F486174

General Info

Members Datasets Scaffolds Average Seq Length
935 755 1870 359

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000953|Ga0496125_0000953_44261_45346
Length 361
Sequence MLTSDFDFDLPDDCIALRPAEPRDSARLLVVKDGVLDDRIIRDLPDFLQPGDALVFNDTRVIPARLSGVRQRIGPEGETLTVEVEATLHHRDAPDVWSAFMKPGKRIKXXXRIHFGRNNAGACELGHLDATVEAKDEDGLITLRFDLAGPALDDAIRDVGVMPLPPYIAARRPEDDRDLKDYQTVFATYDGSVAAPTAGLHFTPELLDAIRARGVSTHAVTLHVGAGTFLPVKADDTTDHKMHSEWGEVSPETAAALNAVRAAGGRIVCVGTTSLRLLESATTEDGMVQPFHGDTAIFITPGYRFRACDVLMTNFHLPKSTLFMLVSAFAGLETMRAAYAHAIDSGYRFYSYGDGSLLFRR

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
60 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
102 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
104 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
116 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
117 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
178 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
193 2509276019 Ensifer aridi TW10 Isolate Nodule
194 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
195 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
196 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
197 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
198 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
199 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
200 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
201 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
202 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
203 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
204 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
205 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
206 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
207 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
208 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
209 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
210 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
211 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
212 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
213 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
214 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
215 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
216 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
217 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
218 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
219 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
220 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
221 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
222 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
223 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
224 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
225 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
226 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
227 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
228 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
229 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
230 2516143018 Ensifer sp. BR816 Isolate Nodule
231 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
232 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
233 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
234 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
235 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
236 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
237 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
238 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
239 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
240 2534681786 Brucella suis 92/29 Isolate Unclassified
241 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
242 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
243 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
244 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
245 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
246 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
247 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
248 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
249 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
250 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
251 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
252 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
253 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
254 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
255 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
256 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
257 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
258 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
259 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
260 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
261 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
262 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
263 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
264 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
265 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
266 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
267 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
268 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
269 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
270 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
271 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
272 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
273 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
274 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
275 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
276 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
277 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
278 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
279 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
280 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
281 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
282 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
283 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
284 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
285 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
286 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
287 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
288 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
289 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
290 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
291 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
292 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
293 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
294 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
295 2643221557 Ensifer sp. Root558 Isolate Unclassified
296 2643221558 Rhizobium sp. Root149 Isolate Unclassified
297 2643221568 Rhizobium sp. Root564 Isolate Unclassified
298 2643221582 Rhizobium sp. Root651 Isolate Unclassified
299 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
300 2643221599 Rhizobium sp. Root708 Isolate Unclassified
301 2643221607 Rhizobium sp. Root73 Isolate Unclassified
302 2643221610 Ensifer sp. Root74 Isolate Unclassified
303 2643221618 Ensifer sp. Root231 Isolate Unclassified
304 2643221626 Ensifer sp. Root31 Isolate Unclassified
305 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
306 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
307 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
308 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
309 2643221655 Ensifer sp. Root1252 Isolate Unclassified
310 2643221659 Ensifer sp. Root127 Isolate Unclassified
311 2643221668 Ensifer sp. Root423 Isolate Unclassified
312 2643221675 Ensifer sp. Root1298 Isolate Unclassified
313 2643221680 Ensifer sp. Root1312 Isolate Unclassified
314 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
315 2643221688 Rhizobium sp. Root482 Isolate Unclassified
316 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
317 2643221693 Rhizobium sp. Root491 Isolate Unclassified
318 2643221698 Ensifer sp. Root142 Isolate Unclassified
319 2643221712 Ensifer sp. Root258 Isolate Unclassified
320 2643221718 Rhizobium sp. Root268 Isolate Unclassified
321 2643221719 Rhizobium sp. Root274 Isolate Unclassified
322 2643221723 Ensifer sp. Root278 Isolate Unclassified
323 2643221726 Ensifer sp. Root954 Isolate Unclassified
324 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
325 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
326 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
327 2718217882 Rhizobium sp. N741 Isolate Nodule
328 2718217927 Rhizobium sp. N324 Isolate Nodule
329 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
330 2718218009 Rhizobium sp. N561 Isolate Nodule
331 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
332 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
333 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
334 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
335 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
336 2718218363 Rhizobium sp. N113 Isolate Nodule
337 2718218365 Rhizobium sp. N731 Isolate Nodule
338 2718218366 Rhizobium sp. N621 Isolate Nodule
339 2718218423 Rhizobium sp. N941 Isolate Nodule
340 2721755514 Rhizobium sp. N6212 Isolate Nodule
341 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
342 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
343 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
344 2721755809 Rhizobium sp. N541 Isolate Nodule
345 2721755810 Rhizobium sp. N871 Isolate Nodule
346 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
347 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
348 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
349 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
350 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
351 2728369365 Rhizobium sp. N1341 Isolate Nodule
352 2728369397 Rhizobium sp. N1314 Isolate Nodule
353 2738541293 Rhizobium sp. GV031 Isolate Unclassified
354 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
355 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
356 2738543024 Aminobacter sp. AP02 Isolate Unclassified
357 2751185800 Brucella pituitosa AA2 Isolate Unclassified
358 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
359 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
360 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
361 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
362 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
363 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
364 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
365 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
366 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
367 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
368 2791355256 Rhizobium sp. M10 Isolate Nodule
369 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
370 2791355260 Rhizobium sp. L9 Isolate Nodule
371 2791355261 Rhizobium sp. J15 Isolate Nodule
372 2791355262 Rhizobium sp. M1 Isolate Nodule
373 2791355263 Rhizobium chutanense C5 Isolate Nodule
374 2791355264 Rhizobium sp. S9 Isolate Nodule
375 2791355265 Rhizobium sp. H4 Isolate Nodule
376 2791355266 Rhizobium sp. L43 Isolate Nodule
377 2791355267 Rhizobium sp. L18 Isolate Nodule
378 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
379 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
380 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
381 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
382 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
383 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
384 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
385 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
386 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
387 2802429633 Rhizobium anhuiense J3 Isolate Nodule
388 2802429634 Rhizobium anhuiense S10 Isolate Nodule
389 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
390 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
391 2802429637 Rhizobium anhuiense C15 Isolate Nodule
392 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
393 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
394 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
395 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
396 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
397 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
398 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
399 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
400 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
401 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
402 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
403 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
404 2838048938 Rhizobium pisi 27/80 Isolate Nodule
405 2838061910 Rhizobium phaseoli L15 Isolate Nodule
406 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
407 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
408 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
409 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
410 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
411 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
412 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
413 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
414 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
415 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
416 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
417 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
418 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
419 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
420 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
421 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
422 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
423 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
424 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
425 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
426 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
427 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
428 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
429 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
430 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
431 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
432 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
433 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
434 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
435 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
436 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
437 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
438 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
439 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
440 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
441 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
442 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
443 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
444 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
445 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
446 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
447 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
448 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
449 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
450 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
451 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
452 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
453 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
454 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
455 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
456 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
457 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
458 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
459 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
460 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
461 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
462 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
463 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
464 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
465 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
466 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
467 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
468 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
469 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
470 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
471 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
472 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
473 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
474 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
475 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
476 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
477 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
478 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
479 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
480 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
481 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
482 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
483 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
484 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
485 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
486 2844163670 Ensifer sp. 1H6 Isolate Unclassified
487 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
488 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
489 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
490 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
491 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
492 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
493 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
494 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
495 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
496 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
497 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
498 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
499 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
500 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
501 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
502 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
503 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
504 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
505 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
506 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
507 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
508 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
509 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
510 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
511 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
512 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
513 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
514 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
515 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
516 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
517 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
518 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
519 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
520 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
521 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
522 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
523 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
524 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
525 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
526 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
527 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
528 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
529 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
530 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
531 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
532 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
533 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
534 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
535 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
536 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
537 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
538 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
539 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
540 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
541 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
542 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
543 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
544 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
545 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
546 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
547 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
548 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
549 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
550 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
551 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
552 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
553 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
554 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
555 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
556 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
557 2933599457 Rhizobium phaseoli M3 Isolate Nodule
558 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
559 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
560 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
561 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
562 2936381700 Rhizobium chutanense C16 Isolate Unclassified
563 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
564 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
565 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
566 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
567 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
568 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
569 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
570 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
571 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
572 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
573 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
574 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
575 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
576 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
577 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
578 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
579 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
580 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
581 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
582 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
583 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
584 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
585 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
586 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
587 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
588 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
589 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
590 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
591 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
592 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
593 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
594 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
595 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
596 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
597 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
598 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
599 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
600 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
601 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
602 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
603 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
604 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
605 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
606 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
607 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
608 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
609 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
610 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
611 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
612 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
613 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
614 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
615 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
616 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
617 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
618 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
619 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
620 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
621 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
622 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
623 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
624 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
625 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
626 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
627 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
628 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
629 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
630 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
631 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
632 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
633 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
634 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
635 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
636 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
637 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
638 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
639 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
640 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
641 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
642 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
643 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
644 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
645 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
646 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
647 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
648 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
649 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
650 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
651 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
652 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
653 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
654 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
655 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
656 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
657 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
658 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
659 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
660 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
661 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
662 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
663 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
664 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
665 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
666 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
667 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
668 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
669 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
670 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
671 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
672 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
673 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
674 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
675 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
676 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
677 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
678 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
679 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
680 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
681 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
682 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
683 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
684 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
685 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
686 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
687 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
688 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
689 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
690 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
691 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
692 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
693 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
694 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
695 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
696 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
697 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
698 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
699 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
700 2996887358 Rhizobium sp. R711 Isolate Nodule
701 2996893221 Rhizobium sp. R635 Isolate Nodule
702 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
703 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
704 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
705 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
706 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
707 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
708 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
709 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
710 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
711 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
712 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
713 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
714 8005258706 Rhizobium sp. R693 Isolate Nodule
715 8005275841 Rhizobium sp. N4311 Isolate Nodule
716 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
717 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
718 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
719 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
720 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
721 8005321885 Rhizobium sp. R72 Isolate Nodule
722 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
723 8005382845 Rhizobium sp. R634 Isolate Nodule
724 8005395548 Rhizobium sp. R339 Isolate Nodule
725 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
726 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
727 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
728 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
729 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
730 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
731 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
732 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
733 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
734 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
735 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
736 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
737 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
738 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
739 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
740 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
741 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
742 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
743 8018176218 Rhizobium sp. N122 Isolate Nodule
744 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
745 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
746 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
747 8024501048 Rhizobium sp. H4 Isolate Nodule
748 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
749 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
750 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
751 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
752 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
753 8056382006 Rhizobium croatiense 13T Isolate Nodule
754 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
755 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.25
Metatranscriptomes 0.32
Isolates 60.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 16.9
Nodule 45.99
Rhizoplane 1.28
Rhizosphere 17.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0000953 3300048928 Bacteria 45480
2 JGI24740J21852_10001389 3300001979 Bacteria 11052
3 JGI25155J39150_1000011 3300002704 Bacteria 207685
4 JGI25156J39149_1000030 3300002705 Bacteria 126029
5 JGI25154J39366_1000289 3300002738 Bacteria 30213
6 JGI25158J39367_1000167 3300002739 Bacteria 15671
7 JGI25157J39369_1000010 3300002741 Bacteria 207685
8 JGI25152J39213_1008181 3300002773 Bacteria 2621
9 JGI25159J45721_1000029 3300002987 Bacteria 105868
10 JGI25159J45721_1001125 3300002987 Bacteria 11424
11 JGI25159J45721_1001806 3300002987 Bacteria 8584
12 JGI25151J46595_10003454 3300003187 Bacteria 8727
13 JGI25151J46595_10004048 3300003187 Bacteria 7862
14 JGI25151J46595_10005052 3300003187 Bacteria 6869
15 JGI25151J46595_10005103 3300003187 Bacteria 6822
16 JGI25165J46597_1006781 3300003214 Bacteria 1987
17 JGI25153J46596_10004316 3300003215 Bacteria 7687
18 JGI25153J46596_10011346 3300003215 Bacteria 3943
19 JGI25160J50197_1000004 3300003354 Bacteria 419797
20 JGI25160J50197_1000011 3300003354 Bacteria 275577
21 JGI25160J50197_1000593 3300003354 Bacteria 20289
22 JGI25161J50226_1000003 3300003374 Bacteria 413345
23 JGI25161J50226_1001956 3300003374 Bacteria 5662
24 JGI25161J50226_1002628 3300003374 Bacteria 4505
25 Ga0006562J51391_1060468 3300003578 Bacteria 3100
26 Ga0055526_1001995 3300003771 Bacteria 14058
27 Ga0055526_1003733 3300003771 Bacteria 9506
28 Ga0055526_1006958 3300003771 Bacteria 6004
29 Ga0055526_1010214 3300003771 Bacteria 4395
30 Ga0055526_1010394 3300003771 Bacteria 4335
31 Ga0055526_1021566 3300003771 Bacteria 2234
32 Ga0055524_1003862 3300003775 Bacteria 7107
33 Ga0055524_1013014 3300003775 Bacteria 3162
34 Ga0055524_1020480 3300003775 Bacteria 2226
35 Ga0055524_1028237 3300003775 Bacteria 1685
36 Ga0055536_1000356 3300003781 Bacteria 34069
37 Ga0055528_1001267 3300003790 Bacteria 15948
38 Ga0055528_1001601 3300003790 Bacteria 13382
39 Ga0055528_1005825 3300003790 Bacteria 5664
40 Ga0055528_1013134 3300003790 Bacteria 3162
41 Ga0055528_1015466 3300003790 Bacteria 2754
42 Ga0055540_1000177 3300003792 Bacteria 62976
43 Ga0055531_10003828 3300003794 Bacteria 9428
44 Ga0055531_10003846 3300003794 Bacteria 9402
45 Ga0058692_1002330 3300003856 Bacteria 6416
46 Ga0055543_1000001 3300004625 Bacteria 419949
47 Ga0055543_1000097 3300004625 Bacteria 75364
48 Ga0055543_1000255 3300004625 Bacteria 40071
49 Ga0055543_1001144 3300004625 Bacteria 11331
50 Ga0065165_1000018 3300005262 Bacteria 275082
51 Ga0065165_1023781 3300005262 Bacteria 2070
52 Ga0070658_10212360 3300005327 Bacteria 1635
53 Ga0070670_100000535 3300005331 Bacteria 30434
54 Ga0070670_100065176 3300005331 Bacteria 3126
55 Ga0070671_100033264 3300005355 Bacteria 4263
56 Ga0070665_100107355 3300005548 Bacteria 2794
57 Ga0068855_100109341 3300005563 Bacteria 3175
58 Ga0068856_100032523 3300005614 Bacteria 5106
59 Ga0075365_10005053 3300006038 Bacteria 7078
60 Ga0075365_10012329 3300006038 Bacteria 5071
61 Ga0075368_10002095 3300006042 Bacteria 6447
62 Ga0075364_10000043 3300006051 Bacteria 44079
63 Ga0075364_10129542 3300006051 Bacteria 1693
64 Ga0075362_10011839 3300006177 Bacteria 3446
65 Ga0075362_10012116 3300006177 Bacteria 3416
66 Ga0075367_10032147 3300006178 Bacteria 3017
67 Ga0075369_10009230 3300006186 Bacteria 3825
68 Ga0075366_10021694 3300006195 Bacteria 3734
69 Ga0075370_10001750 3300006353 Bacteria 9672
70 Ga0079104_1000022 3300006946 Bacteria 223522
71 Ga0079104_1001402 3300006946 Bacteria 16290
72 Ga0099826_10000090 3300006948 Bacteria 44830
73 Ga0099826_10004510 3300006948 Bacteria 9777
74 Ga0105251_10020317 3300009011 Bacteria 3491
75 Ga0105240_10000005 3300009093 Bacteria 702630
76 Ga0105243_10089667 3300009148 Bacteria 2529
77 Ga0105237_10000773 3300009545 Bacteria 43739
78 Ga0123341_1000049 3300009765 Bacteria 49561
79 Ga0105239_10004008 3300010375 Bacteria 17836
80 Ga0157373_10002285 3300013100 Bacteria 14521
81 Ga0157373_10131447 3300013100 Bacteria 1760
82 Ga0157371_10000015 3300013102 Bacteria 339838
83 Ga0157371_10005986 3300013102 Bacteria 10143
84 Ga0157370_10000992 3300013104 Bacteria 35815
85 Ga0157370_10003013 3300013104 Bacteria 20000
86 Ga0157370_10017734 3300013104 Bacteria 7177
87 Ga0157369_10050141 3300013105 Bacteria 4522
88 Ga0157369_10145335 3300013105 Bacteria 2508
89 Ga0171463_1008 3300013249 Bacteria 299022
90 Ga0182007_10000618 3300015262 Bacteria 20687
91 Ga0182005_1018412 3300015265 Bacteria 1930
92 Ga0183363_1281 3300015690 Bacteria 7689
93 Ga0214544_1000129 3300021320 Bacteria 108948
94 Ga0214542_1000828 3300021321 Bacteria 59640
95 Ga0214542_1027439 3300021321 Bacteria 2608
96 Ga0214543_1000010 3300021327 Bacteria 364844
97 Ga0214543_1000134 3300021327 Bacteria 102056
98 Ga0213872_10022695 3300021361 Bacteria 2888
99 Ga0228711_1002680 3300022739 Bacteria 27471
100 Ga0228710_1002851 3300022740 Bacteria 27471
101 Ga0209435_100022 3300025206 Bacteria 207766
102 Ga0209436_100507 3300025208 Bacteria 17013
103 Ga0209437_100122 3300025233 Bacteria 201364
104 Ga0209437_100160 3300025233 Bacteria 149451
105 Ga0207425_1008820 3300025245 Bacteria 2549
106 Ga0207425_1009643 3300025245 Bacteria 2391
107 Ga0209646_1000078 3300025246 Bacteria 207766
108 Ga0209646_1003812 3300025246 Bacteria 2878
109 Ga0209026_1000065 3300025250 Bacteria 207766
110 Ga0209759_1000055 3300025256 Bacteria 207766
111 Ga0209129_1000127 3300025258 Bacteria 133263
112 Ga0209129_1001042 3300025258 Bacteria 16374
113 Ga0209129_1001442 3300025258 Bacteria 13289
114 Ga0209129_1002372 3300025258 Bacteria 9286
115 Ga0209129_1012798 3300025258 Bacteria 1892
116 Ga0209129_1012818 3300025258 Bacteria 1889
117 Ga0209233_1000168 3300025261 Bacteria 149312
118 Ga0209233_1000170 3300025261 Bacteria 147527
119 Ga0209233_1001127 3300025261 Bacteria 10903
120 Ga0209673_1000139 3300025273 Bacteria 157765
121 Ga0209673_1001327 3300025273 Bacteria 24841
122 Ga0209673_1002230 3300025273 Bacteria 14043
123 Ga0209673_1003846 3300025273 Bacteria 8482
124 Ga0209673_1004486 3300025273 Bacteria 7455
125 Ga0209673_1004582 3300025273 Bacteria 7327
126 Ga0209130_1000012 3300025284 Bacteria 421329
127 Ga0209130_1000029 3300025284 Bacteria 323399
128 Ga0209130_1000097 3300025284 Bacteria 143750
129 Ga0209130_1008169 3300025284 Bacteria 3122
130 Ga0209676_1000438 3300025292 Bacteria 71339
131 Ga0209676_1007877 3300025292 Bacteria 4893
132 Ga0209676_1016797 3300025292 Bacteria 2623
133 Ga0209025_1000033 3300025294 Bacteria 414511
134 Ga0209025_1000563 3300025294 Bacteria 68086
135 Ga0209025_1001678 3300025294 Bacteria 27100
136 Ga0209025_1001703 3300025294 Bacteria 26799
137 Ga0209025_1003459 3300025294 Bacteria 14911
138 Ga0209025_1010390 3300025294 Bacteria 6311
139 Ga0209564_1000105 3300025295 Bacteria 218124
140 Ga0209564_1000275 3300025295 Bacteria 107884
141 Ga0209564_1000986 3300025295 Bacteria 35645
142 Ga0209564_1001528 3300025295 Bacteria 22999
143 Ga0209564_1001611 3300025295 Bacteria 21903
144 Ga0209564_1022689 3300025295 Bacteria 2207
145 Ga0209758_1000505 3300025297 Bacteria 63185
146 Ga0209758_1000534 3300025297 Bacteria 60556
147 Ga0209758_1000805 3300025297 Bacteria 44274
148 Ga0209758_1001745 3300025297 Bacteria 24202
149 Ga0209758_1003872 3300025297 Bacteria 13105
150 Ga0209758_1007599 3300025297 Bacteria 7316
151 Ga0209758_1020108 3300025297 Bacteria 3178
152 Ga0209050_1000516 3300025298 Bacteria 64933
153 Ga0209050_1004356 3300025298 Bacteria 9613
154 Ga0209256_1001255 3300025299 Bacteria 27934
155 Ga0209256_1001768 3300025299 Bacteria 20511
156 Ga0209256_1002167 3300025299 Bacteria 16908
157 Ga0209256_1003073 3300025299 Bacteria 12267
158 Ga0209256_1008787 3300025299 Bacteria 4594
159 Ga0209256_1009219 3300025299 Bacteria 4372
160 Ga0209256_1042308 3300025299 Bacteria 1151
161 Ga0207426_1000003 3300025302 Bacteria 1063212
162 Ga0207426_1000010 3300025302 Bacteria 796003
163 Ga0207426_1000074 3300025302 Bacteria 323399
164 Ga0207426_1000290 3300025302 Bacteria 99519
165 Ga0207426_1000408 3300025302 Bacteria 72326
166 Ga0209051_1000125 3300025303 Bacteria 142863
167 Ga0209051_1003377 3300025303 Bacteria 10501
168 Ga0209051_1004697 3300025303 Bacteria 8308
169 Ga0209051_1036652 3300025303 Bacteria 1808
170 Ga0209051_1039840 3300025303 Bacteria 1691
171 Ga0209257_1009229 3300025304 Bacteria 5347
172 Ga0207695_10000011 3300025913 Bacteria 910221
173 Ga0207671_10004599 3300025914 Bacteria 13104
174 Ga0207650_10014417 3300025925 Bacteria 5494
175 Ga0207650_10118692 3300025925 Bacteria 2057
176 Ga0207678_10064346 3300026067 Bacteria 3151
177 Ga0207702_10009685 3300026078 Bacteria 8090
178 Ga0209281_1000036 3300027111 Bacteria 369415
179 Ga0209281_1000047 3300027111 Bacteria 326514
180 Ga0209281_1000508 3300027111 Bacteria 51432
181 Ga0209281_1004020 3300027111 Bacteria 4553
182 Ga0209371_1000178 3300027312 Bacteria 93894
183 Ga0209371_1000382 3300027312 Bacteria 47344
184 Ga0209282_1000116 3300027666 Bacteria 51432
185 Ga0209282_1000235 3300027666 Bacteria 28597
186 Ga0209282_1075229 3300027666 Bacteria 1823
187 Ga0268266_10059721 3300028379 Bacteria 3285
188 Ga0268266_10076615 3300028379 Bacteria 2907
189 Ga0268265_10077564 3300028380 Bacteria 2610
190 Ga0265318_10031724 3300028577 Bacteria 2048
191 Ga0307515_10000233 3300028794 Bacteria 137311
192 Ga0307515_10000569 3300028794 Bacteria 87068
193 Ga0307515_10013071 3300028794 Bacteria 15547
194 Ga0307515_10095379 3300028794 Bacteria 3662
195 Ga0268256_1000251 3300030500 Bacteria 56750
196 Ga0268256_1006569 3300030500 Bacteria 4299
197 Ga0265331_10001061 3300031250 Bacteria 21420
198 Ga0307513_10000588 3300031456 Bacteria 52189
199 Ga0307513_10021520 3300031456 Bacteria 7611
200 Ga0307408_100129754 3300031548 Bacteria 1965
201 Ga0265314_10091276 3300031711 Bacteria 1983
202 Ga0307405_10026000 3300031731 Bacteria 3370
203 Ga0307406_10006937 3300031901 Bacteria 6274
204 Ga0307412_10000449 3300031911 Bacteria 24913
205 Ga0315914_1002646 3300031967 Bacteria 27416
206 Ga0316593_10020427 3300032168 Bacteria 2059
207 Ga0315913_1001232 3300033430 Bacteria 27471
208 Ga0315915_1000058 3300033464 Bacteria 72461
209 Ga0373935_0084405 3300035692 Bacteria 2069
210 Ga0373927_0002488 3300035695 Bacteria 13446
211 Ga0316584_0168452 3300036712 Bacteria 1626
212 Ga0373925_0001826 3300037068 Bacteria 17766
213 Ga0395905_0000386 3300037471 Bacteria 62786
214 Ga0395905_0011890 3300037471 Bacteria 8400
215 Ga0436361_0388638 3300039447 Bacteria 3153
216 Ga0439436_0020716 3300041404 Bacteria 1957
217 Ga0439465_0002627 3300041413 Bacteria 5866
218 Ga0439465_0012232 3300041413 Bacteria 2686
219 Ga0451833_0326332 3300041491 Bacteria 2197
220 Ga0451839_0624369 3300041496 Bacteria 1354
221 Ga0451839_1171986 3300041496 Bacteria 5799
222 Ga0451845_0406102 3300041501 Bacteria 4920
223 Ga0451849_1391146 3300041505 Bacteria 4223
224 Ga0451851_0083156 3300041507 Bacteria 1585
225 Ga0451851_0085829 3300041507 Bacteria 2107
226 Ga0451851_1152225 3300041507 Bacteria 1972
227 Ga0451843_0892284 3300041509 Bacteria 2229
228 Ga0439442_022028 3300042002 Bacteria 1322
229 Ga0439449_0005586 3300042007 Bacteria 4813
230 Ga0439449_0041569 3300042007 Bacteria 1709
231 Ga0439462_0019440 3300042015 Bacteria 1768
232 Ga0466968_0033665 3300044735 Bacteria 2136
233 Ga0495638_0001886 3300046460 Bacteria 18129
234 Ga0495638_0034607 3300046460 Bacteria 3225
235 Ga0495662_0037834 3300046476 Bacteria 2331
236 Ga0495585_0066062 3300046492 Bacteria 1981
237 Ga0495585_0106093 3300046492 Bacteria 1498
238 Ga0495607_0127700 3300046501 Bacteria 1327
239 Ga0495583_0051972 3300046506 Bacteria 1866
240 Ga0495583_0076388 3300046506 Bacteria 1463
241 Ga0495606_0002073 3300046507 Bacteria 24490
242 Ga0495606_0029987 3300046507 Bacteria 3809
243 Ga0495620_0028632 3300046515 Bacteria 2588
244 Ga0495628_0059749 3300046516 Bacteria 2992
245 Ga0495631_0080968 3300046518 Bacteria 1401
246 Ga0495632_0050841 3300046519 Bacteria 2042
247 Ga0495643_0027844 3300046522 Bacteria 3172
248 Ga0495643_0078683 3300046522 Bacteria 1720
249 Ga0495654_0003690 3300046530 Bacteria 9293
250 Ga0495622_0046432 3300046557 Bacteria 2018
251 Ga0495633_0001025 3300046558 Bacteria 22844
252 Ga0495668_0006310 3300046616 Bacteria 7806
253 Ga0495611_0041726 3300046648 Bacteria 2047
254 Ga0495625_0038361 3300046660 Bacteria 3508
255 Ga0495625_0119427 3300046660 Bacteria 1795
256 Ga0495625_0185123 3300046660 Bacteria 1382
257 Ga0495635_0142511 3300046663 Bacteria 1632
258 Ga0495588_0020089 3300046674 Bacteria 3277
259 Ga0495658_0054226 3300046683 Bacteria 2280
260 Ga0495613_0003033 3300046689 Bacteria 12563
261 Ga0495649_0103253 3300046694 Bacteria 1514
262 Ga0495660_0071744 3300046810 Bacteria 1835
263 Ga0495604_0013679 3300047317 Bacteria 6471
264 Ga0495687_068952 3300047443 Bacteria 1426
265 Ga0495681_0077664 3300047470 Bacteria 1489
266 Ga0495686_0002178 3300047472 Bacteria 19063
267 Ga0495686_0005411 3300047472 Bacteria 10084
268 Ga0496106_0000478 3300048909 Bacteria 28406
269 Ga0496111_0003975 3300048914 Bacteria 9283
270 Ga0496114_0335013 3300048917 Bacteria 1338
271 Ga0496116_0000232 3300048919 Bacteria 103015
272 Ga0496116_0019844 3300048919 Bacteria 5131
273 Ga0496116_0083325 3300048919 Bacteria 1975
274 Ga0496116_0097864 3300048919 Bacteria 1762
275 Ga0496116_0101076 3300048919 Bacteria 1722
276 Ga0496117_0000002 3300048920 Bacteria 2483758
277 Ga0496117_0002298 3300048920 Bacteria 24600
278 Ga0496117_0011144 3300048920 Bacteria 8082
279 Ga0496118_0000460 3300048921 Bacteria 67445
280 Ga0496118_0003956 3300048921 Bacteria 18115
281 Ga0496118_0020559 3300048921 Bacteria 5850
282 Ga0496118_0071214 3300048921 Bacteria 2504
283 Ga0496118_0109262 3300048921 Bacteria 1841
284 Ga0496119_0012076 3300048922 Bacteria 7058
285 Ga0496119_0012145 3300048922 Bacteria 7030
286 Ga0496119_0023760 3300048922 Bacteria 4335
287 Ga0496119_0047784 3300048922 Bacteria 2659
288 Ga0496120_0000078 3300048923 Bacteria 162312
289 Ga0496120_0006355 3300048923 Bacteria 9088
290 Ga0496121_0000001 3300048924 Bacteria 1830318
291 Ga0496121_0002309 3300048924 Bacteria 29564
292 Ga0496121_0005949 3300048924 Bacteria 15422
293 Ga0496121_0009598 3300048924 Bacteria 11087
294 Ga0496121_0010507 3300048924 Bacteria 10428
295 Ga0496121_0081738 3300048924 Bacteria 2556
296 Ga0496121_0087328 3300048924 Bacteria 2448
297 Ga0496122_0000001 3300048925 Bacteria 1827766
298 Ga0496122_0006684 3300048925 Bacteria 13133
299 Ga0496122_0011586 3300048925 Bacteria 8900
300 Ga0496122_0012223 3300048925 Bacteria 8585
301 Ga0496122_0052212 3300048925 Bacteria 3097
302 Ga0496122_0100963 3300048925 Bacteria 1929
303 Ga0496122_0113931 3300048925 Bacteria 1765
304 Ga0496122_0118521 3300048925 Bacteria 1715
305 Ga0496122_0124634 3300048925 Bacteria 1652
306 Ga0496123_0000001 3300048926 Bacteria 1831497
307 Ga0496123_0000032 3300048926 Bacteria 285282
308 Ga0496123_0000512 3300048926 Bacteria 67458
309 Ga0496123_0005232 3300048926 Bacteria 13181
310 Ga0496123_0050289 3300048926 Bacteria 2786
311 Ga0496123_0076430 3300048926 Bacteria 2061
312 Ga0496123_0076538 3300048926 Bacteria 2059
313 Ga0496124_0000377 3300048927 Bacteria 81321
314 Ga0496124_0004853 3300048927 Bacteria 15467
315 Ga0496124_0014237 3300048927 Bacteria 7705
316 Ga0496124_0093699 3300048927 Bacteria 2444
317 Ga0496124_0127798 3300048927 Bacteria 2023
318 Ga0496124_0231886 3300048927 Bacteria 1379
319 Ga0496125_0000155 3300048928 Bacteria 151541
320 Ga0496125_0053841 3300048928 Bacteria 3294
321 Ga0496126_0001369 3300048929 Bacteria 38538
322 Ga0496126_0052656 3300048929 Bacteria 3698
323 Ga0496126_0230043 3300048929 Bacteria 1553
324 Ga0501034_0254277 3300049571 Bacteria 1701
325 Ga0501036_0201895 3300049572 Bacteria 1672
326 Ga0501037_0154721 3300049573 Bacteria 1637
327 Ga0501070_0084565 3300049586 Bacteria 2626
328 Ga0501073_0017851 3300049589 Bacteria 5136
329 Ga0501035_0029163 3300049822 Bacteria 5032
330 Ga0501035_0208503 3300049822 Bacteria 1673
331 Ga0501035_0348446 3300049822 Bacteria 1240
332 nmdc:mga03683_3419_c1 3300050489 Bacteria 5117
333 nmdc:mga03n38_26274_c1 3300050490 Bacteria 2403
334 nmdc:mga00v17_203_c1 3300050491 Bacteria 35824
335 nmdc:mga00v17_3726_c1 3300050491 Bacteria 7867
336 nmdc:mga00v17_68969_c1 3300050491 Bacteria 2187
337 nmdc:mga0yw44_697_c1 3300050492 Bacteria 12311
338 nmdc:mga0yw44_95712_c1 3300050492 Bacteria 1884
339 nmdc:mga0k408_112515_c1 3300050493 Bacteria 1610
340 nmdc:mga0k408_25595_c1 3300050493 Bacteria 3342
341 nmdc:mga0sz30_14502_c1 3300050516 Bacteria 3104
342 nmdc:mga0sz30_16497_c1 3300050516 Bacteria 2935
343 nmdc:mga0sz30_4182_c1 3300050516 Bacteria 5200
344 Ga0500643_023318 3300053087 Bacteria 1978
345 Ga0500556_0081163 3300053104 Bacteria 1226
346 Ga0500560_001846 3300053107 Bacteria 3841
347 Ga0500572_000849 3300053111 Bacteria 9526
348 Ga0500572_003892 3300053111 Bacteria 3396
349 Ga0500618_002786 3300053125 Bacteria 6338
350 Ga0500618_009375 3300053125 Bacteria 2674
351 Ga0500618_018902 3300053125 Bacteria 1700
352 Ga0500658_0000485 3300053134 Bacteria 17014
353 Ga0500658_0012162 3300053134 Bacteria 3170
354 Ga0500559_0062107 3300053136 Bacteria 1667
355 Ga0500561_0002360 3300053137 Bacteria 3169
356 Ga0500568_0003249 3300053139 Bacteria 9186
357 Ga0500577_0078061 3300053142 Bacteria 1314
358 Ga0500616_0002587 3300053153 Bacteria 14874
359 Ga0500616_0011140 3300053153 Bacteria 5338
360 Ga0500622_0000378 3300053156 Bacteria 42912
361 Ga0500622_0000778 3300053156 Bacteria 27680
362 Ga0500622_0039798 3300053156 Bacteria 2451
363 Ga0500622_0124327 3300053156 Bacteria 1247
364 Ga0500624_001373 3300053157 Bacteria 4077
365 Ga0500634_0010832 3300053161 Bacteria 4674
366 Ga0500636_0000123 3300053177 Bacteria 40230
367 Ga0500636_0001081 3300053177 Bacteria 14582
368 Ga0500636_0059250 3300053177 Bacteria 2238
369 Ga0500645_000972 3300053730 Bacteria 16288
370 Ga0587090_000719 3300059510 Bacteria 2967
371 2509107650 2508501122 Bacteria 6292184
372 2509375988 2509276019 Bacteria 6802256
373 2509386920 2509276021 Bacteria 7634384
374 2509442448 2509276033 Bacteria 7180565
375 2510133052 2510065019 Bacteria 6903379
376 2510308661 2510065057 Bacteria 6649661
377 2510843005 2510461069 Bacteria 5505000
378 2510899441 2510461076 Bacteria 8618824
379 2511134929 2510917022 Bacteria 6504556
380 2511172608 2510917026 Bacteria 7046020
381 2511183744 2510917028 Bacteria 6185411
382 2511193389 2510917030 Bacteria 7460662
383 2511501507 2511231052 Bacteria 6974333
384 2512532933 2512047086 Bacteria 6850303
385 2512971740 2512875026 Bacteria 6861065
386 2513569867 2513237084 Bacteria 7231967
387 2513575135 2513237085 Bacteria 7695351
388 2513588110 2513237086 Bacteria 7265287
389 2513594390 2513237088 Bacteria 6927906
390 2513605270 2513237089 Bacteria 6553624
391 2513618701 2513237091 Bacteria 6900273
392 2513635602 2513237093 Bacteria 7545552
393 2513713454 2513237103 Bacteria 7647401
394 2513866995 2513237138 Bacteria 7368160
395 2513886969 2513237140 Bacteria 7076289
396 2513907204 2513237143 Bacteria 6664116
397 2513909862 2513237144 Bacteria 7530820
398 2513926641 2513237146 Bacteria 7166346
399 2513987068 2513237156 Bacteria 6402557
400 2513997346 2513237159 Bacteria 6810126
401 2514005288 2513237160 Bacteria 6650282
402 2514021856 2513237162 Bacteria 7468464
403 2515112002 2515075009 Bacteria 7288508
404 2515611352 2515154107 Bacteria 6795637
405 2515633798 2515154113 Bacteria 7807172
406 2515645037 2515154114 Bacteria 7848616
407 2515660179 2515154116 Bacteria 7552979
408 2515738816 2515154134 Bacteria 7220242
409 2516209510 2516143018 Bacteria 6951533
410 2516892825 2516653046 Bacteria 6989037
411 2517035738 2516653077 Bacteria 7555578
412 2517076162 2516653085 Bacteria 7346596
413 2517094906 2517093000 Bacteria 7412387
414 2517406535 2517287029 Bacteria 6905599
415 2517569600 2517487022 Bacteria 7227575
416 2524453661 2524023207 Bacteria 6813453
417 2524460459 2524023209 Bacteria 6679728
418 2530645302 2529292951 Bacteria 6916614
419 2535484818 2534681786 Bacteria 3308809
420 2535516275 2534681796 Bacteria 7146037
421 2537877784 2537561587 Bacteria 5425293
422 2551674252 2551306084 Bacteria 8942552
423 2551680404 2551306084 Bacteria 8942552
424 2551686544 2551306085 Bacteria 7347181
425 2551691823 2551306086 Bacteria 6843938
426 2551699773 2551306087 Bacteria 7351905
427 2551711741 2551306089 Bacteria 7162724
428 2551719508 2551306090 Bacteria 7953713
429 2551729148 2551306091 Bacteria 7086830
430 2551737098 2551306092 Bacteria 6992595
431 2551742525 2551306093 Bacteria 7064773
432 2554247754 2554235003 Bacteria 5877155
433 2558868261 2558860100 Bacteria 8458965
434 2559294887 2558860242 Bacteria 5568029
435 2561466505 2558860983 Bacteria 4133860
436 2585168470 2582581283 Bacteria 6030556
437 2585199960 2582581294 Bacteria 6626667
438 2585225792 2582581298 Bacteria 7315509
439 2585233553 2582581299 Bacteria 6518058
440 2585254507 2582581304 Bacteria 5831370
441 2585270044 2582581306 Bacteria 6450535
442 2585270669 2582581307 Bacteria 6597605
443 2585277010 2582581308 Bacteria 7413247
444 2585323984 2582581315 Bacteria 7318924
445 2585333619 2582581316 Bacteria 7774528
446 2585389749 2582581865 Bacteria 6644329
447 2585393716 2582581866 Bacteria 6859583
448 2585403453 2582581867 Bacteria 7184437
449 2585528318 2585427526 Bacteria 7258840
450 2585537020 2585427527 Bacteria 7273426
451 2585540495 2585427528 Bacteria 6842387
452 2585546752 2585427529 Bacteria 7395659
453 2585551871 2585427530 Bacteria 7383882
454 2585558372 2585427531 Bacteria 6992870
455 2585819579 2585427590 Bacteria 6824633
456 2585838711 2585427593 Bacteria 7141551
457 2585846561 2585427594 Bacteria 6180594
458 2585897767 2585427608 Bacteria 6544331
459 2585904639 2585427609 Bacteria 6667127
460 2585995875 2585427633 Bacteria 6413184
461 2586000440 2585427634 Bacteria 6455027
462 2587980245 2585428125 Bacteria 6662905
463 2599336303 2599185156 Bacteria 5403036
464 2599417930 2599185170 Bacteria 7295545
465 2599604148 2599185210 Bacteria 5624189
466 2599721501 2599185236 Bacteria 6875203
467 2600197125 2599185352 Bacteria 7228948
468 2600375810 2600254933 Bacteria 4750527
469 2601608059 2600255279 Bacteria 5605316
470 2601744834 2600255308 Bacteria 5611129
471 2616292685 2615840624 Bacteria 6557588
472 2616308384 2615840626 Bacteria 7921970
473 2616556548 2615840698 Bacteria 7319877
474 2617385873 2617270742 Bacteria 6808054
475 2643808722 2643221557 Bacteria 7184309
476 2643811901 2643221558 Bacteria 5460675
477 2643857685 2643221568 Bacteria 5187270
478 2643919378 2643221582 Bacteria 5804683
479 2644001960 2643221598 Bacteria 4578346
480 2644005060 2643221599 Bacteria 6292121
481 2644049364 2643221607 Bacteria 6314006
482 2644066256 2643221610 Bacteria 7480339
483 2644107978 2643221618 Bacteria 7717186
484 2644148350 2643221626 Bacteria 8069654
485 2644192901 2643221634 Bacteria 6705461
486 2644204297 2643221636 Bacteria 6583769
487 2644210481 2643221637 Bacteria 5345260
488 2644239387 2643221643 Bacteria 5749658
489 2644309372 2643221655 Bacteria 7722067
490 2644333198 2643221659 Bacteria 7890716
491 2644377796 2643221668 Bacteria 7306521
492 2644415531 2643221675 Bacteria 7473456
493 2644450067 2643221680 Bacteria 7473610
494 2644482398 2643221686 Bacteria 6310811
495 2644494478 2643221688 Bacteria 5260751
496 2644502051 2643221689 Bacteria 6042950
497 2644522280 2643221693 Bacteria 5513853
498 2644545630 2643221698 Bacteria 7756764
499 2644615314 2643221712 Bacteria 7729434
500 2644654033 2643221718 Bacteria 5345506
501 2644658693 2643221719 Bacteria 4568197
502 2644673621 2643221723 Bacteria 7095460
503 2644687624 2643221726 Bacteria 7455827
504 2657683822 2657244999 Bacteria 5946535
505 2671115785 2667528174 Bacteria 6435400
506 2692316028 2690316117 Bacteria 6800650
507 2719180960 2718217882 Bacteria 6556348
508 2719385560 2718217927 Bacteria 6972593
509 2719665382 2718217997 Bacteria 6740740
510 2719731709 2718218009 Bacteria 6478651
511 2720491802 2718218199 Bacteria 6740745
512 2720613071 2718218232 Bacteria 6720332
513 2720619924 2718218233 Bacteria 6662049
514 2720631350 2718218235 Bacteria 6630699
515 2720775077 2718218269 Bacteria 6906114
516 2721147054 2718218363 Bacteria 6524337
517 2721158582 2718218365 Bacteria 6274507
518 2721163972 2718218366 Bacteria 6425255
519 2721399308 2718218423 Bacteria 6438183
520 2722840142 2721755514 Bacteria 6424414
521 2723026714 2721755556 Bacteria 6745503
522 2723560331 2721755684 Bacteria 6859907
523 2723566897 2721755685 Bacteria 6704835
524 2724038121 2721755809 Bacteria 6438790
525 2724044465 2721755810 Bacteria 6479005
526 2724089684 2721755819 Bacteria 6906405
527 2724104162 2721755822 Bacteria 6726041
528 2724109971 2721755823 Bacteria 6752556
529 2725948736 2724679232 Bacteria 7646494
530 2730107650 2728369352 Bacteria 6745171
531 2730164197 2728369365 Bacteria 6555560
532 2730298214 2728369397 Bacteria 6274511
533 2738801925 2738541293 Bacteria 7065685
534 2738945592 2738541317 Bacteria 5340176
535 2739037991 2738541333 Bacteria 7106503
536 2739307891 2738543024 Bacteria 5603683
537 2753359426 2751185800 Bacteria 5467370
538 2753458334 2751185821 Bacteria 6189929
539 2758641686 2758568016 Bacteria 5645291
540 2766062931 2765235942 Bacteria 7445910
541 2776913375 2775507049 Bacteria 6284736
542 2778176524 2775507266 Bacteria 7392367
543 2792580744 2791355082 Bacteria 5973319
544 2792619981 2791355091 Bacteria 6135441
545 2792626601 2791355092 Bacteria 6248105
546 2792639537 2791355094 Bacteria 7011481
547 2793279680 2791355253 Bacteria 5171699
548 2793298262 2791355256 Bacteria 6798008
549 2793313743 2791355259 Bacteria 7254731
550 2793324325 2791355260 Bacteria 6598818
551 2793326463 2791355261 Bacteria 6661293
552 2793337048 2791355262 Bacteria 6774204
553 2793341299 2791355263 Bacteria 6872478
554 2793347523 2791355264 Bacteria 6429314
555 2793352412 2791355265 Bacteria 6539969
556 2793361397 2791355266 Bacteria 7116587
557 2793369668 2791355267 Bacteria 7222458
558 2802718738 2802428858 Bacteria 6636079
559 2802726350 2802428859 Bacteria 6667919
560 2802732890 2802428860 Bacteria 6525526
561 2802738245 2802428861 Bacteria 6534206
562 2802744579 2802428862 Bacteria 6633353
563 2802751215 2802428863 Bacteria 6410669
564 2804752085 2802429268 Bacteria 6094027
565 2805927740 2802429605 Bacteria 6875453
566 2805935646 2802429606 Bacteria 6346811
567 2806045384 2802429633 Bacteria 7341974
568 2806055423 2802429634 Bacteria 7083200
569 2806061466 2802429635 Bacteria 7650140
570 2806068040 2802429636 Bacteria 7597525
571 2806072612 2802429637 Bacteria 7067217
572 2808985343 2808606387 Bacteria 5697198
573 2819241893 2818991272 Bacteria 4622173
574 2819559776 2818991439 Bacteria 6907412
575 2819610359 2818991448 Bacteria 6772224
576 2819638101 2818991453 Bacteria 7181617
577 2819684693 2818991461 Bacteria 7026071
578 2821127924 2821123053 Bacteria 7836056
579 2838021143 2838016132 Bacteria 6577831
580 2838025374 2838022645 Bacteria 6494267
581 2838035091 2838029111 Bacteria 6603031
582 2838041556 2838035591 Bacteria 7166484
583 2838043206 2838042994 Bacteria 6046894
584 2838054200 2838048938 Bacteria 6044578
585 2838067853 2838061910 Bacteria 6794874
586 2838071483 2838068647 Bacteria 6208656
587 2838078756 2838074704 Bacteria 6785777
588 2838666301 2838661181 Bacteria 7385261
589 2838670188 2838668709 Bacteria 6671819
590 2838676187 2838675328 Bacteria 4909118
591 2838682462 2838680041 Bacteria 6545511
592 2838689234 2838686498 Bacteria 7807632
593 2838697033 2838694306 Bacteria 6853137
594 2838702559 2838701080 Bacteria 6669771
595 2838709726 2838707686 Bacteria 6619912
596 2838715069 2838714209 Bacteria 5525906
597 2838721131 2838719591 Bacteria 5523910
598 2838725828 2838724970 Bacteria 4908691
599 2838730582 2838729681 Bacteria 7400765
600 2838738348 2838736955 Bacteria 5760694
601 2838743523 2838742623 Bacteria 7396178
602 2841841282 2841840854 Bacteria 5761912
603 2841848088 2841846520 Bacteria 5345850
604 2841854801 2841851746 Bacteria 7532261
605 2841859361 2841859092 Bacteria 5436171
606 2842077900 2842077413 Bacteria 6508645
607 2842110744 2842110456 Bacteria 7656360
608 2842119592 2842118031 Bacteria 7033875
609 2842125882 2842124991 Bacteria 5346824
610 2842131081 2842130223 Bacteria 4909145
611 2842141060 2842140634 Bacteria 5759631
612 2842146896 2842146304 Bacteria 5957337
613 2842153749 2842152218 Bacteria 4908957
614 2842157664 2842156927 Bacteria 6894975
615 2842164861 2842163707 Bacteria 6916235
616 2842171312 2842170452 Bacteria 5525737
617 2842177369 2842175837 Bacteria 4908771
618 2842180751 2842180545 Bacteria 6888678
619 2842188177 2842187318 Bacteria 5524014
620 2842196879 2842192696 Bacteria 6147454
621 2842200942 2842198810 Bacteria 6608673
622 2842206277 2842205361 Bacteria 6340321
623 2842212488 2842211629 Bacteria 5523832
624 2842222968 2842217011 Bacteria 7497767
625 2842225893 2842224351 Bacteria 5524473
626 2842231191 2842229732 Bacteria 7475766
627 2842239139 2842237096 Bacteria 6620661
628 2842244702 2842243621 Bacteria 7421798
629 2842251961 2842250916 Bacteria 6579627
630 2842258515 2842257432 Bacteria 7401195
631 2842268042 2842264693 Bacteria 6472963
632 2842273254 2842271015 Bacteria 7807131
633 2842279734 2842278818 Bacteria 6340002
634 2842287379 2842285085 Bacteria 6011953
635 2842291562 2842291075 Bacteria 7076806
636 2842301789 2842298080 Bacteria 6123127
637 2842310084 2842304105 Bacteria 7023636
638 2842313685 2842311132 Bacteria 6616990
639 2842318145 2842317721 Bacteria 6793725
640 2842347275 2842341865 Bacteria 7003929
641 2842357292 2842357229 Bacteria 6485165
642 2842366540 2842363717 Bacteria 6844742
643 2842373029 2842370503 Bacteria 7038661
644 2842377958 2842377471 Bacteria 7140707
645 2842386101 2842384541 Bacteria 7057858
646 2842397424 2842395702 Bacteria 6780583
647 2842405091 2842402390 Bacteria 6681310
648 2842411674 2842409023 Bacteria 6687331
649 2842417876 2842415677 Bacteria 6596907
650 2842424859 2842422224 Bacteria 6239196
651 2842431739 2842428310 Bacteria 6767288
652 2842438318 2842434925 Bacteria 6502746
653 2842444949 2842441272 Bacteria 6769273
654 2842452267 2842447887 Bacteria 6754142
655 2842466093 2842462802 Bacteria 6588055
656 2842472934 2842469257 Bacteria 6752936
657 2842481857 2842475841 Bacteria 6603183
658 2842487085 2842482326 Bacteria 7212537
659 2842492890 2842489311 Bacteria 6620893
660 2842496415 2842495871 Bacteria 6820686
661 2842508732 2842502639 Bacteria 6604161
662 2842510258 2842509118 Bacteria 6850950
663 2842516145 2842515876 Bacteria 5436280
664 2842522409 2842521101 Bacteria 6569494
665 2842927724 2842922631 Bacteria 5824079
666 2844167286 2844163670 Bacteria 7266046
667 2844459411 2844454524 Bacteria 7952546
668 2847418907 2847417321 Bacteria 6913799
669 2848993944 2848992105 Bacteria 6810864
670 2850081893 2850079185 Bacteria 6848280
671 2852389676 2852387548 Bacteria 8025568
672 2855825602 2855825444 Bacteria 6785811
673 2855840979 2855839649 Bacteria 7135830
674 2855876577 2855872281 Bacteria 6964271
675 2857518469 2857516855 Bacteria 7787325
676 2857534335 2857531043 Bacteria 6754041
677 2858801519 2858800743 Bacteria 6603254
678 2896390625 2896384573 Bacteria 7700774
679 2899794165 2899792073 Bacteria 4926588
680 2899808863 2899803654 Bacteria 5577784
681 2899846536 2899845264 Bacteria 5672268
682 2913301097 2913295892 Bacteria 6333755
683 2913310301 2913308742 Bacteria 5350706
684 2915985346 2915980308 Bacteria 6624279
685 2915987993 2915986958 Bacteria 6739310
686 2915996321 2915993759 Bacteria 7016183
687 2916001462 2916000859 Bacteria 6865702
688 2916010351 2916007675 Bacteria 6898660
689 2916017089 2916014648 Bacteria 6946486
690 2916022488 2916021584 Bacteria 6854472
691 2916029018 2916028427 Bacteria 6748433
692 2916041674 2916035215 Bacteria 6755766
693 2916047886 2916041962 Bacteria 6820487
694 2916054114 2916048683 Bacteria 6543552
695 2916061632 2916055098 Bacteria 6758838
696 2916062311 2916061851 Bacteria 6737736
697 2916071974 2916068649 Bacteria 6943657
698 2916081967 2916076590 Bacteria 6596108
699 2917556789 2917554339 Bacteria 4987857
700 2919107874 2919100787 Bacteria 7710546
701 2919115160 2919114240 Bacteria 5700270
702 2919167865 2919166419 Bacteria 4952238
703 2919175093 2919171160 Bacteria 6499771
704 2919409839 2919408235 Bacteria 6149349
705 2920765913 2920760137 Bacteria 7427611
706 2920824445 2920822456 Bacteria 6897201
707 2921201569 2921201388 Bacteria 6926299
708 2921210265 2921208531 Bacteria 6745326
709 2921239101 2921237296 Bacteria 6876710
710 2921250407 2921244191 Bacteria 6568419
711 2921253991 2921250672 Bacteria 6677771
712 2921257377 2921257292 Bacteria 6808382
713 2921264601 2921263974 Bacteria 6864552
714 2921283378 2921282425 Bacteria 6826397
715 2921293218 2921289301 Bacteria 7316391
716 2923560808 2923556063 Bacteria 6793593
717 2924147431 2924144063 Bacteria 6883928
718 2924151676 2924150972 Bacteria 7169444
719 2924159053 2924158325 Bacteria 7188855
720 2924167818 2924165586 Bacteria 7260590
721 2924176528 2924172951 Bacteria 6749356
722 2924187599 2924186466 Bacteria 6876637
723 2924200312 2924193448 Bacteria 6955718
724 2924203858 2924200457 Bacteria 6757188
725 2924213804 2924207177 Bacteria 6917007
726 2924217102 2924214083 Bacteria 7080103
727 2924224041 2924221636 Bacteria 7113495
728 2924235069 2924228884 Bacteria 6633132
729 2926756206 2926754445 Bacteria 5964435
730 2926760437 2926760298 Bacteria 5505990
731 2929140426 2929138655 Bacteria 5810547
732 2933008395 2933006813 Bacteria 4912075
733 2933013211 2933011516 Bacteria 5439334
734 2933576555 2933570622 Bacteria 7023390
735 2933586770 2933586486 Bacteria 7667493
736 2933597900 2933594066 Bacteria 5594265
737 2933602282 2933599457 Bacteria 5858799
738 2935899101 2935894831 Bacteria 6620579
739 2935904493 2935901341 Bacteria 7341747
740 2936372985 2936367885 Bacteria 7324495
741 2936381136 2936375103 Bacteria 6652732
742 2936386055 2936381700 Bacteria 7006523
743 2936998015 2936996657 Bacteria 6298727
744 2937006150 2937002841 Bacteria 6934057
745 2937012649 2937009748 Bacteria 6746052
746 2937019724 2937016420 Bacteria 6782579
747 2937029344 2937023124 Bacteria 6815156
748 2937032701 2937029754 Bacteria 6424026
749 2937042032 2937036028 Bacteria 6846469
750 2937045847 2937042894 Bacteria 6741576
751 2937051299 2937049772 Bacteria 6757901
752 2937057708 2937056579 Bacteria 7107896
753 2937070789 2937063883 Bacteria 7199456
754 2937077581 2937071275 Bacteria 6984483
755 2937082641 2937078374 Bacteria 6610289
756 2937091439 2937084907 Bacteria 6618516
757 2937095871 2937091812 Bacteria 6979387
758 2937100127 2937098957 Bacteria 7249374
759 2937111902 2937106411 Bacteria 6947143
760 2937118407 2937113482 Bacteria 6505872
761 2937125679 2937119839 Bacteria 6597547
762 2937130342 2937126314 Bacteria 6771275
763 2937845932 2937843397 Bacteria 5256375
764 2941505042 2941499720 Bacteria 7599444
765 2957379424 2957375807 Bacteria 6425588
766 2957386433 2957382221 Bacteria 6737050
767 2957389831 2957388812 Bacteria 6778072
768 2957399872 2957395598 Bacteria 6822399
769 2957406755 2957402308 Bacteria 6741770
770 2957410210 2957408893 Bacteria 6558585
771 2957421728 2957415311 Bacteria 6991633
772 2957426182 2957422303 Bacteria 7172205
773 2957437168 2957430029 Bacteria 7022557
774 2957441880 2957437181 Bacteria 6568994
775 2957445461 2957443900 Bacteria 6869977
776 2957453884 2957450854 Bacteria 6765715
777 2957459745 2957457609 Bacteria 6967680
778 2957465738 2957464669 Bacteria 6568877
779 2957476555 2957471148 Bacteria 6797643
780 2957478612 2957478035 Bacteria 6756658
781 2957486136 2957484790 Bacteria 6703082
782 2957498186 2957491536 Bacteria 6695180
783 2957502580 2957498199 Bacteria 7126688
784 2957506633 2957505466 Bacteria 7253085
785 2960588929 2960584000 Bacteria 6864594
786 2960596282 2960591022 Bacteria 6622873
787 2960604485 2960603979 Bacteria 6898737
788 2960616527 2960610863 Bacteria 6691244
789 2960618877 2960617483 Bacteria 6727748
790 2960632644 2960631154 Bacteria 6732508
791 2960645194 2960637947 Bacteria 7296468
792 2960646299 2960645483 Bacteria 7211087
793 2960656287 2960652885 Bacteria 7083688
794 2960664215 2960660292 Bacteria 7041660
795 2960669594 2960667422 Bacteria 6763020
796 2960676824 2960674078 Bacteria 6609048
797 2960686977 2960680706 Bacteria 6624464
798 2960688762 2960687367 Bacteria 6535474
799 2960700136 2960693952 Bacteria 6749742
800 2964609320 2964607997 Bacteria 7101408
801 2964616150 2964615318 Bacteria 6809089
802 2964622914 2964621998 Bacteria 6834995
803 2964632098 2964628898 Bacteria 7083044
804 2964639308 2964636051 Bacteria 7091832
805 2964648889 2964643177 Bacteria 6820887
806 2964652088 2964649959 Bacteria 6675118
807 2964662790 2964656573 Bacteria 7100150
808 2964666845 2964663802 Bacteria 7019362
809 2964671280 2964670856 Bacteria 6851364
810 2964681064 2964678106 Bacteria 6792020
811 2964690095 2964685014 Bacteria 6839111
812 2964699355 2964698721 Bacteria 6765331
813 2964709017 2964705432 Bacteria 7114648
814 2964716204 2964712639 Bacteria 6695970
815 2964724373 2964719344 Bacteria 7286602
816 2967667077 2967664464 Bacteria 6948836
817 2967672801 2967671571 Bacteria 7021409
818 2967683897 2967678726 Bacteria 7264382
819 2967691232 2967686174 Bacteria 6678622
820 2967693512 2967693043 Bacteria 6804451
821 2967700730 2967699805 Bacteria 6854538
822 2967711706 2967706974 Bacteria 7186053
823 2967715650 2967714385 Bacteria 7000047
824 2967726793 2967721400 Bacteria 7073753
825 2967734419 2967728569 Bacteria 6641507
826 2967736513 2967735183 Bacteria 6827012
827 2967742392 2967742019 Bacteria 6794534
828 2967750524 2967748971 Bacteria 6733771
829 2967758257 2967755722 Bacteria 6814706
830 2967765198 2967762386 Bacteria 6923502
831 2967770678 2967769361 Bacteria 6587838
832 2967776543 2967775926 Bacteria 6738189
833 2970022529 2970019648 Bacteria 7072033
834 2970032754 2970026789 Bacteria 6785236
835 2970034408 2970033650 Bacteria 7118744
836 2970041585 2970040964 Bacteria 6731123
837 2970052525 2970047711 Bacteria 7088379
838 2970061299 2970054988 Bacteria 6611507
839 2970063075 2970061556 Bacteria 7099761
840 2970074646 2970068827 Bacteria 7123112
841 2970082408 2970076120 Bacteria 6697332
842 2970088196 2970082768 Bacteria 6183754
843 2970095691 2970088815 Bacteria 6933825
844 2970102339 2970095765 Bacteria 6936963
845 2970104188 2970102677 Bacteria 6812532
846 2970114987 2970109326 Bacteria 6863976
847 2970121468 2970116247 Bacteria 6501857
848 2970126905 2970122695 Bacteria 6625855
849 2970130211 2970129317 Bacteria 6806560
850 2970138420 2970136068 Bacteria 7207982
851 2970147726 2970143518 Bacteria 6446480
852 2970154332 2970149975 Bacteria 6779706
853 2970158078 2970156795 Bacteria 7168044
854 2970170444 2970164137 Bacteria 6861252
855 2970172112 2970170962 Bacteria 6876229
856 2970178241 2970177841 Bacteria 6768001
857 2970187248 2970184632 Bacteria 7054431
858 2970193859 2970191845 Bacteria 7032787
859 2977521180 2977516862 Bacteria 6940108
860 2977526801 2977523885 Bacteria 6960446
861 2977535700 2977530762 Bacteria 6951399
862 2977541717 2977537788 Bacteria 6929320
863 2977550762 2977544691 Bacteria 6875412
864 2977554488 2977551784 Bacteria 7125765
865 2977562630 2977558990 Bacteria 6863948
866 2977572333 2977565890 Bacteria 6901543
867 2977577383 2977572785 Bacteria 6763888
868 2977583692 2977579622 Bacteria 6772100
869 2978974317 2978969890 Bacteria 5400756
870 2979094287 2979089926 Bacteria 5670289
871 2979098332 2979095461 Bacteria 5669583
872 2979103520 2979100975 Bacteria 5423623
873 2984511911 2984509177 Bacteria 5274802
874 2984521729 2984518228 Bacteria 5277463
875 2984541026 2984537506 Bacteria 5277481
876 2984589659 2984587000 Bacteria 5263363
877 2984603307 2984601300 Bacteria 5455244
878 2989776117 2989771324 Bacteria 5605128
879 2989778818 2989776772 Bacteria 4843317
880 2996889911 2996887358 Bacteria 5795980
881 2996898357 2996893221 Bacteria 5823108
882 3005409571 3005409236 Bacteria 7188837
883 3005420298 3005416602 Bacteria 7064308
884 3005447321 3005445848 Bacteria 6906074
885 3005454082 3005452660 Bacteria 5889319
886 639648287 639633055 Bacteria 7751309
887 643825785 643692032 Bacteria 6891900
888 648740968 648276728 Bacteria 6968865
889 650740142 650716007 Bacteria 5573770
890 8003571203 8003570095 Bacteria 5747666
891 8003993472 8003992118 Bacteria 7266902
892 8004000735 8003999396 Bacteria 7063185
893 8005248368 8005246636 Bacteria 4933972
894 8005261631 8005258706 Bacteria 6184835
895 8005280334 8005275841 Bacteria 6929066
896 8005288402 8005282627 Bacteria 6675747
897 8005294911 8005289223 Bacteria 6634003
898 8005306923 8005301065 Bacteria 6614431
899 8005314280 8005307578 Bacteria 7395396
900 8005317249 8005314921 Bacteria 7072929
901 8005324438 8005321885 Bacteria 5795980
902 8005378936 8005376324 Bacteria 6590079
903 8005388120 8005382845 Bacteria 6732062
904 8005396923 8005395548 Bacteria 6806915
905 8005434618 8005430974 Bacteria 6689030
906 8005462661 8005460587 Bacteria 7157962
907 8005486690 8005484373 Bacteria 6297373
908 8005500026 8005497431 Bacteria 6477605
909 8005544922 8005542996 Bacteria 7077758
910 8005557982 8005556819 Bacteria 6908598
911 8005569155 8005563573 Bacteria 7153261
912 8005575563 8005570704 Bacteria 6957481
913 8005621394 8005619151 Bacteria 7030230
914 8005631319 8005626139 Bacteria 6534237
915 8005646170 8005645114 Bacteria 6950293
916 8005659386 8005658619 Bacteria 4500593
917 8005671443 8005668836 Bacteria 6953162
918 8005686300 8005682033 Bacteria 6726518
919 8005694841 8005688590 Bacteria 6610080
920 8005696018 8005695170 Bacteria 6912330
921 8018129680 8018127388 Bacteria 7351159
922 8018155441 8018150411 Bacteria 5549903
923 8018178010 8018176218 Bacteria 6896178
924 8023681097 8023680758 Bacteria 7729763
925 8024485890 8024479707 Bacteria 6954785
926 8024492636 8024486573 Bacteria 6540512
927 8024505352 8024501048 Bacteria 6427847
928 8046773946 8046767195 Bacteria 7547379
929 8049294627 8049293176 Bacteria 6128433
930 8054462278 8054460903 Bacteria 4872905
931 8055435180 8055431914 Bacteria 4551896
932 8056377186 8056375014 Bacteria 7006639
933 8056388308 8056382006 Bacteria 6408074
934 8057578326 8057575449 Bacteria 7367519
935 8057875342 8057874678 Bacteria 7494653
936 Ga0496125_0000953
937 JGI24740J21852_10001389
938 JGI25155J39150_1000011
939 JGI25156J39149_1000030
940 JGI25154J39366_1000289
941 JGI25158J39367_1000167
942 JGI25157J39369_1000010
943 JGI25152J39213_1008181
944 JGI25159J45721_1000029
945 JGI25159J45721_1001125
946 JGI25159J45721_1001806
947 JGI25151J46595_10003454
948 JGI25151J46595_10004048
949 JGI25151J46595_10005052
950 JGI25151J46595_10005103
951 JGI25165J46597_1006781
952 JGI25153J46596_10004316
953 JGI25153J46596_10011346
954 JGI25160J50197_1000004
955 JGI25160J50197_1000011
956 JGI25160J50197_1000593
957 JGI25161J50226_1000003
958 JGI25161J50226_1001956
959 JGI25161J50226_1002628
960 Ga0006562J51391_1060468
961 Ga0055526_1001995
962 Ga0055526_1003733
963 Ga0055526_1006958
964 Ga0055526_1010214
965 Ga0055526_1010394
966 Ga0055526_1021566
967 Ga0055524_1003862
968 Ga0055524_1013014
969 Ga0055524_1020480
970 Ga0055524_1028237
971 Ga0055536_1000356
972 Ga0055528_1001267
973 Ga0055528_1001601
974 Ga0055528_1005825
975 Ga0055528_1013134
976 Ga0055528_1015466
977 Ga0055540_1000177
978 Ga0055531_10003828
979 Ga0055531_10003846
980 Ga0058692_1002330
981 Ga0055543_1000001
982 Ga0055543_1000097
983 Ga0055543_1000255
984 Ga0055543_1001144
985 Ga0065165_1000018
986 Ga0065165_1023781
987 Ga0070658_10212360
988 Ga0070670_100000535
989 Ga0070670_100065176
990 Ga0070671_100033264
991 Ga0070665_100107355
992 Ga0068855_100109341
993 Ga0068856_100032523
994 Ga0075365_10005053
995 Ga0075365_10012329
996 Ga0075368_10002095
997 Ga0075364_10000043
998 Ga0075364_10129542
999 Ga0075362_10011839
1000 Ga0075362_10012116
1001 Ga0075367_10032147
1002 Ga0075369_10009230
1003 Ga0075366_10021694
1004 Ga0075370_10001750
1005 Ga0079104_1000022
1006 Ga0079104_1001402
1007 Ga0099826_10000090
1008 Ga0099826_10004510
1009 Ga0105251_10020317
1010 Ga0105240_10000005
1011 Ga0105243_10089667
1012 Ga0105237_10000773
1013 Ga0123341_1000049
1014 Ga0105239_10004008
1015 Ga0157373_10002285
1016 Ga0157373_10131447
1017 Ga0157371_10000015
1018 Ga0157371_10005986
1019 Ga0157370_10000992
1020 Ga0157370_10003013
1021 Ga0157370_10017734
1022 Ga0157369_10050141
1023 Ga0157369_10145335
1024 Ga0171463_1008
1025 Ga0182007_10000618
1026 Ga0182005_1018412
1027 Ga0183363_1281
1028 Ga0214544_1000129
1029 Ga0214542_1000828
1030 Ga0214542_1027439
1031 Ga0214543_1000010
1032 Ga0214543_1000134
1033 Ga0213872_10022695
1034 Ga0228711_1002680
1035 Ga0228710_1002851
1036 Ga0209435_100022
1037 Ga0209436_100507
1038 Ga0209437_100122
1039 Ga0209437_100160
1040 Ga0207425_1008820
1041 Ga0207425_1009643
1042 Ga0209646_1000078
1043 Ga0209646_1003812
1044 Ga0209026_1000065
1045 Ga0209759_1000055
1046 Ga0209129_1000127
1047 Ga0209129_1001042
1048 Ga0209129_1001442
1049 Ga0209129_1002372
1050 Ga0209129_1012798
1051 Ga0209129_1012818
1052 Ga0209233_1000168
1053 Ga0209233_1000170
1054 Ga0209233_1001127
1055 Ga0209673_1000139
1056 Ga0209673_1001327
1057 Ga0209673_1002230
1058 Ga0209673_1003846
1059 Ga0209673_1004486
1060 Ga0209673_1004582
1061 Ga0209130_1000012
1062 Ga0209130_1000029
1063 Ga0209130_1000097
1064 Ga0209130_1008169
1065 Ga0209676_1000438
1066 Ga0209676_1007877
1067 Ga0209676_1016797
1068 Ga0209025_1000033
1069 Ga0209025_1000563
1070 Ga0209025_1001678
1071 Ga0209025_1001703
1072 Ga0209025_1003459
1073 Ga0209025_1010390
1074 Ga0209564_1000105
1075 Ga0209564_1000275
1076 Ga0209564_1000986
1077 Ga0209564_1001528
1078 Ga0209564_1001611
1079 Ga0209564_1022689
1080 Ga0209758_1000505
1081 Ga0209758_1000534
1082 Ga0209758_1000805
1083 Ga0209758_1001745
1084 Ga0209758_1003872
1085 Ga0209758_1007599
1086 Ga0209758_1020108
1087 Ga0209050_1000516
1088 Ga0209050_1004356
1089 Ga0209256_1001255
1090 Ga0209256_1001768
1091 Ga0209256_1002167
1092 Ga0209256_1003073
1093 Ga0209256_1008787
1094 Ga0209256_1009219
1095 Ga0209256_1042308
1096 Ga0207426_1000003
1097 Ga0207426_1000010
1098 Ga0207426_1000074
1099 Ga0207426_1000290
1100 Ga0207426_1000408
1101 Ga0209051_1000125
1102 Ga0209051_1003377
1103 Ga0209051_1004697
1104 Ga0209051_1036652
1105 Ga0209051_1039840
1106 Ga0209257_1009229
1107 Ga0207695_10000011
1108 Ga0207671_10004599
1109 Ga0207650_10014417
1110 Ga0207650_10118692
1111 Ga0207678_10064346
1112 Ga0207702_10009685
1113 Ga0209281_1000036
1114 Ga0209281_1000047
1115 Ga0209281_1000508
1116 Ga0209281_1004020
1117 Ga0209371_1000178
1118 Ga0209371_1000382
1119 Ga0209282_1000116
1120 Ga0209282_1000235
1121 Ga0209282_1075229
1122 Ga0268266_10059721
1123 Ga0268266_10076615
1124 Ga0268265_10077564
1125 Ga0265318_10031724
1126 Ga0307515_10000233
1127 Ga0307515_10000569
1128 Ga0307515_10013071
1129 Ga0307515_10095379
1130 Ga0268256_1000251
1131 Ga0268256_1006569
1132 Ga0265331_10001061
1133 Ga0307513_10000588
1134 Ga0307513_10021520
1135 Ga0307408_100129754
1136 Ga0265314_10091276
1137 Ga0307405_10026000
1138 Ga0307406_10006937
1139 Ga0307412_10000449
1140 Ga0315914_1002646
1141 Ga0316593_10020427
1142 Ga0315913_1001232
1143 Ga0315915_1000058
1144 Ga0373935_0084405
1145 Ga0373927_0002488
1146 Ga0316584_0168452
1147 Ga0373925_0001826
1148 Ga0395905_0000386
1149 Ga0395905_0011890
1150 Ga0436361_0388638
1151 Ga0439436_0020716
1152 Ga0439465_0002627
1153 Ga0439465_0012232
1154 Ga0451833_0326332
1155 Ga0451839_0624369
1156 Ga0451839_1171986
1157 Ga0451845_0406102
1158 Ga0451849_1391146
1159 Ga0451851_0083156
1160 Ga0451851_0085829
1161 Ga0451851_1152225
1162 Ga0451843_0892284
1163 Ga0439442_022028
1164 Ga0439449_0005586
1165 Ga0439449_0041569
1166 Ga0439462_0019440
1167 Ga0466968_0033665
1168 Ga0495638_0001886
1169 Ga0495638_0034607
1170 Ga0495662_0037834
1171 Ga0495585_0066062
1172 Ga0495585_0106093
1173 Ga0495607_0127700
1174 Ga0495583_0051972
1175 Ga0495583_0076388
1176 Ga0495606_0002073
1177 Ga0495606_0029987
1178 Ga0495620_0028632
1179 Ga0495628_0059749
1180 Ga0495631_0080968
1181 Ga0495632_0050841
1182 Ga0495643_0027844
1183 Ga0495643_0078683
1184 Ga0495654_0003690
1185 Ga0495622_0046432
1186 Ga0495633_0001025
1187 Ga0495668_0006310
1188 Ga0495611_0041726
1189 Ga0495625_0038361
1190 Ga0495625_0119427
1191 Ga0495625_0185123
1192 Ga0495635_0142511
1193 Ga0495588_0020089
1194 Ga0495658_0054226
1195 Ga0495613_0003033
1196 Ga0495649_0103253
1197 Ga0495660_0071744
1198 Ga0495604_0013679
1199 Ga0495687_068952
1200 Ga0495681_0077664
1201 Ga0495686_0002178
1202 Ga0495686_0005411
1203 Ga0496106_0000478
1204 Ga0496111_0003975
1205 Ga0496114_0335013
1206 Ga0496116_0000232
1207 Ga0496116_0019844
1208 Ga0496116_0083325
1209 Ga0496116_0097864
1210 Ga0496116_0101076
1211 Ga0496117_0000002
1212 Ga0496117_0002298
1213 Ga0496117_0011144
1214 Ga0496118_0000460
1215 Ga0496118_0003956
1216 Ga0496118_0020559
1217 Ga0496118_0071214
1218 Ga0496118_0109262
1219 Ga0496119_0012076
1220 Ga0496119_0012145
1221 Ga0496119_0023760
1222 Ga0496119_0047784
1223 Ga0496120_0000078
1224 Ga0496120_0006355
1225 Ga0496121_0000001
1226 Ga0496121_0002309
1227 Ga0496121_0005949
1228 Ga0496121_0009598
1229 Ga0496121_0010507
1230 Ga0496121_0081738
1231 Ga0496121_0087328
1232 Ga0496122_0000001
1233 Ga0496122_0006684
1234 Ga0496122_0011586
1235 Ga0496122_0012223
1236 Ga0496122_0052212
1237 Ga0496122_0100963
1238 Ga0496122_0113931
1239 Ga0496122_0118521
1240 Ga0496122_0124634
1241 Ga0496123_0000001
1242 Ga0496123_0000032
1243 Ga0496123_0000512
1244 Ga0496123_0005232
1245 Ga0496123_0050289
1246 Ga0496123_0076430
1247 Ga0496123_0076538
1248 Ga0496124_0000377
1249 Ga0496124_0004853
1250 Ga0496124_0014237
1251 Ga0496124_0093699
1252 Ga0496124_0127798
1253 Ga0496124_0231886
1254 Ga0496125_0000155
1255 Ga0496125_0053841
1256 Ga0496126_0001369
1257 Ga0496126_0052656
1258 Ga0496126_0230043
1259 Ga0501034_0254277
1260 Ga0501036_0201895
1261 Ga0501037_0154721
1262 Ga0501070_0084565
1263 Ga0501073_0017851
1264 Ga0501035_0029163
1265 Ga0501035_0208503
1266 Ga0501035_0348446
1267 nmdc:mga03683_3419_c1
1268 nmdc:mga03n38_26274_c1
1269 nmdc:mga00v17_203_c1
1270 nmdc:mga00v17_3726_c1
1271 nmdc:mga00v17_68969_c1
1272 nmdc:mga0yw44_697_c1
1273 nmdc:mga0yw44_95712_c1
1274 nmdc:mga0k408_112515_c1
1275 nmdc:mga0k408_25595_c1
1276 nmdc:mga0sz30_14502_c1
1277 nmdc:mga0sz30_16497_c1
1278 nmdc:mga0sz30_4182_c1
1279 Ga0500643_023318
1280 Ga0500556_0081163
1281 Ga0500560_001846
1282 Ga0500572_000849
1283 Ga0500572_003892
1284 Ga0500618_002786
1285 Ga0500618_009375
1286 Ga0500618_018902
1287 Ga0500658_0000485
1288 Ga0500658_0012162
1289 Ga0500559_0062107
1290 Ga0500561_0002360
1291 Ga0500568_0003249
1292 Ga0500577_0078061
1293 Ga0500616_0002587
1294 Ga0500616_0011140
1295 Ga0500622_0000378
1296 Ga0500622_0000778
1297 Ga0500622_0039798
1298 Ga0500622_0124327
1299 Ga0500624_001373
1300 Ga0500634_0010832
1301 Ga0500636_0000123
1302 Ga0500636_0001081
1303 Ga0500636_0059250
1304 Ga0500645_000972
1305 Ga0587090_000719
1306 2509107650
1307 2509375988
1308 2509386920
1309 2509442448
1310 2510133052
1311 2510308661
1312 2510843005
1313 2510899441
1314 2511134929
1315 2511172608
1316 2511183744
1317 2511193389
1318 2511501507
1319 2512532933
1320 2512971740
1321 2513569867
1322 2513575135
1323 2513588110
1324 2513594390
1325 2513605270
1326 2513618701
1327 2513635602
1328 2513713454
1329 2513866995
1330 2513886969
1331 2513907204
1332 2513909862
1333 2513926641
1334 2513987068
1335 2513997346
1336 2514005288
1337 2514021856
1338 2515112002
1339 2515611352
1340 2515633798
1341 2515645037
1342 2515660179
1343 2515738816
1344 2516209510
1345 2516892825
1346 2517035738
1347 2517076162
1348 2517094906
1349 2517406535
1350 2517569600
1351 2524453661
1352 2524460459
1353 2530645302
1354 2535484818
1355 2535516275
1356 2537877784
1357 2551674252
1358 2551680404
1359 2551686544
1360 2551691823
1361 2551699773
1362 2551711741
1363 2551719508
1364 2551729148
1365 2551737098
1366 2551742525
1367 2554247754
1368 2558868261
1369 2559294887
1370 2561466505
1371 2585168470
1372 2585199960
1373 2585225792
1374 2585233553
1375 2585254507
1376 2585270044
1377 2585270669
1378 2585277010
1379 2585323984
1380 2585333619
1381 2585389749
1382 2585393716
1383 2585403453
1384 2585528318
1385 2585537020
1386 2585540495
1387 2585546752
1388 2585551871
1389 2585558372
1390 2585819579
1391 2585838711
1392 2585846561
1393 2585897767
1394 2585904639
1395 2585995875
1396 2586000440
1397 2587980245
1398 2599336303
1399 2599417930
1400 2599604148
1401 2599721501
1402 2600197125
1403 2600375810
1404 2601608059
1405 2601744834
1406 2616292685
1407 2616308384
1408 2616556548
1409 2617385873
1410 2643808722
1411 2643811901
1412 2643857685
1413 2643919378
1414 2644001960
1415 2644005060
1416 2644049364
1417 2644066256
1418 2644107978
1419 2644148350
1420 2644192901
1421 2644204297
1422 2644210481
1423 2644239387
1424 2644309372
1425 2644333198
1426 2644377796
1427 2644415531
1428 2644450067
1429 2644482398
1430 2644494478
1431 2644502051
1432 2644522280
1433 2644545630
1434 2644615314
1435 2644654033
1436 2644658693
1437 2644673621
1438 2644687624
1439 2657683822
1440 2671115785
1441 2692316028
1442 2719180960
1443 2719385560
1444 2719665382
1445 2719731709
1446 2720491802
1447 2720613071
1448 2720619924
1449 2720631350
1450 2720775077
1451 2721147054
1452 2721158582
1453 2721163972
1454 2721399308
1455 2722840142
1456 2723026714
1457 2723560331
1458 2723566897
1459 2724038121
1460 2724044465
1461 2724089684
1462 2724104162
1463 2724109971
1464 2725948736
1465 2730107650
1466 2730164197
1467 2730298214
1468 2738801925
1469 2738945592
1470 2739037991
1471 2739307891
1472 2753359426
1473 2753458334
1474 2758641686
1475 2766062931
1476 2776913375
1477 2778176524
1478 2792580744
1479 2792619981
1480 2792626601
1481 2792639537
1482 2793279680
1483 2793298262
1484 2793313743
1485 2793324325
1486 2793326463
1487 2793337048
1488 2793341299
1489 2793347523
1490 2793352412
1491 2793361397
1492 2793369668
1493 2802718738
1494 2802726350
1495 2802732890
1496 2802738245
1497 2802744579
1498 2802751215
1499 2804752085
1500 2805927740
1501 2805935646
1502 2806045384
1503 2806055423
1504 2806061466
1505 2806068040
1506 2806072612
1507 2808985343
1508 2819241893
1509 2819559776
1510 2819610359
1511 2819638101
1512 2819684693
1513 2821127924
1514 2838021143
1515 2838025374
1516 2838035091
1517 2838041556
1518 2838043206
1519 2838054200
1520 2838067853
1521 2838071483
1522 2838078756
1523 2838666301
1524 2838670188
1525 2838676187
1526 2838682462
1527 2838689234
1528 2838697033
1529 2838702559
1530 2838709726
1531 2838715069
1532 2838721131
1533 2838725828
1534 2838730582
1535 2838738348
1536 2838743523
1537 2841841282
1538 2841848088
1539 2841854801
1540 2841859361
1541 2842077900
1542 2842110744
1543 2842119592
1544 2842125882
1545 2842131081
1546 2842141060
1547 2842146896
1548 2842153749
1549 2842157664
1550 2842164861
1551 2842171312
1552 2842177369
1553 2842180751
1554 2842188177
1555 2842196879
1556 2842200942
1557 2842206277
1558 2842212488
1559 2842222968
1560 2842225893
1561 2842231191
1562 2842239139
1563 2842244702
1564 2842251961
1565 2842258515
1566 2842268042
1567 2842273254
1568 2842279734
1569 2842287379
1570 2842291562
1571 2842301789
1572 2842310084
1573 2842313685
1574 2842318145
1575 2842347275
1576 2842357292
1577 2842366540
1578 2842373029
1579 2842377958
1580 2842386101
1581 2842397424
1582 2842405091
1583 2842411674
1584 2842417876
1585 2842424859
1586 2842431739
1587 2842438318
1588 2842444949
1589 2842452267
1590 2842466093
1591 2842472934
1592 2842481857
1593 2842487085
1594 2842492890
1595 2842496415
1596 2842508732
1597 2842510258
1598 2842516145
1599 2842522409
1600 2842927724
1601 2844167286
1602 2844459411
1603 2847418907
1604 2848993944
1605 2850081893
1606 2852389676
1607 2855825602
1608 2855840979
1609 2855876577
1610 2857518469
1611 2857534335
1612 2858801519
1613 2896390625
1614 2899794165
1615 2899808863
1616 2899846536
1617 2913301097
1618 2913310301
1619 2915985346
1620 2915987993
1621 2915996321
1622 2916001462
1623 2916010351
1624 2916017089
1625 2916022488
1626 2916029018
1627 2916041674
1628 2916047886
1629 2916054114
1630 2916061632
1631 2916062311
1632 2916071974
1633 2916081967
1634 2917556789
1635 2919107874
1636 2919115160
1637 2919167865
1638 2919175093
1639 2919409839
1640 2920765913
1641 2920824445
1642 2921201569
1643 2921210265
1644 2921239101
1645 2921250407
1646 2921253991
1647 2921257377
1648 2921264601
1649 2921283378
1650 2921293218
1651 2923560808
1652 2924147431
1653 2924151676
1654 2924159053
1655 2924167818
1656 2924176528
1657 2924187599
1658 2924200312
1659 2924203858
1660 2924213804
1661 2924217102
1662 2924224041
1663 2924235069
1664 2926756206
1665 2926760437
1666 2929140426
1667 2933008395
1668 2933013211
1669 2933576555
1670 2933586770
1671 2933597900
1672 2933602282
1673 2935899101
1674 2935904493
1675 2936372985
1676 2936381136
1677 2936386055
1678 2936998015
1679 2937006150
1680 2937012649
1681 2937019724
1682 2937029344
1683 2937032701
1684 2937042032
1685 2937045847
1686 2937051299
1687 2937057708
1688 2937070789
1689 2937077581
1690 2937082641
1691 2937091439
1692 2937095871
1693 2937100127
1694 2937111902
1695 2937118407
1696 2937125679
1697 2937130342
1698 2937845932
1699 2941505042
1700 2957379424
1701 2957386433
1702 2957389831
1703 2957399872
1704 2957406755
1705 2957410210
1706 2957421728
1707 2957426182
1708 2957437168
1709 2957441880
1710 2957445461
1711 2957453884
1712 2957459745
1713 2957465738
1714 2957476555
1715 2957478612
1716 2957486136
1717 2957498186
1718 2957502580
1719 2957506633
1720 2960588929
1721 2960596282
1722 2960604485
1723 2960616527
1724 2960618877
1725 2960632644
1726 2960645194
1727 2960646299
1728 2960656287
1729 2960664215
1730 2960669594
1731 2960676824
1732 2960686977
1733 2960688762
1734 2960700136
1735 2964609320
1736 2964616150
1737 2964622914
1738 2964632098
1739 2964639308
1740 2964648889
1741 2964652088
1742 2964662790
1743 2964666845
1744 2964671280
1745 2964681064
1746 2964690095
1747 2964699355
1748 2964709017
1749 2964716204
1750 2964724373
1751 2967667077
1752 2967672801
1753 2967683897
1754 2967691232
1755 2967693512
1756 2967700730
1757 2967711706
1758 2967715650
1759 2967726793
1760 2967734419
1761 2967736513
1762 2967742392
1763 2967750524
1764 2967758257
1765 2967765198
1766 2967770678
1767 2967776543
1768 2970022529
1769 2970032754
1770 2970034408
1771 2970041585
1772 2970052525
1773 2970061299
1774 2970063075
1775 2970074646
1776 2970082408
1777 2970088196
1778 2970095691
1779 2970102339
1780 2970104188
1781 2970114987
1782 2970121468
1783 2970126905
1784 2970130211
1785 2970138420
1786 2970147726
1787 2970154332
1788 2970158078
1789 2970170444
1790 2970172112
1791 2970178241
1792 2970187248
1793 2970193859
1794 2977521180
1795 2977526801
1796 2977535700
1797 2977541717
1798 2977550762
1799 2977554488
1800 2977562630
1801 2977572333
1802 2977577383
1803 2977583692
1804 2978974317
1805 2979094287
1806 2979098332
1807 2979103520
1808 2984511911
1809 2984521729
1810 2984541026
1811 2984589659
1812 2984603307
1813 2989776117
1814 2989778818
1815 2996889911
1816 2996898357
1817 3005409571
1818 3005420298
1819 3005447321
1820 3005454082
1821 639648287
1822 643825785
1823 648740968
1824 650740142
1825 8003571203
1826 8003993472
1827 8004000735
1828 8005248368
1829 8005261631
1830 8005280334
1831 8005288402
1832 8005294911
1833 8005306923
1834 8005314280
1835 8005317249
1836 8005324438
1837 8005378936
1838 8005388120
1839 8005396923
1840 8005434618
1841 8005462661
1842 8005486690
1843 8005500026
1844 8005544922
1845 8005557982
1846 8005569155
1847 8005575563
1848 8005621394
1849 8005631319
1850 8005646170
1851 8005659386
1852 8005671443
1853 8005686300
1854 8005694841
1855 8005696018
1856 8018129680
1857 8018155441
1858 8018178010
1859 8023681097
1860 8024485890
1861 8024492636
1862 8024505352
1863 8046773946
1864 8049294627
1865 8054462278
1866 8055435180
1867 8056377186
1868 8056388308
1869 8057578326
1870 8057875342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02547

Queuosine_synth

Queuosine biosynthesis protein

3

358

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fks-assembly1.cif.gz_D yeast f1 atpase in the absence of bound nucleotides 0.7441 72 147
6q45-assembly1.cif.gz_F f1-atpase from fusobacterium nucleatum 0.743 86 151
6re2-assembly1.cif.gz_X cryo-em structure of polytomella f-atp synthase, rotary substate 2b, composite map 0.7389 86 147
3oaa-assembly4.cif.gz_b structure of the e.coli f1-atp synthase inhibited by subunit epsilon 0.7344 86 151
6foc-assembly1.cif.gz_D f1-atpase from mycobacterium smegmatis 0.734 86 151
ID Description Score Start End Superfamily
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9371 5 356 3.40.1780.10
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9193 5 356 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8244 66 178 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8097 66 178 3.40.1780.10
1vkyA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like 0.7995 66 151 2.40.10.240
ID Description Score Start End GO Terms
AF-A0A4V1UHR0-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9592 260 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3D4QLI7-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9585 219 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-L1MKH9-F1-model_v4 S-adenosylmethionine:tRNA ribosyltransferase-isomerase 0.9573 247 357 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3N5F0H8-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9491 228 359 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A522W263-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9486 247 360 GO:0002099
GO:0005737
GO:0008616
GO:0051075

Map