 | 3.40.1780.10 |
| 1vkyA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like | 0.7995 | 66 | 151 | 2.40.10.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1UHR0-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9592 | 260 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A3D4QLI7-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9585 | 219 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-L1MKH9-F1-model_v4 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | 0.9573 | 247 | 357 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A3N5F0H8-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9491 | 228 | 359 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A522W263-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9486 | 247 | 360 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |