F486177

General Info

Members Datasets Scaffolds Average Seq Length
935 412 1870 278

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0063357|Ga0501034_0063357_1268_2128
Length 286
Sequence MGAFPMTDRFGRLSLHMWTIDTTPLGTALDAARAAGYDAVELRRTDFKRLLDTGQSNAQILDLIRKSGIKVGILGVEYGWLFAKGDESKRLFGVLRESCQNAVALGCDMLMCAPGQISAPLSEAVENLKIGGDIVGEFPGLRLAIEFNSQHAVLNSVHALRDLLAGARRKNCGYLLDAYHLTRSGSPGRGFEDVPGEEIFVFQYSDVPPAPVETGVKRPTDRLPPGKGLVRWREMLGLLAEKGYTGYLSYEAPNPEQWARSPYDVAKEGVELTRKLLKEAVPSYAA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
403 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 5.88
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 15.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0063357 3300049571 Bacteria 3711
2 ARSoilYngRDRAFT_c00118 3300000042 Bacteria 13503
3 ARcpr5yngRDRAFT_c000035 3300000043 Bacteria 21396
4 ARCol0yngRDRAFT_1000516 3300000652 Bacteria 4478
5 JGI24752J21851_1007583 3300001976 Bacteria 1416
6 JGI24746J21847_1011725 3300001977 Bacteria 1287
7 JGI24747J21853_1002987 3300001978 Bacteria 1431
8 JGI24739J22299_10000158 3300001989 Bacteria 22012
9 JGI24737J22298_10001510 3300001990 Bacteria 8284
10 JGI24737J22298_10001948 3300001990 Bacteria 7386
11 JGI24750J21931_1000477 3300002070 Bacteria 6371
12 JGI24745J21846_1000120 3300002073 Bacteria 6024
13 JGI24738J21930_10001316 3300002075 Bacteria 6946
14 JGI24749J21850_1000215 3300002076 Bacteria 9013
15 JGI24749J21850_1004682 3300002076 Bacteria 1918
16 JGI24744J21845_10012002 3300002077 Bacteria 1763
17 JGI24035J26624_1000023 3300002126 Bacteria 11063
18 JGI24034J26672_10000641 3300002239 Plasmid 4487
19 JGI24742J22300_10002624 3300002244 Plasmid 2883
20 Ga0065717_1000203 3300005276 Bacteria 2019
21 Ga0065704_10090673 3300005289 Bacteria 2768
22 Ga0065712_10018330 3300005290 Bacteria 1732
23 Ga0065712_10093636 3300005290 Unclassified 2284
24 Ga0065715_10001166 3300005293 Bacteria 15369
25 Ga0065715_10021066 3300005293 Bacteria 1926
26 Ga0065715_10099722 3300005293 Plasmid 3378
27 Ga0070658_10006919 3300005327 Bacteria 9160
28 Ga0070658_10028299 3300005327 Bacteria 4498
29 Ga0070658_10055484 3300005327 Bacteria 3219
30 Ga0070676_10015064 3300005328 Bacteria 4260
31 Ga0070683_100012601 3300005329 Bacteria 7351
32 Ga0070683_100051385 3300005329 Plasmid 3817
33 Ga0070690_100000727 3300005330 Bacteria 16862
34 Ga0070690_100023181 3300005330 Plasmid 3805
35 Ga0070690_100038800 3300005330 Bacteria 3007
36 Ga0070690_100291883 3300005330 Unclassified 1166
37 Ga0070670_100040022 3300005331 Plasmid 4031
38 Ga0070670_100046230 3300005331 Plasmid 3743
39 Ga0070670_100566337 3300005331 Unclassified 1014
40 Ga0070677_10002396 3300005333 Bacteria 5981
41 Ga0068869_100002166 3300005334 Bacteria 11815
42 Ga0068869_100312538 3300005334 Unclassified 1272
43 Ga0070666_10022637 3300005335 Plasmid 4082
44 Ga0070666_10025033 3300005335 Plasmid 3890
45 Ga0070680_100006389 3300005336 Bacteria 8955
46 Ga0070680_100018615 3300005336 Bacteria 5491
47 Ga0070680_100057732 3300005336 Plasmid 3173
48 Ga0070680_100073630 3300005336 Bacteria 2809
49 Ga0070680_100189244 3300005336 Bacteria 1734
50 Ga0070680_100289243 3300005336 Unclassified 1389
51 Ga0070680_100448654 3300005336 Unclassified 1102
52 Ga0070682_100002724 3300005337 Bacteria 9789
53 Ga0070682_100038338 3300005337 Unclassified 2939
54 Ga0070682_100130177 3300005337 Bacteria 1702
55 Ga0068868_100002949 3300005338 Bacteria 11812
56 Ga0068868_100021585 3300005338 Plasmid 4850
57 Ga0070660_100000985 3300005339 Bacteria 19067
58 Ga0070660_100026353 3300005339 Bacteria 4327
59 Ga0070689_100000646 3300005340 Bacteria 21086
60 Ga0070689_100002989 3300005340 Bacteria 11115
61 Ga0070689_100014280 3300005340 Bacteria 5766
62 Ga0070691_10000060 3300005341 Bacteria 30257
63 Ga0070687_100000773 3300005343 Bacteria 10637
64 Ga0070661_100015592 3300005344 Bacteria 5363
65 Ga0070661_100206021 3300005344 Bacteria 1504
66 Ga0070692_10000273 3300005345 Bacteria 14477
67 Ga0070668_100007804 3300005347 Bacteria 7946
68 Ga0070669_100019129 3300005353 Bacteria 4895
69 Ga0070675_100003854 3300005354 Bacteria 11384
70 Ga0070675_100036283 3300005354 Plasmid 4011
71 Ga0070671_100000349 3300005355 Bacteria 31741
72 Ga0070671_100032167 3300005355 Bacteria 4338
73 Ga0070671_100111836 3300005355 Bacteria 2294
74 Ga0070674_100000152 3300005356 Bacteria 32268
75 Ga0070674_100026791 3300005356 Bacteria 3770
76 Ga0070674_100031793 3300005356 Plasmid 3500
77 Ga0070673_100007455 3300005364 Bacteria 7216
78 Ga0070688_100002079 3300005365 Bacteria 10108
79 Ga0070688_100002194 3300005365 Bacteria 9852
80 Ga0070688_100091062 3300005365 Bacteria 1992
81 Ga0070659_100000621 3300005366 Bacteria 25919
82 Ga0070659_100037533 3300005366 Bacteria 3777
83 Ga0070667_100000810 3300005367 Bacteria 29225
84 Ga0070703_10002626 3300005406 Bacteria 5171
85 Ga0070709_10024168 3300005434 Bacteria 3574
86 Ga0070714_100027007 3300005435 Bacteria 4750
87 Ga0070714_100049823 3300005435 Bacteria 3565
88 Ga0070714_100068290 3300005435 Bacteria 3066
89 Ga0070714_100102916 3300005435 Plasmid 2519
90 Ga0070714_100617703 3300005435 Bacteria 1042
91 Ga0070713_100015547 3300005436 Bacteria 5697
92 Ga0070713_100045893 3300005436 Plasmid 3583
93 Ga0070713_100081039 3300005436 Bacteria 2769
94 Ga0070713_100084255 3300005436 Bacteria 2720
95 Ga0070710_10029249 3300005437 Bacteria 2954
96 Ga0070701_10000042 3300005438 Bacteria 32304
97 Ga0070701_10008593 3300005438 Plasmid 4427
98 Ga0070711_100008373 3300005439 Bacteria 6335
99 Ga0070711_100132629 3300005439 Unclassified 1857
100 Ga0070705_100005564 3300005440 Bacteria 6146
101 Ga0070705_100096394 3300005440 Unclassified 1857
102 Ga0070705_100147919 3300005440 Bacteria 1555
103 Ga0070700_100000329 3300005441 Bacteria 24667
104 Ga0070700_100023379 3300005441 Plasmid 3613
105 Ga0070694_100002007 3300005444 Bacteria 12098
106 Ga0070694_100002748 3300005444 Bacteria 10437
107 Ga0070708_100045860 3300005445 Plasmid 3854
108 Ga0070663_100037014 3300005455 Plasmid 3394
109 Ga0070663_100090670 3300005455 Unclassified 2264
110 Ga0070678_100013734 3300005456 Bacteria 5089
111 Ga0070678_100062841 3300005456 Plasmid 2744
112 Ga0070662_100064811 3300005457 Plasmid 2676
113 Ga0070662_100182156 3300005457 Unclassified 1656
114 Ga0070662_100333215 3300005457 Unclassified 1240
115 Ga0070662_100548462 3300005457 Unclassified 968
116 Ga0070681_10004332 3300005458 Bacteria 13487
117 Ga0070681_10005076 3300005458 Bacteria 12700
118 Ga0070681_10016427 3300005458 Bacteria 7390
119 Ga0070681_10148826 3300005458 Unclassified 2269
120 Ga0068867_100007473 3300005459 Bacteria 7727
121 Ga0068867_100119720 3300005459 Unclassified 2033
122 Ga0070685_10006180 3300005466 Bacteria 6097
123 Ga0070685_10007245 3300005466 Bacteria 5670
124 Ga0070685_10129989 3300005466 Bacteria 1573
125 Ga0070706_100157073 3300005467 Bacteria 2123
126 Ga0070699_100270906 3300005518 Bacteria 1520
127 Ga0070679_100002742 3300005530 Bacteria 16042
128 Ga0070679_100157221 3300005530 Unclassified 2248
129 Ga0070679_100206314 3300005530 Bacteria 1930
130 Ga0070679_100222698 3300005530 Bacteria 1847
131 Ga0070679_100236175 3300005530 Bacteria 1787
132 Ga0070684_100000464 3300005535 Bacteria 27749
133 Ga0070684_100376832 3300005535 Bacteria 1307
134 Ga0070697_100013327 3300005536 Bacteria 6448
135 Ga0068853_100001029 3300005539 Bacteria 19655
136 Ga0070672_100020218 3300005543 Bacteria 4851
137 Ga0070672_100078130 3300005543 Bacteria 2648
138 Ga0070686_100001527 3300005544 Bacteria 13007
139 Ga0070695_100010249 3300005545 Bacteria 5593
140 Ga0070695_100047425 3300005545 Plasmid 2744
141 Ga0070695_100097437 3300005545 Bacteria 1975
142 Ga0070696_100015481 3300005546 Bacteria 5123
143 Ga0070696_100098522 3300005546 Unclassified 2091
144 Ga0070693_100000266 3300005547 Bacteria 24669
145 Ga0070693_100036753 3300005547 Bacteria 2725
146 Ga0070693_100060687 3300005547 Unclassified 2196
147 Ga0070665_100108939 3300005548 Plasmid 2772
148 Ga0070665_100168547 3300005548 Bacteria 2191
149 Ga0070704_100010668 3300005549 Bacteria 5596
150 Ga0070704_100104573 3300005549 Bacteria 2141
151 Ga0068855_100041697 3300005563 Bacteria 5439
152 Ga0068855_100061239 3300005563 Bacteria 4398
153 Ga0070664_100015424 3300005564 Bacteria 6249
154 Ga0070664_100023574 3300005564 Bacteria 5084
155 Ga0068857_100000888 3300005577 Bacteria 22595
156 Ga0068857_100239796 3300005577 Bacteria 1660
157 Ga0068857_100691623 3300005577 Unclassified 968
158 Ga0068854_100005378 3300005578 Bacteria 8082
159 Ga0068856_100003260 3300005614 Bacteria 16512
160 Ga0068856_100126633 3300005614 Bacteria 2557
161 Ga0068856_100160523 3300005614 Bacteria 2258
162 Ga0068856_100494033 3300005614 Unclassified 1244
163 Ga0070702_100053415 3300005615 Unclassified 2321
164 Ga0068852_100000579 3300005616 Bacteria 24117
165 Ga0068852_100580680 3300005616 Bacteria 1124
166 Ga0068859_100003690 3300005617 Bacteria 15603
167 Ga0068859_100146749 3300005617 Bacteria 2434
168 Ga0068859_100231653 3300005617 Bacteria 1935
169 Ga0068859_100233619 3300005617 Bacteria 1927
170 Ga0068864_100001260 3300005618 Bacteria 21062
171 Ga0068864_100106019 3300005618 Bacteria 2498
172 Ga0068864_100236411 3300005618 Bacteria 1691
173 Ga0068864_100710527 3300005618 Bacteria 982
174 Ga0068866_10001077 3300005718 Bacteria 12040
175 Ga0068866_10018692 3300005718 Unclassified 3140
176 Ga0068861_100001782 3300005719 Bacteria 13850
177 Ga0068861_100351967 3300005719 Unclassified 1292
178 Ga0068851_10046717 3300005834 Bacteria 2191
179 Ga0068870_10000108 3300005840 Bacteria 28313
180 Ga0068863_100001201 3300005841 Bacteria 25868
181 Ga0068863_100324236 3300005841 Unclassified 1496
182 Ga0068858_100000419 3300005842 Bacteria 44155
183 Ga0068858_100054459 3300005842 Plasmid 3699
184 Ga0068858_100181366 3300005842 Unclassified 1988
185 Ga0068860_100001359 3300005843 Bacteria 26585
186 Ga0068860_100475076 3300005843 Unclassified 1245
187 Ga0068860_100875780 3300005843 Bacteria 913
188 Ga0068860_100896963 3300005843 Unclassified 902
189 Ga0068862_100005815 3300005844 Bacteria 10279
190 Ga0068862_100056562 3300005844 Plasmid 3361
191 Ga0081455_10000009 3300005937 Bacteria 249885
192 Ga0081455_10004982 3300005937 Bacteria 14691
193 Ga0081455_10117653 3300005937 Bacteria 2100
194 Ga0070717_10021459 3300006028 Bacteria 5089
195 Ga0070717_10527144 3300006028 Unclassified 1069
196 Ga0075432_10021698 3300006058 Bacteria 2195
197 Ga0070715_10020498 3300006163 Unclassified 2551
198 Ga0070716_100001823 3300006173 Bacteria 9652
199 Ga0070716_100016982 3300006173 Unclassified 3766
200 Ga0070712_100014499 3300006175 Bacteria 5058
201 Ga0070712_100032441 3300006175 Unclassified 3527
202 Ga0070712_100050661 3300006175 Bacteria 2890
203 Ga0070712_100051125 3300006175 Plasmid 2878
204 Ga0070712_100499292 3300006175 Bacteria 1020
205 Ga0075367_10009088 3300006178 Bacteria 5176
206 Ga0075427_10001549 3300006194 Bacteria 2969
207 Ga0097621_100021768 3300006237 Bacteria 4967
208 Ga0097621_100031346 3300006237 Bacteria 4218
209 Ga0097621_100073441 3300006237 Unclassified 2831
210 Ga0075370_10131248 3300006353 Unclassified 1462
211 Ga0075370_10252665 3300006353 Unclassified 1045
212 Ga0068871_100000417 3300006358 Bacteria 29416
213 Ga0068871_100011895 3300006358 Bacteria 6403
214 Ga0068871_100357746 3300006358 Unclassified 1292
215 Ga0075428_100010422 3300006844 Bacteria 10321
216 Ga0075430_100001576 3300006846 Bacteria 18645
217 Ga0075430_100095225 3300006846 Bacteria 2489
218 Ga0075431_100002654 3300006847 Bacteria 17313
219 Ga0075433_10011770 3300006852 Bacteria 7046
220 Ga0075433_10017308 3300006852 Bacteria 5967
221 Ga0075433_10047158 3300006852 Bacteria 3748
222 Ga0075433_10221434 3300006852 Unclassified 1681
223 Ga0075434_100001354 3300006871 Bacteria 20567
224 Ga0075434_100002767 3300006871 Bacteria 15520
225 Ga0075434_100011160 3300006871 Bacteria 8453
226 Ga0075434_100188185 3300006871 Bacteria 2084
227 Ga0075429_100001895 3300006880 Bacteria 17336
228 Ga0075429_100309124 3300006880 Bacteria 1384
229 Ga0068865_100000450 3300006881 Bacteria 22865
230 Ga0068865_100149202 3300006881 Bacteria 1772
231 Ga0097620_100003690 3300006931 Bacteria 15603
232 Ga0097620_100146739 3300006931 Bacteria 2434
233 Ga0097620_100231649 3300006931 Bacteria 1935
234 Ga0097620_100233630 3300006931 Bacteria 1927
235 Ga0075435_100003745 3300007076 Bacteria 10359
236 Ga0075435_100014388 3300007076 Bacteria 5912
237 Ga0075435_100154700 3300007076 Bacteria 1929
238 Ga0075435_100228984 3300007076 Bacteria 1579
239 Ga0075435_100346988 3300007076 Unclassified 1272
240 Ga0105240_10059540 3300009093 Bacteria 4765
241 Ga0105240_10177548 3300009093 Plasmid 2517
242 Ga0111539_10000196 3300009094 Bacteria 70998
243 Ga0111539_10013383 3300009094 Bacteria 10255
244 Ga0111539_10027016 3300009094 Bacteria 7010
245 Ga0111539_10655615 3300009094 Bacteria 1222
246 Ga0111539_11067943 3300009094 Bacteria 938
247 Ga0105245_10026898 3300009098 Bacteria 5065
248 Ga0105245_10458835 3300009098 Unclassified 1284
249 Ga0105247_10013936 3300009101 Plasmid 4821
250 Ga0105247_10182088 3300009101 Unclassified 1403
251 Ga0105247_10212672 3300009101 Bacteria 1305
252 Ga0105247_10234103 3300009101 Bacteria 1248
253 Ga0114129_10013413 3300009147 Bacteria 11678
254 Ga0114129_10020551 3300009147 Bacteria 9391
255 Ga0105243_10002051 3300009148 Bacteria 17085
256 Ga0105243_10044187 3300009148 Unclassified 3494
257 Ga0105243_10702399 3300009148 Bacteria 986
258 Ga0105241_10001526 3300009174 Bacteria 17741
259 Ga0105241_10132786 3300009174 Bacteria 2018
260 Ga0105241_10383803 3300009174 Bacteria 1228
261 Ga0105242_10000399 3300009176 Bacteria 34466
262 Ga0105242_10066427 3300009176 Plasmid 2978
263 Ga0105242_10285747 3300009176 Unclassified 1500
264 Ga0105248_10004145 3300009177 Bacteria 16029
265 Ga0105248_10068292 3300009177 Unclassified 3991
266 Ga0105248_10085160 3300009177 Bacteria 3557
267 Ga0105237_10006666 3300009545 Bacteria 12762
268 Ga0105237_10038653 3300009545 Bacteria 4818
269 Ga0105237_10040533 3300009545 Bacteria 4696
270 Ga0105237_10458258 3300009545 Bacteria 1281
271 Ga0105238_10111550 3300009551 Plasmid 2715
272 Ga0105238_10432216 3300009551 Unclassified 1312
273 Ga0105249_10002756 3300009553 Bacteria 15191
274 Ga0105249_10013099 3300009553 Bacteria 7319
275 Ga0105249_10831782 3300009553 Unclassified 988
276 Ga0105239_10043528 3300010375 Plasmid 4922
277 Ga0105239_10105506 3300010375 Bacteria 3121
278 Ga0105239_10478136 3300010375 Unclassified 1415
279 Ga0105239_10493535 3300010375 Unclassified 1392
280 Ga0105246_10000033 3300011119 Bacteria 50575
281 Ga0105246_10203566 3300011119 Unclassified 1540
282 Ga0105246_10254007 3300011119 Bacteria 1397
283 Ga0157373_10006645 3300013100 Bacteria 8615
284 Ga0157371_10015424 3300013102 Bacteria 5731
285 Ga0157371_10052511 3300013102 Bacteria 2895
286 Ga0157370_10114232 3300013104 Bacteria 2523
287 Ga0157370_10144803 3300013104 Unclassified 2213
288 Ga0157369_10494186 3300013105 Unclassified 1266
289 Ga0157374_10002423 3300013296 Bacteria 15718
290 Ga0157374_10201748 3300013296 Bacteria 1948
291 Ga0157374_10209982 3300013296 Bacteria 1909
292 Ga0157374_10228712 3300013296 Bacteria 1827
293 Ga0157378_10011328 3300013297 Bacteria 7804
294 Ga0163162_10175648 3300013306 Unclassified 2267
295 Ga0163162_10429942 3300013306 Bacteria 1452
296 Ga0157372_10001162 3300013307 Bacteria 28497
297 Ga0157372_10531519 3300013307 Bacteria 1371
298 Ga0157372_10783681 3300013307 Unclassified 1108
299 Ga0157375_10000124 3300013308 Bacteria 76003
300 Ga0157375_10022011 3300013308 Bacteria 5861
301 Ga0157375_10193278 3300013308 Bacteria 2190
302 Ga0163163_10000745 3300014325 Bacteria 27709
303 Ga0163163_10173646 3300014325 Unclassified 2201
304 Ga0163163_10591800 3300014325 Bacteria 1172
305 Ga0157380_10000140 3300014326 Bacteria 40628
306 Ga0157380_10294780 3300014326 Bacteria 1491
307 Ga0157377_10000117 3300014745 Bacteria 53219
308 Ga0157377_10120726 3300014745 Unclassified 1588
309 Ga0157379_10000785 3300014968 Bacteria 25777
310 Ga0157379_10020035 3300014968 Bacteria 5912
311 Ga0157379_10055182 3300014968 Unclassified 3550
312 Ga0157379_10507186 3300014968 Unclassified 1119
313 Ga0157376_10000034 3300014969 Bacteria 161526
314 Ga0206354_10939082 3300020081 Unclassified 1036
315 Ga0213876_10037930 3300021384 Bacteria 2542
316 Ga0207666_1000017 3300025271 Bacteria 40049
317 Ga0207666_1000448 3300025271 Bacteria 5327
318 Ga0207673_1000258 3300025290 Bacteria 5406
319 Ga0207697_10000009 3300025315 Bacteria 67526
320 Ga0207697_10001569 3300025315 Bacteria 12343
321 Ga0207682_10000301 3300025893 Bacteria 22279
322 Ga0207692_10005897 3300025898 Bacteria 4940
323 Ga0207642_10001973 3300025899 Bacteria 6336
324 Ga0207710_10004684 3300025900 Bacteria 5936
325 Ga0207710_10094733 3300025900 Bacteria 1402
326 Ga0207688_10000012 3300025901 Bacteria 60353
327 Ga0207688_10287309 3300025901 Bacteria 1003
328 Ga0207647_10005111 3300025904 Bacteria 9660
329 Ga0207647_10017208 3300025904 Plasmid 4919
330 Ga0207685_10005072 3300025905 Plasmid 3431
331 Ga0207699_10001620 3300025906 Bacteria 10680
332 Ga0207699_10002309 3300025906 Bacteria 9013
333 Ga0207645_10000124 3300025907 Bacteria 58746
334 Ga0207645_10008610 3300025907 Bacteria 7104
335 Ga0207643_10000046 3300025908 Bacteria 80736
336 Ga0207705_10008788 3300025909 Bacteria 7363
337 Ga0207705_10027090 3300025909 Bacteria 4085
338 Ga0207705_10209221 3300025909 Bacteria 1479
339 Ga0207654_10003867 3300025911 Bacteria 7546
340 Ga0207654_10051066 3300025911 Bacteria 2378
341 Ga0207707_10021900 3300025912 Bacteria 5586
342 Ga0207707_10052526 3300025912 Bacteria 3548
343 Ga0207707_10065374 3300025912 Bacteria 3168
344 Ga0207707_10140111 3300025912 Bacteria 2115
345 Ga0207707_10414139 3300025912 Bacteria 1156
346 Ga0207707_10530181 3300025912 Unclassified 1002
347 Ga0207671_10253315 3300025914 Bacteria 1384
348 Ga0207693_10005252 3300025915 Bacteria 10836
349 Ga0207693_10158542 3300025915 Unclassified 1780
350 Ga0207693_10185006 3300025915 Bacteria 1640
351 Ga0207663_10012608 3300025916 Bacteria 4577
352 Ga0207663_10066915 3300025916 Bacteria 2302
353 Ga0207663_10186245 3300025916 Bacteria 1486
354 Ga0207660_10001510 3300025917 Bacteria 15663
355 Ga0207660_10020034 3300025917 Bacteria 4482
356 Ga0207660_10139087 3300025917 Bacteria 1855
357 Ga0207660_10264613 3300025917 Bacteria 1361
358 Ga0207662_10000222 3300025918 Bacteria 26332
359 Ga0207657_10000162 3300025919 Bacteria 68121
360 Ga0207657_10008982 3300025919 Bacteria 10097
361 Ga0207657_10031279 3300025919 Bacteria 4824
362 Ga0207649_10000798 3300025920 Bacteria 20284
363 Ga0207649_10050147 3300025920 Bacteria 2581
364 Ga0207649_10074301 3300025920 Unclassified 2181
365 Ga0207652_10066691 3300025921 Bacteria 3120
366 Ga0207652_10126524 3300025921 Unclassified 2277
367 Ga0207652_10150391 3300025921 Bacteria 2084
368 Ga0207652_10157030 3300025921 Bacteria 2038
369 Ga0207652_10272769 3300025921 Unclassified 1526
370 Ga0207652_10343981 3300025921 Bacteria 1346
371 Ga0207646_10153575 3300025922 Unclassified 2076
372 Ga0207681_10003611 3300025923 Bacteria 9628
373 Ga0207694_10090129 3300025924 Unclassified 2419
374 Ga0207694_10326208 3300025924 Unclassified 1268
375 Ga0207650_10031847 3300025925 Plasmid 3811
376 Ga0207650_10059776 3300025925 Unclassified 2842
377 Ga0207650_10230395 3300025925 Bacteria 1494
378 Ga0207659_10016376 3300025926 Bacteria 4823
379 Ga0207687_10011784 3300025927 Bacteria 5721
380 Ga0207687_10236956 3300025927 Unclassified 1444
381 Ga0207700_10000290 3300025928 Bacteria 29736
382 Ga0207700_10022250 3300025928 Bacteria 4346
383 Ga0207664_10026121 3300025929 Unclassified 4409
384 Ga0207664_10097295 3300025929 Unclassified 2424
385 Ga0207664_10162640 3300025929 Unclassified 1905
386 Ga0207644_10018037 3300025931 Bacteria 4771
387 Ga0207644_10124978 3300025931 Unclassified 1962
388 Ga0207706_10000368 3300025933 Bacteria 48834
389 Ga0207706_10007484 3300025933 Bacteria 10098
390 Ga0207706_10058572 3300025933 Plasmid 3393
391 Ga0207686_10010832 3300025934 Bacteria 4971
392 Ga0207686_10034817 3300025934 Plasmid 3017
393 Ga0207709_10000256 3300025935 Bacteria 63853
394 Ga0207709_10147387 3300025935 Unclassified 1626
395 Ga0207670_10450041 3300025936 Bacteria 1038
396 Ga0207669_10001765 3300025937 Bacteria 9180
397 Ga0207669_10315477 3300025937 Bacteria 1194
398 Ga0207669_10585300 3300025937 Unclassified 905
399 Ga0207704_10002423 3300025938 Bacteria 8389
400 Ga0207665_10024323 3300025939 Plasmid 3993
401 Ga0207691_10000303 3300025940 Bacteria 48873
402 Ga0207711_10048233 3300025941 Bacteria 3644
403 Ga0207689_10000109 3300025942 Bacteria 67941
404 Ga0207661_10010457 3300025944 Bacteria 6680
405 Ga0207661_10106083 3300025944 Unclassified 2368
406 Ga0207661_10528559 3300025944 Bacteria 1079
407 Ga0207679_10000031 3300025945 Bacteria 165962
408 Ga0207679_10068452 3300025945 Bacteria 2667
409 Ga0207667_10002481 3300025949 Bacteria 22990
410 Ga0207667_10015271 3300025949 Bacteria 8732
411 Ga0207667_10078969 3300025949 Unclassified 3410
412 Ga0207651_10404483 3300025960 Bacteria 1162
413 Ga0207712_10001848 3300025961 Bacteria 13972
414 Ga0207712_10307709 3300025961 Unclassified 1303
415 Ga0207668_10001339 3300025972 Bacteria 14601
416 Ga0207640_10001185 3300025981 Bacteria 14246
417 Ga0207658_10016049 3300025986 Bacteria 5144
418 Ga0207658_10056945 3300025986 Unclassified 2903
419 Ga0207658_10102245 3300025986 Unclassified 2247
420 Ga0207677_10335012 3300026023 Unclassified 1262
421 Ga0207703_10008545 3300026035 Bacteria 8088
422 Ga0207639_10050194 3300026041 Plasmid 3167
423 Ga0207678_10000158 3300026067 Bacteria 56255
424 Ga0207678_10030340 3300026067 Bacteria 4720
425 Ga0207678_10073370 3300026067 Plasmid 2933
426 Ga0207678_10141821 3300026067 Unclassified 2051
427 Ga0207708_10000098 3300026075 Bacteria 67005
428 Ga0207708_10005985 3300026075 Bacteria 9009
429 Ga0207708_10122629 3300026075 Unclassified 2026
430 Ga0207702_10043424 3300026078 Bacteria 3774
431 Ga0207702_10319440 3300026078 Bacteria 1478
432 Ga0207702_10375330 3300026078 Unclassified 1366
433 Ga0207702_10739746 3300026078 Bacteria 970
434 Ga0207641_10025880 3300026088 Bacteria 4839
435 Ga0207641_10656842 3300026088 Unclassified 1030
436 Ga0207648_10000696 3300026089 Bacteria 37592
437 Ga0207648_10211259 3300026089 Unclassified 1723
438 Ga0207676_10005342 3300026095 Bacteria 9098
439 Ga0207676_10105319 3300026095 Bacteria 2348
440 Ga0207676_10269041 3300026095 Bacteria 1542
441 Ga0207674_10000420 3300026116 Bacteria 55287
442 Ga0207675_100001146 3300026118 Bacteria 26264
443 Ga0207675_100184391 3300026118 Unclassified 2000
444 Ga0207675_100383127 3300026118 Unclassified 1383
445 Ga0207683_10000004 3300026121 Bacteria 188086
446 Ga0207683_10001766 3300026121 Bacteria 19131
447 Ga0207683_10016095 3300026121 Bacteria 6365
448 Ga0207698_10015254 3300026142 Bacteria 5143
449 Ga0207698_10021138 3300026142 Bacteria 4495
450 Ga0209973_1013981 3300027252 Unclassified 996
451 Ga0209984_1007530 3300027424 Bacteria 1353
452 Ga0209970_1017406 3300027614 Unclassified 1203
453 Ga0210002_1002603 3300027617 Plasmid 2610
454 Ga0209971_1011172 3300027682 Bacteria 2126
455 Ga0209971_1014527 3300027682 Archaea 1867
456 Ga0209998_10003042 3300027717 Plasmid 3726
457 Ga0209998_10009889 3300027717 Unclassified 1977
458 Ga0209974_10000117 3300027876 Bacteria 23200
459 Ga0207428_10000250 3300027907 Bacteria 73217
460 Ga0207428_10001707 3300027907 Bacteria 22539
461 Ga0207428_10007251 3300027907 Bacteria 10137
462 Ga0268266_10009789 3300028379 Bacteria 8432
463 Ga0268265_10005880 3300028380 Bacteria 8360
464 Ga0268265_10054430 3300028380 Plasmid 3036
465 Ga0268264_10076905 3300028381 Bacteria 2841
466 Ga0268264_10108780 3300028381 Unclassified 2424
467 Ga0268264_10157143 3300028381 Unclassified 2044
468 Ga0265337_1005419 3300028556 Bacteria 5064
469 Ga0265318_10072287 3300028577 Bacteria 1278
470 Ga0265338_10009970 3300028800 Bacteria 11231
471 Ga0265338_10205712 3300028800 Unclassified 1481
472 Ga0265338_10261562 3300028800 Bacteria 1272
473 Ga0265325_10000039 3300031241 Bacteria 93014
474 Ga0265325_10000568 3300031241 Bacteria 26844
475 Ga0265325_10001242 3300031241 Bacteria 18188
476 Ga0265325_10007949 3300031241 Bacteria 6301
477 Ga0265325_10090448 3300031241 Unclassified 1510
478 Ga0265325_10118878 3300031241 Bacteria 1276
479 Ga0265329_10051651 3300031242 Bacteria 1309
480 Ga0265340_10011649 3300031247 Bacteria 4667
481 Ga0265340_10058550 3300031247 Bacteria 1850
482 Ga0265340_10068395 3300031247 Bacteria 1687
483 Ga0265339_10000060 3300031249 Bacteria 97276
484 Ga0265339_10004978 3300031249 Bacteria 8945
485 Ga0265339_10061175 3300031249 Bacteria 2027
486 Ga0265339_10108445 3300031249 Bacteria 1439
487 Ga0265316_10124161 3300031344 Bacteria 1948
488 Ga0265316_10154592 3300031344 Bacteria 1717
489 Ga0265313_10000072 3300031595 Bacteria 98635
490 Ga0265313_10000094 3300031595 Bacteria 89774
491 Ga0265313_10002026 3300031595 Bacteria 18179
492 Ga0265313_10013232 3300031595 Bacteria 4967
493 Ga0265313_10027718 3300031595 Bacteria 2961
494 Ga0265313_10094571 3300031595 Bacteria 1335
495 Ga0316579_10011195 3300031691 Bacteria 3808
496 Ga0265314_10011949 3300031711 Bacteria 7123
497 Ga0265314_10060949 3300031711 Bacteria 2572
498 Ga0265314_10087310 3300031711 Bacteria 2040
499 Ga0265342_10001132 3300031712 Bacteria 25514
500 Ga0265342_10017648 3300031712 Bacteria 4638
501 Ga0373948_0004653 3300034817 Unclassified 2184
502 Ga0373950_0000252 3300034818 Bacteria 6789
503 Ga0373950_0013749 3300034818 Bacteria 1354
504 Ga0373958_0000253 3300034819 Bacteria 6279
505 Ga0373958_0051445 3300034819 Bacteria 871
506 Ga0373959_0042536 3300034820 Unclassified 958
507 Ga0373926_0006367 3300035083 Bacteria 3921
508 Ga0373926_0009032 3300035083 Bacteria 3324
509 Ga0373928_0016950 3300035084 Bacteria 1495
510 Ga0373934_0178791 3300035086 Bacteria 872
511 Ga0373940_0001059 3300035088 Bacteria 4755
512 Ga0373944_0016839 3300035089 Bacteria 2067
513 Ga0373949_0007253 3300035090 Unclassified 2427
514 Ga0373951_0012875 3300035091 Bacteria 1881
515 Ga0373951_0025908 3300035091 Bacteria 1363
516 Ga0373952_0003163 3300035092 Plasmid 2963
517 Ga0373923_0020973 3300035111 Unclassified 2546
518 Ga0373923_0188808 3300035111 Bacteria 949
519 Ga0373932_0001805 3300035112 Bacteria 5763
520 Ga0373932_0015369 3300035112 Unclassified 1939
521 Ga0373936_0017326 3300035113 Unclassified 2773
522 Ga0373936_0023704 3300035113 Bacteria 2393
523 Ga0373936_0050063 3300035113 Unclassified 1689
524 Ga0373939_0002173 3300035114 Bacteria 4651
525 Ga0373939_0002190 3300035114 Plasmid 4629
526 Ga0373939_0063931 3300035114 Bacteria 1180
527 Ga0373941_0004921 3300035115 Bacteria 3112
528 Ga0373941_0005662 3300035115 Unclassified 2957
529 Ga0373941_0023592 3300035115 Bacteria 1758
530 Ga0373945_0000631 3300035116 Bacteria 10130
531 Ga0373945_0060108 3300035116 Bacteria 1416
532 Ga0373953_0112980 3300035117 Bacteria 1150
533 Ga0373953_0156098 3300035117 Bacteria 980
534 Ga0373954_0041392 3300035118 Unclassified 2148
535 Ga0373954_0059511 3300035118 Bacteria 1800
536 Ga0373954_0088350 3300035118 Bacteria 1486
537 Ga0373956_0011799 3300035119 Bacteria 3607
538 Ga0373956_0048683 3300035119 Bacteria 1899
539 Ga0373956_0085892 3300035119 Bacteria 1447
540 Ga0373957_0084793 3300035120 Bacteria 1253
541 Ga0373960_0028487 3300035121 Unclassified 1542
542 Ga0373943_0000576 3300035170 Bacteria 15908
543 Ga0373946_0020057 3300035171 Bacteria 2580
544 Ga0373955_0000486 3300035172 Bacteria 16843
545 Ga0373955_0008616 3300035172 Bacteria 4744
546 Ga0373955_0011699 3300035172 Bacteria 4193
547 Ga0373955_0266221 3300035172 Bacteria 1029
548 Ga0373942_0003463 3300035207 Plasmid 3705
549 Ga0373942_0046125 3300035207 Bacteria 1206
550 Ga0373961_0015754 3300035241 Bacteria 1937
551 Ga0373924_0011641 3300035410 Bacteria 3271
552 Ga0373931_0022894 3300035691 Unclassified 3148
553 Ga0373931_0050564 3300035691 Unclassified 2211
554 Ga0373935_0009157 3300035692 Bacteria 5924
555 Ga0373935_0010279 3300035692 Bacteria 5611
556 Ga0373935_0098587 3300035692 Unclassified 1923
557 Ga0373935_0104772 3300035692 Bacteria 1870
558 Ga0373935_0121379 3300035692 Unclassified 1746
559 Ga0373935_0290427 3300035692 Bacteria 1153
560 Ga0373927_0000994 3300035695 Bacteria 21579
561 Ga0373927_0125644 3300035695 Bacteria 1674
562 Ga0373927_0247215 3300035695 Bacteria 1172
563 Ga0373933_0001169 3300035724 Bacteria 15570
564 Ga0373933_0011184 3300035724 Unclassified 4938
565 Ga0373933_0048350 3300035724 Bacteria 2533
566 Ga0373933_0056238 3300035724 Bacteria 2361
567 Ga0373947_0000084 3300035725 Bacteria 46913
568 Ga0373947_0000874 3300035725 Bacteria 18211
569 Ga0373947_0179277 3300035725 Bacteria 1378
570 Ga0373947_0338826 3300035725 Bacteria 1007
571 Ga0373937_0003379 3300036401 Bacteria 13396
572 Ga0373937_0015326 3300036401 Bacteria 6778
573 Ga0373937_0027230 3300036401 Bacteria 5169
574 Ga0373937_0029009 3300036401 Bacteria 5011
575 Ga0373937_0029562 3300036401 Bacteria 4963
576 Ga0373937_0351105 3300036401 Bacteria 1397
577 Ga0373937_0457683 3300036401 Bacteria 1212
578 Ga0373925_0002271 3300037068 Bacteria 15571
579 Ga0373925_0009697 3300037068 Bacteria 7005
580 Ga0373925_0097726 3300037068 Bacteria 2252
581 Ga0373925_0105792 3300037068 Bacteria 2168
582 Ga0373925_0155420 3300037068 Unclassified 1798
583 Ga0373925_0499589 3300037068 Bacteria 998
584 Ga0395899_0018964 3300037312 Bacteria 5227
585 Ga0395899_0363665 3300037312 Unclassified 965
586 Ga0395900_0013490 3300037418 Bacteria 8349
587 Ga0395900_0033443 3300037418 Bacteria 5291
588 Ga0395900_0265905 3300037418 Bacteria 1711
589 Ga0395898_0002017 3300037466 Bacteria 25468
590 Ga0395898_0019431 3300037466 Bacteria 6914
591 Ga0395898_0070625 3300037466 Bacteria 3375
592 Ga0395901_0033083 3300038443 Bacteria 5335
593 Ga0395901_0040672 3300038443 Bacteria 4816
594 Ga0395901_0731074 3300038443 Unclassified 984
595 Ga0436365_1084775 3300039437 Bacteria 2258
596 Ga0436365_1446426 3300039437 Bacteria 6334
597 Ga0436365_1906059 3300039437 Bacteria 2235
598 Ga0439435_0051813 3300042436 Unclassified 1177
599 Ga0451577_0257160 3300042876 Bacteria 1581
600 Ga0466963_0011264 3300044694 Bacteria 5442
601 Ga0453684_0114945 3300044712 Plasmid 3262
602 Ga0466957_0444620 3300044842 Bacteria 892
603 Ga0451576_0047663 3300045051 Plasmid 4504
604 Ga0466958_0069110 3300045836 Unclassified 2160
605 Ga0466967_0001558 3300045976 Bacteria 13445
606 Ga0495617_008848 3300046452 Bacteria 3465
607 Ga0495592_0010591 3300046454 Bacteria 6955
608 Ga0495592_0012448 3300046454 Bacteria 6461
609 Ga0495592_0015983 3300046454 Bacteria 5693
610 Ga0495603_0001529 3300046455 Bacteria 13515
611 Ga0495603_0084857 3300046455 Bacteria 1854
612 Ga0495629_0001129 3300046459 Bacteria 21115
613 Ga0495629_0140647 3300046459 Bacteria 1679
614 Ga0495629_0181730 3300046459 Bacteria 1457
615 Ga0495641_0009864 3300046461 Bacteria 5622
616 Ga0495641_0121583 3300046461 Unclassified 1165
617 Ga0495651_0000565 3300046462 Bacteria 28643
618 Ga0495651_0005013 3300046462 Bacteria 10117
619 Ga0495651_0012172 3300046462 Bacteria 6623
620 Ga0495651_0248990 3300046462 Bacteria 1214
621 Ga0495653_0020000 3300046463 Bacteria 5425
622 Ga0495653_0080969 3300046463 Bacteria 2400
623 Ga0495653_0083117 3300046463 Bacteria 2362
624 Ga0495653_0106269 3300046463 Bacteria 2025
625 Ga0495580_0014617 3300046472 Bacteria 5950
626 Ga0495580_0081545 3300046472 Bacteria 2254
627 Ga0495582_0003684 3300046473 Bacteria 8636
628 Ga0495582_0106862 3300046473 Unclassified 1570
629 Ga0495639_0034974 3300046475 Bacteria 2247
630 Ga0495639_0061948 3300046475 Unclassified 1716
631 Ga0495662_0012418 3300046476 Bacteria 4156
632 Ga0495662_0017919 3300046476 Plasmid 3427
633 Ga0495664_0000810 3300046477 Bacteria 15995
634 Ga0495664_0005186 3300046477 Bacteria 7151
635 Ga0495664_0005968 3300046477 Bacteria 6711
636 Ga0495664_0016079 3300046477 Unclassified 4261
637 Ga0495584_0011215 3300046491 Bacteria 4591
638 Ga0495584_0052830 3300046491 Unclassified 2045
639 Ga0495585_0002467 3300046492 Bacteria 13224
640 Ga0495594_0031402 3300046499 Unclassified 2879
641 Ga0495594_0040820 3300046499 Bacteria 2540
642 Ga0495607_0004861 3300046501 Bacteria 9794
643 Ga0495583_0034275 3300046506 Bacteria 2434
644 Ga0495608_0003844 3300046511 Bacteria 10793
645 Ga0495608_0021633 3300046511 Bacteria 4414
646 Ga0495608_0052610 3300046511 Bacteria 2695
647 Ga0495608_0258057 3300046511 Bacteria 1086
648 Ga0495618_0000917 3300046514 Bacteria 20251
649 Ga0495618_0001056 3300046514 Bacteria 18774
650 Ga0495618_0139377 3300046514 Bacteria 1551
651 Ga0495618_0141972 3300046514 Bacteria 1536
652 Ga0495628_0004353 3300046516 Bacteria 12563
653 Ga0495628_0007281 3300046516 Bacteria 9588
654 Ga0495628_0024488 3300046516 Bacteria 4940
655 Ga0495628_0102206 3300046516 Bacteria 2212
656 Ga0495630_0002361 3300046517 Bacteria 13096
657 Ga0495630_0037747 3300046517 Bacteria 3612
658 Ga0495630_0104139 3300046517 Bacteria 2147
659 Ga0495631_0082807 3300046518 Bacteria 1383
660 Ga0495644_0000977 3300046523 Bacteria 11861
661 Ga0495663_0008995 3300046525 Bacteria 2768
662 Ga0495666_0010301 3300046526 Bacteria 4661
663 Ga0495652_0003321 3300046529 Bacteria 15975
664 Ga0495652_0011095 3300046529 Bacteria 8164
665 Ga0495652_0036189 3300046529 Bacteria 4293
666 Ga0495652_0042569 3300046529 Bacteria 3915
667 Ga0495652_0051988 3300046529 Unclassified 3496
668 Ga0495652_0107167 3300046529 Bacteria 2255
669 Ga0495652_0231048 3300046529 Bacteria 1383
670 Ga0495665_0010372 3300046531 Bacteria 5041
671 Ga0495665_0027263 3300046531 Plasmid 3067
672 Ga0495665_0033062 3300046531 Bacteria 2766
673 Ga0495665_0054425 3300046531 Unclassified 2114
674 Ga0495640_0015820 3300046533 Bacteria 5661
675 Ga0495640_0071285 3300046533 Bacteria 2332
676 Ga0495640_0186056 3300046533 Bacteria 1322
677 Ga0495587_0002666 3300046536 Bacteria 11915
678 Ga0495587_0086202 3300046536 Bacteria 1817
679 Ga0495645_0001019 3300046543 Bacteria 19074
680 Ga0495645_0001763 3300046543 Bacteria 14717
681 Ga0495622_0022047 3300046557 Bacteria 2967
682 Ga0495633_0021747 3300046558 Bacteria 3203
683 Ga0495667_0000256 3300046559 Bacteria 34418
684 Ga0495667_0003202 3300046559 Bacteria 10975
685 Ga0495667_0004500 3300046559 Bacteria 9408
686 Ga0495667_0051698 3300046559 Bacteria 2710
687 Ga0495667_0080082 3300046559 Bacteria 2123
688 Ga0495667_0111204 3300046559 Bacteria 1770
689 Ga0495656_0002804 3300046615 Bacteria 5828
690 Ga0495634_0002529 3300046642 Bacteria 15163
691 Ga0495634_0085794 3300046642 Unclassified 2051
692 Ga0495634_0099557 3300046642 Unclassified 1879
693 Ga0495634_0325765 3300046642 Bacteria 924
694 Ga0495611_0006278 3300046648 Bacteria 5071
695 Ga0495635_0001674 3300046663 Bacteria 14916
696 Ga0495635_0006462 3300046663 Bacteria 8173
697 Ga0495635_0055975 3300046663 Bacteria 2716
698 Ga0495635_0063562 3300046663 Bacteria 2535
699 Ga0495635_0175513 3300046663 Bacteria 1457
700 Ga0495659_0002865 3300046664 Bacteria 5540
701 Ga0495661_0046138 3300046665 Bacteria 2662
702 Ga0495588_0040840 3300046674 Bacteria 2367
703 Ga0495657_0002838 3300046675 Bacteria 14378
704 Ga0495657_0008836 3300046675 Bacteria 7671
705 Ga0495657_0041262 3300046675 Bacteria 3160
706 Ga0495599_0014560 3300046678 Plasmid 4870
707 Ga0495599_0015487 3300046678 Bacteria 4733
708 Ga0495599_0052311 3300046678 Bacteria 2558
709 Ga0495599_0093299 3300046678 Bacteria 1878
710 Ga0495623_0006304 3300046679 Bacteria 7713
711 Ga0495623_0102325 3300046679 Bacteria 1744
712 Ga0495623_0150627 3300046679 Bacteria 1375
713 Ga0495646_0001535 3300046680 Bacteria 13774
714 Ga0495646_0003056 3300046680 Bacteria 10373
715 Ga0495646_0144578 3300046680 Bacteria 1327
716 Ga0495647_0012134 3300046681 Plasmid 2963
717 Ga0495647_0027866 3300046681 Bacteria 2078
718 Ga0495658_0007273 3300046683 Bacteria 5472
719 Ga0495658_0027556 3300046683 Bacteria 3058
720 Ga0495658_0071135 3300046683 Unclassified 2020
721 Ga0495613_0012997 3300046689 Bacteria 6186
722 Ga0495613_0082469 3300046689 Unclassified 2335
723 Ga0495613_0116360 3300046689 Bacteria 1923
724 Ga0495624_0021752 3300046690 Bacteria 4249
725 Ga0495624_0048734 3300046690 Bacteria 2687
726 Ga0495670_0000385 3300046691 Bacteria 21067
727 Ga0495600_0008913 3300046809 Bacteria 6180
728 Ga0495600_0016927 3300046809 Bacteria 4633
729 Ga0495600_0035138 3300046809 Bacteria 3254
730 Ga0495581_0001980 3300047315 Bacteria 11493
731 Ga0495581_0038963 3300047315 Unclassified 2751
732 Ga0495581_0052331 3300047315 Bacteria 2358
733 Ga0495604_0035932 3300047317 Bacteria 3909
734 Ga0495604_0059042 3300047317 Bacteria 2943
735 Ga0495604_0061187 3300047317 Unclassified 2880
736 Ga0495604_0085385 3300047317 Bacteria 2355
737 Ga0495674_0001984 3300047319 Bacteria 20115
738 Ga0495674_0004803 3300047319 Bacteria 13003
739 Ga0495674_0097401 3300047319 Bacteria 2505
740 Ga0495674_0162477 3300047319 Bacteria 1868
741 Ga0495674_0238686 3300047319 Bacteria 1498
742 Ga0495674_0538587 3300047319 Bacteria 930
743 Ga0495676_0097796 3300047321 Unclassified 2179
744 Ga0495680_0005186 3300047322 Bacteria 12294
745 Ga0495680_0005564 3300047322 Bacteria 11827
746 Ga0495680_0013978 3300047322 Bacteria 6979
747 Ga0495680_0091074 3300047322 Bacteria 2286
748 Ga0495680_0096580 3300047322 Bacteria 2206
749 Ga0495675_0000532 3300047444 Bacteria 24684
750 Ga0495675_0155300 3300047444 Bacteria 1412
751 Ga0495677_0075446 3300047445 Bacteria 1260
752 Ga0495684_0003231 3300047471 Bacteria 12790
753 Ga0495684_0020948 3300047471 Bacteria 5036
754 Ga0495684_0025239 3300047471 Bacteria 4569
755 Ga0495684_0025619 3300047471 Bacteria 4531
756 Ga0495684_0083439 3300047471 Bacteria 2423
757 Ga0495684_0089038 3300047471 Bacteria 2339
758 Ga0495593_0016546 3300047673 Plasmid 4158
759 Ga0495593_0064928 3300047673 Unclassified 1904
760 Ga0495593_0154936 3300047673 Bacteria 1158
761 Ga0495593_0235278 3300047673 Bacteria 918
762 Ga0495602_0003582 3300048088 Bacteria 16079
763 Ga0495602_0005750 3300048088 Bacteria 13013
764 Ga0495614_0081315 3300048089 Bacteria 1403
765 Ga0496100_0009690 3300048903 Bacteria 5418
766 Ga0496100_0070886 3300048903 Unclassified 2325
767 Ga0496101_0002148 3300048904 Bacteria 12040
768 Ga0496101_0016521 3300048904 Bacteria 4988
769 Ga0496101_0474639 3300048904 Bacteria 987
770 Ga0496102_0038521 3300048905 Bacteria 4314
771 Ga0496102_0228210 3300048905 Unclassified 1755
772 Ga0496102_0567603 3300048905 Unclassified 1057
773 Ga0496102_0909528 3300048905 Bacteria 801
774 Ga0496103_0030585 3300048906 Bacteria 3277
775 Ga0496103_0106174 3300048906 Unclassified 1781
776 Ga0496104_0000575 3300048907 Bacteria 31363
777 Ga0496104_0095591 3300048907 Unclassified 2842
778 Ga0496104_0297870 3300048907 Bacteria 1525
779 Ga0496104_0375378 3300048907 Bacteria 1334
780 Ga0496105_0012737 3300048908 Bacteria 6662
781 Ga0496105_0048584 3300048908 Unclassified 3502
782 Ga0496105_0116922 3300048908 Bacteria 2199
783 Ga0496105_0408681 3300048908 Bacteria 1076
784 Ga0496106_0015507 3300048909 Bacteria 5638
785 Ga0496106_0025013 3300048909 Plasmid 4441
786 Ga0496106_0238314 3300048909 Unclassified 1453
787 Ga0496107_0004066 3300048910 Bacteria 9849
788 Ga0496107_0274991 3300048910 Unclassified 1253
789 Ga0496108_0017973 3300048911 Bacteria 5784
790 Ga0496108_0040534 3300048911 Bacteria 3882
791 Ga0496108_0054196 3300048911 Bacteria 3365
792 Ga0496108_0427739 3300048911 Bacteria 1156
793 Ga0496109_0004277 3300048912 Bacteria 11931
794 Ga0496109_0026022 3300048912 Bacteria 5215
795 Ga0496109_0043968 3300048912 Bacteria 4050
796 Ga0496109_0064398 3300048912 Bacteria 3354
797 Ga0496109_0178818 3300048912 Unclassified 1992
798 Ga0496110_0039711 3300048913 Bacteria 4098
799 Ga0496110_0042792 3300048913 Bacteria 3953
800 Ga0496110_0082037 3300048913 Plasmid 2875
801 Ga0496111_0067953 3300048914 Unclassified 2590
802 Ga0496111_0076128 3300048914 Bacteria 2446
803 Ga0496111_0137455 3300048914 Bacteria 1810
804 Ga0496112_0022849 3300048915 Bacteria 5966
805 Ga0496112_0027238 3300048915 Bacteria 5511
806 Ga0496112_0076436 3300048915 Unclassified 3311
807 Ga0496112_0373305 3300048915 Unclassified 1368
808 Ga0496112_0555739 3300048915 Bacteria 1081
809 Ga0496113_0024623 3300048916 Bacteria 4280
810 Ga0496113_0035969 3300048916 Unclassified 3626
811 Ga0496113_0108250 3300048916 Bacteria 2160
812 Ga0496113_0216578 3300048916 Bacteria 1525
813 Ga0496114_0005575 3300048917 Bacteria 9865
814 Ga0496114_0016691 3300048917 Bacteria 5920
815 Ga0496115_0027862 3300048918 Plasmid 4423
816 Ga0496115_0031167 3300048918 Bacteria 4199
817 Ga0496115_0069516 3300048918 Bacteria 2852
818 Ga0496115_0127538 3300048918 Unclassified 2096
819 Ga0496115_0156486 3300048918 Bacteria 1883
820 Ga0496119_0000906 3300048922 Bacteria 38547
821 Ga0496121_0245841 3300048924 Bacteria 1244
822 Ga0496122_0016749 3300048925 Bacteria 6907
823 Ga0496123_0001118 3300048926 Bacteria 40071
824 Ga0501033_0003913 3300049570 Bacteria 12090
825 Ga0501033_0091848 3300049570 Bacteria 2221
826 Ga0501033_0239233 3300049570 Bacteria 1288
827 Ga0501033_0429803 3300049570 Bacteria 919
828 Ga0501034_0000516 3300049571 Bacteria 62005
829 Ga0501034_0037478 3300049571 Bacteria 4910
830 Ga0501036_0392257 3300049572 Bacteria 1158
831 Ga0501038_0063990 3300049574 Bacteria 3138
832 Ga0501038_0066609 3300049574 Bacteria 3066
833 Ga0501039_0006041 3300049575 Bacteria 9191
834 Ga0501039_0054336 3300049575 Bacteria 3100
835 Ga0501040_0014268 3300049576 Bacteria 5233
836 Ga0501041_0006521 3300049577 Bacteria 6833
837 Ga0501042_0048779 3300049578 Bacteria 3019
838 Ga0501043_0048654 3300049579 Bacteria 3333
839 Ga0501046_0063893 3300049580 Bacteria 2874
840 Ga0501046_0098596 3300049580 Bacteria 2244
841 Ga0501047_0004478 3300049581 Bacteria 13149
842 Ga0501047_0044782 3300049581 Bacteria 4276
843 Ga0501047_0078933 3300049581 Bacteria 3165
844 Ga0501047_0463921 3300049581 Bacteria 1095
845 Ga0501070_0018727 3300049586 Bacteria 5809
846 Ga0501070_0037859 3300049586 Bacteria 4025
847 Ga0501070_0260332 3300049586 Bacteria 1418
848 Ga0501070_0690068 3300049586 Unclassified 808
849 Ga0501071_0038665 3300049587 Bacteria 3410
850 Ga0501072_0139806 3300049588 Bacteria 1930
851 Ga0501072_0227857 3300049588 Bacteria 1485
852 Ga0501073_0009746 3300049589 Bacteria 7073
853 Ga0501075_0006847 3300049591 Bacteria 7869
854 Ga0501076_0002990 3300049592 Bacteria 11741
855 Ga0501076_0043052 3300049592 Bacteria 3557
856 Ga0501079_0000379 3300049741 Bacteria 28580
857 Ga0501079_0125498 3300049741 Bacteria 1997
858 Ga0501079_0243350 3300049741 Bacteria 1406
859 Ga0501080_0012910 3300049742 Bacteria 7667
860 Ga0501080_0032326 3300049742 Bacteria 4880
861 Ga0501080_0308225 3300049742 Bacteria 1435
862 Ga0501081_0000033 3300049743 Bacteria 51492
863 Ga0501083_0091167 3300049744 Bacteria 2012
864 Ga0501035_0004436 3300049822 Bacteria 13316
865 Ga0501044_0005860 3300049823 Bacteria 13610
866 Ga0501044_0094254 3300049823 Bacteria 3019
867 Ga0501044_0132508 3300049823 Bacteria 2486
868 Ga0501045_0036136 3300049824 Bacteria 3587
869 nmdc:mga07m45_327029_c1 3300050496 Unclassified 891
870 nmdc:mga05p37_3041_c1 3300050507 Bacteria 19469
871 nmdc:mga09592_324265_c1 3300050508 Bacteria 1334
872 nmdc:mga09592_5026_c1 3300050508 Bacteria 10727
873 nmdc:mga0qj67_1705_c1 3300050509 Bacteria 15492
874 nmdc:mga0qj67_231261_c1 3300050509 Bacteria 1500
875 nmdc:mga06r32_2163_c1 3300050510 Bacteria 17587
876 nmdc:mga06r32_226428_c1 3300050510 Bacteria 1858
877 nmdc:mga08y16_289_c1 3300050511 Bacteria 45654
878 nmdc:mga08y16_31530_c1 3300050511 Bacteria 5575
879 nmdc:mga0n895_112788_c1 3300050512 Bacteria 2736
880 nmdc:mga0n895_140865_c1 3300050512 Bacteria 2440
881 nmdc:mga0n895_361831_c1 3300050512 Bacteria 1469
882 nmdc:mga0n895_392128_c1 3300050512 Bacteria 1405
883 nmdc:mga0n895_4459_c1 3300050512 Bacteria 11502
884 nmdc:mga0rr50_11469_c1 3300050513 Bacteria 5677
885 nmdc:mga0rr50_141250_c1 3300050513 Bacteria 1937
886 nmdc:mga0rr50_168968_c1 3300050513 Bacteria 1780
887 nmdc:mga0rr50_308633_c1 3300050513 Bacteria 1325
888 nmdc:mga0rr50_576477_c1 3300050513 Bacteria 959
889 nmdc:mga08x19_198328_c1 3300050514 Bacteria 1375
890 nmdc:mga0a205_17258_c1 3300050515 Bacteria 6763
891 nmdc:mga0a205_249588_c1 3300050515 Unclassified 1654
892 nmdc:mga0a205_3619_c1 3300050515 Bacteria 13829
893 nmdc:mga0a205_733_c2 3300050515 Bacteria 10917
894 Ga0495601_0000418 3300053077 Bacteria 22241
895 Ga0495601_0002208 3300053077 Bacteria 10952
896 Ga0495601_0003992 3300053077 Bacteria 8492
897 Ga0495601_0017457 3300053077 Bacteria 4356
898 Ga0495601_0041803 3300053077 Bacteria 2874
899 Ga0495612_0000666 3300053078 Bacteria 13871
900 Ga0495612_0011282 3300053078 Bacteria 3602
901 Ga0495612_0011744 3300053078 Bacteria 3530
902 Ga0495612_0020362 3300053078 Bacteria 2658
903 Ga0495595_0003514 3300053084 Bacteria 6221
904 Ga0495595_0013087 3300053084 Bacteria 3499
905 Ga0495595_0025852 3300053084 Unclassified 2604
906 Ga0495595_0026794 3300053084 Bacteria 2563
907 Ga0495595_0047076 3300053084 Bacteria 1988
908 Ga0495619_0002359 3300053085 Bacteria 12422
909 Ga0495619_0002566 3300053085 Bacteria 11887
910 Ga0495619_0007346 3300053085 Bacteria 6982
911 Ga0495619_0007524 3300053085 Bacteria 6899
912 Ga0495619_0017182 3300053085 Bacteria 4582
913 Ga0495619_0021147 3300053085 Bacteria 4151
914 Ga0495619_0036672 3300053085 Unclassified 3193
915 Ga0495619_0061266 3300053085 Bacteria 2503
916 Ga0495619_0098848 3300053085 Bacteria 1984
917 Ga0500643_002005 3300053087 Bacteria 10963
918 Ga0500644_0013518 3300053088 Bacteria 2281
919 Ga0500566_0105691 3300053094 Bacteria 1537
920 Ga0500650_0097840 3300053098 Bacteria 1374
921 Ga0500593_035093 3300053117 Bacteria 2245
922 Ga0500594_0047025 3300053118 Bacteria 1202
923 Ga0500595_000002 3300053119 Bacteria 1074388
924 Ga0500652_003429 3300053131 Bacteria 4801
925 Ga0500652_154862 3300053131 Bacteria 949
926 Ga0500616_0000002 3300053153 Bacteria 1611257
927 Ga0500645_000086 3300053730 Bacteria 74512
928 Ga0500645_004764 3300053730 Bacteria 5135
929 Ga0501084_0074934 3300054114 Bacteria 2835
930 Ga0501082_0003399 3300060353 Bacteria 13894
931 Ga0501082_0203082 3300060353 Bacteria 1724
932 Ga0501082_0306932 3300060353 Unclassified 1382
933 Ga0501082_0439431 3300060353 Bacteria 1140
934 Ga0466962_0080838 3300061719 Bacteria 1554
935 Ga0530510_0167878 3300061734 Bacteria 1625
936 Ga0501034_0063357
937 ARSoilYngRDRAFT_c00118
938 ARcpr5yngRDRAFT_c000035
939 ARCol0yngRDRAFT_1000516
940 JGI24752J21851_1007583
941 JGI24746J21847_1011725
942 JGI24747J21853_1002987
943 JGI24739J22299_10000158
944 JGI24737J22298_10001510
945 JGI24737J22298_10001948
946 JGI24750J21931_1000477
947 JGI24745J21846_1000120
948 JGI24738J21930_10001316
949 JGI24749J21850_1000215
950 JGI24749J21850_1004682
951 JGI24744J21845_10012002
952 JGI24035J26624_1000023
953 JGI24034J26672_10000641
954 JGI24742J22300_10002624
955 Ga0065717_1000203
956 Ga0065704_10090673
957 Ga0065712_10018330
958 Ga0065712_10093636
959 Ga0065715_10001166
960 Ga0065715_10021066
961 Ga0065715_10099722
962 Ga0070658_10006919
963 Ga0070658_10028299
964 Ga0070658_10055484
965 Ga0070676_10015064
966 Ga0070683_100012601
967 Ga0070683_100051385
968 Ga0070690_100000727
969 Ga0070690_100023181
970 Ga0070690_100038800
971 Ga0070690_100291883
972 Ga0070670_100040022
973 Ga0070670_100046230
974 Ga0070670_100566337
975 Ga0070677_10002396
976 Ga0068869_100002166
977 Ga0068869_100312538
978 Ga0070666_10022637
979 Ga0070666_10025033
980 Ga0070680_100006389
981 Ga0070680_100018615
982 Ga0070680_100057732
983 Ga0070680_100073630
984 Ga0070680_100189244
985 Ga0070680_100289243
986 Ga0070680_100448654
987 Ga0070682_100002724
988 Ga0070682_100038338
989 Ga0070682_100130177
990 Ga0068868_100002949
991 Ga0068868_100021585
992 Ga0070660_100000985
993 Ga0070660_100026353
994 Ga0070689_100000646
995 Ga0070689_100002989
996 Ga0070689_100014280
997 Ga0070691_10000060
998 Ga0070687_100000773
999 Ga0070661_100015592
1000 Ga0070661_100206021
1001 Ga0070692_10000273
1002 Ga0070668_100007804
1003 Ga0070669_100019129
1004 Ga0070675_100003854
1005 Ga0070675_100036283
1006 Ga0070671_100000349
1007 Ga0070671_100032167
1008 Ga0070671_100111836
1009 Ga0070674_100000152
1010 Ga0070674_100026791
1011 Ga0070674_100031793
1012 Ga0070673_100007455
1013 Ga0070688_100002079
1014 Ga0070688_100002194
1015 Ga0070688_100091062
1016 Ga0070659_100000621
1017 Ga0070659_100037533
1018 Ga0070667_100000810
1019 Ga0070703_10002626
1020 Ga0070709_10024168
1021 Ga0070714_100027007
1022 Ga0070714_100049823
1023 Ga0070714_100068290
1024 Ga0070714_100102916
1025 Ga0070714_100617703
1026 Ga0070713_100015547
1027 Ga0070713_100045893
1028 Ga0070713_100081039
1029 Ga0070713_100084255
1030 Ga0070710_10029249
1031 Ga0070701_10000042
1032 Ga0070701_10008593
1033 Ga0070711_100008373
1034 Ga0070711_100132629
1035 Ga0070705_100005564
1036 Ga0070705_100096394
1037 Ga0070705_100147919
1038 Ga0070700_100000329
1039 Ga0070700_100023379
1040 Ga0070694_100002007
1041 Ga0070694_100002748
1042 Ga0070708_100045860
1043 Ga0070663_100037014
1044 Ga0070663_100090670
1045 Ga0070678_100013734
1046 Ga0070678_100062841
1047 Ga0070662_100064811
1048 Ga0070662_100182156
1049 Ga0070662_100333215
1050 Ga0070662_100548462
1051 Ga0070681_10004332
1052 Ga0070681_10005076
1053 Ga0070681_10016427
1054 Ga0070681_10148826
1055 Ga0068867_100007473
1056 Ga0068867_100119720
1057 Ga0070685_10006180
1058 Ga0070685_10007245
1059 Ga0070685_10129989
1060 Ga0070706_100157073
1061 Ga0070699_100270906
1062 Ga0070679_100002742
1063 Ga0070679_100157221
1064 Ga0070679_100206314
1065 Ga0070679_100222698
1066 Ga0070679_100236175
1067 Ga0070684_100000464
1068 Ga0070684_100376832
1069 Ga0070697_100013327
1070 Ga0068853_100001029
1071 Ga0070672_100020218
1072 Ga0070672_100078130
1073 Ga0070686_100001527
1074 Ga0070695_100010249
1075 Ga0070695_100047425
1076 Ga0070695_100097437
1077 Ga0070696_100015481
1078 Ga0070696_100098522
1079 Ga0070693_100000266
1080 Ga0070693_100036753
1081 Ga0070693_100060687
1082 Ga0070665_100108939
1083 Ga0070665_100168547
1084 Ga0070704_100010668
1085 Ga0070704_100104573
1086 Ga0068855_100041697
1087 Ga0068855_100061239
1088 Ga0070664_100015424
1089 Ga0070664_100023574
1090 Ga0068857_100000888
1091 Ga0068857_100239796
1092 Ga0068857_100691623
1093 Ga0068854_100005378
1094 Ga0068856_100003260
1095 Ga0068856_100126633
1096 Ga0068856_100160523
1097 Ga0068856_100494033
1098 Ga0070702_100053415
1099 Ga0068852_100000579
1100 Ga0068852_100580680
1101 Ga0068859_100003690
1102 Ga0068859_100146749
1103 Ga0068859_100231653
1104 Ga0068859_100233619
1105 Ga0068864_100001260
1106 Ga0068864_100106019
1107 Ga0068864_100236411
1108 Ga0068864_100710527
1109 Ga0068866_10001077
1110 Ga0068866_10018692
1111 Ga0068861_100001782
1112 Ga0068861_100351967
1113 Ga0068851_10046717
1114 Ga0068870_10000108
1115 Ga0068863_100001201
1116 Ga0068863_100324236
1117 Ga0068858_100000419
1118 Ga0068858_100054459
1119 Ga0068858_100181366
1120 Ga0068860_100001359
1121 Ga0068860_100475076
1122 Ga0068860_100875780
1123 Ga0068860_100896963
1124 Ga0068862_100005815
1125 Ga0068862_100056562
1126 Ga0081455_10000009
1127 Ga0081455_10004982
1128 Ga0081455_10117653
1129 Ga0070717_10021459
1130 Ga0070717_10527144
1131 Ga0075432_10021698
1132 Ga0070715_10020498
1133 Ga0070716_100001823
1134 Ga0070716_100016982
1135 Ga0070712_100014499
1136 Ga0070712_100032441
1137 Ga0070712_100050661
1138 Ga0070712_100051125
1139 Ga0070712_100499292
1140 Ga0075367_10009088
1141 Ga0075427_10001549
1142 Ga0097621_100021768
1143 Ga0097621_100031346
1144 Ga0097621_100073441
1145 Ga0075370_10131248
1146 Ga0075370_10252665
1147 Ga0068871_100000417
1148 Ga0068871_100011895
1149 Ga0068871_100357746
1150 Ga0075428_100010422
1151 Ga0075430_100001576
1152 Ga0075430_100095225
1153 Ga0075431_100002654
1154 Ga0075433_10011770
1155 Ga0075433_10017308
1156 Ga0075433_10047158
1157 Ga0075433_10221434
1158 Ga0075434_100001354
1159 Ga0075434_100002767
1160 Ga0075434_100011160
1161 Ga0075434_100188185
1162 Ga0075429_100001895
1163 Ga0075429_100309124
1164 Ga0068865_100000450
1165 Ga0068865_100149202
1166 Ga0097620_100003690
1167 Ga0097620_100146739
1168 Ga0097620_100231649
1169 Ga0097620_100233630
1170 Ga0075435_100003745
1171 Ga0075435_100014388
1172 Ga0075435_100154700
1173 Ga0075435_100228984
1174 Ga0075435_100346988
1175 Ga0105240_10059540
1176 Ga0105240_10177548
1177 Ga0111539_10000196
1178 Ga0111539_10013383
1179 Ga0111539_10027016
1180 Ga0111539_10655615
1181 Ga0111539_11067943
1182 Ga0105245_10026898
1183 Ga0105245_10458835
1184 Ga0105247_10013936
1185 Ga0105247_10182088
1186 Ga0105247_10212672
1187 Ga0105247_10234103
1188 Ga0114129_10013413
1189 Ga0114129_10020551
1190 Ga0105243_10002051
1191 Ga0105243_10044187
1192 Ga0105243_10702399
1193 Ga0105241_10001526
1194 Ga0105241_10132786
1195 Ga0105241_10383803
1196 Ga0105242_10000399
1197 Ga0105242_10066427
1198 Ga0105242_10285747
1199 Ga0105248_10004145
1200 Ga0105248_10068292
1201 Ga0105248_10085160
1202 Ga0105237_10006666
1203 Ga0105237_10038653
1204 Ga0105237_10040533
1205 Ga0105237_10458258
1206 Ga0105238_10111550
1207 Ga0105238_10432216
1208 Ga0105249_10002756
1209 Ga0105249_10013099
1210 Ga0105249_10831782
1211 Ga0105239_10043528
1212 Ga0105239_10105506
1213 Ga0105239_10478136
1214 Ga0105239_10493535
1215 Ga0105246_10000033
1216 Ga0105246_10203566
1217 Ga0105246_10254007
1218 Ga0157373_10006645
1219 Ga0157371_10015424
1220 Ga0157371_10052511
1221 Ga0157370_10114232
1222 Ga0157370_10144803
1223 Ga0157369_10494186
1224 Ga0157374_10002423
1225 Ga0157374_10201748
1226 Ga0157374_10209982
1227 Ga0157374_10228712
1228 Ga0157378_10011328
1229 Ga0163162_10175648
1230 Ga0163162_10429942
1231 Ga0157372_10001162
1232 Ga0157372_10531519
1233 Ga0157372_10783681
1234 Ga0157375_10000124
1235 Ga0157375_10022011
1236 Ga0157375_10193278
1237 Ga0163163_10000745
1238 Ga0163163_10173646
1239 Ga0163163_10591800
1240 Ga0157380_10000140
1241 Ga0157380_10294780
1242 Ga0157377_10000117
1243 Ga0157377_10120726
1244 Ga0157379_10000785
1245 Ga0157379_10020035
1246 Ga0157379_10055182
1247 Ga0157379_10507186
1248 Ga0157376_10000034
1249 Ga0206354_10939082
1250 Ga0213876_10037930
1251 Ga0207666_1000017
1252 Ga0207666_1000448
1253 Ga0207673_1000258
1254 Ga0207697_10000009
1255 Ga0207697_10001569
1256 Ga0207682_10000301
1257 Ga0207692_10005897
1258 Ga0207642_10001973
1259 Ga0207710_10004684
1260 Ga0207710_10094733
1261 Ga0207688_10000012
1262 Ga0207688_10287309
1263 Ga0207647_10005111
1264 Ga0207647_10017208
1265 Ga0207685_10005072
1266 Ga0207699_10001620
1267 Ga0207699_10002309
1268 Ga0207645_10000124
1269 Ga0207645_10008610
1270 Ga0207643_10000046
1271 Ga0207705_10008788
1272 Ga0207705_10027090
1273 Ga0207705_10209221
1274 Ga0207654_10003867
1275 Ga0207654_10051066
1276 Ga0207707_10021900
1277 Ga0207707_10052526
1278 Ga0207707_10065374
1279 Ga0207707_10140111
1280 Ga0207707_10414139
1281 Ga0207707_10530181
1282 Ga0207671_10253315
1283 Ga0207693_10005252
1284 Ga0207693_10158542
1285 Ga0207693_10185006
1286 Ga0207663_10012608
1287 Ga0207663_10066915
1288 Ga0207663_10186245
1289 Ga0207660_10001510
1290 Ga0207660_10020034
1291 Ga0207660_10139087
1292 Ga0207660_10264613
1293 Ga0207662_10000222
1294 Ga0207657_10000162
1295 Ga0207657_10008982
1296 Ga0207657_10031279
1297 Ga0207649_10000798
1298 Ga0207649_10050147
1299 Ga0207649_10074301
1300 Ga0207652_10066691
1301 Ga0207652_10126524
1302 Ga0207652_10150391
1303 Ga0207652_10157030
1304 Ga0207652_10272769
1305 Ga0207652_10343981
1306 Ga0207646_10153575
1307 Ga0207681_10003611
1308 Ga0207694_10090129
1309 Ga0207694_10326208
1310 Ga0207650_10031847
1311 Ga0207650_10059776
1312 Ga0207650_10230395
1313 Ga0207659_10016376
1314 Ga0207687_10011784
1315 Ga0207687_10236956
1316 Ga0207700_10000290
1317 Ga0207700_10022250
1318 Ga0207664_10026121
1319 Ga0207664_10097295
1320 Ga0207664_10162640
1321 Ga0207644_10018037
1322 Ga0207644_10124978
1323 Ga0207706_10000368
1324 Ga0207706_10007484
1325 Ga0207706_10058572
1326 Ga0207686_10010832
1327 Ga0207686_10034817
1328 Ga0207709_10000256
1329 Ga0207709_10147387
1330 Ga0207670_10450041
1331 Ga0207669_10001765
1332 Ga0207669_10315477
1333 Ga0207669_10585300
1334 Ga0207704_10002423
1335 Ga0207665_10024323
1336 Ga0207691_10000303
1337 Ga0207711_10048233
1338 Ga0207689_10000109
1339 Ga0207661_10010457
1340 Ga0207661_10106083
1341 Ga0207661_10528559
1342 Ga0207679_10000031
1343 Ga0207679_10068452
1344 Ga0207667_10002481
1345 Ga0207667_10015271
1346 Ga0207667_10078969
1347 Ga0207651_10404483
1348 Ga0207712_10001848
1349 Ga0207712_10307709
1350 Ga0207668_10001339
1351 Ga0207640_10001185
1352 Ga0207658_10016049
1353 Ga0207658_10056945
1354 Ga0207658_10102245
1355 Ga0207677_10335012
1356 Ga0207703_10008545
1357 Ga0207639_10050194
1358 Ga0207678_10000158
1359 Ga0207678_10030340
1360 Ga0207678_10073370
1361 Ga0207678_10141821
1362 Ga0207708_10000098
1363 Ga0207708_10005985
1364 Ga0207708_10122629
1365 Ga0207702_10043424
1366 Ga0207702_10319440
1367 Ga0207702_10375330
1368 Ga0207702_10739746
1369 Ga0207641_10025880
1370 Ga0207641_10656842
1371 Ga0207648_10000696
1372 Ga0207648_10211259
1373 Ga0207676_10005342
1374 Ga0207676_10105319
1375 Ga0207676_10269041
1376 Ga0207674_10000420
1377 Ga0207675_100001146
1378 Ga0207675_100184391
1379 Ga0207675_100383127
1380 Ga0207683_10000004
1381 Ga0207683_10001766
1382 Ga0207683_10016095
1383 Ga0207698_10015254
1384 Ga0207698_10021138
1385 Ga0209973_1013981
1386 Ga0209984_1007530
1387 Ga0209970_1017406
1388 Ga0210002_1002603
1389 Ga0209971_1011172
1390 Ga0209971_1014527
1391 Ga0209998_10003042
1392 Ga0209998_10009889
1393 Ga0209974_10000117
1394 Ga0207428_10000250
1395 Ga0207428_10001707
1396 Ga0207428_10007251
1397 Ga0268266_10009789
1398 Ga0268265_10005880
1399 Ga0268265_10054430
1400 Ga0268264_10076905
1401 Ga0268264_10108780
1402 Ga0268264_10157143
1403 Ga0265337_1005419
1404 Ga0265318_10072287
1405 Ga0265338_10009970
1406 Ga0265338_10205712
1407 Ga0265338_10261562
1408 Ga0265325_10000039
1409 Ga0265325_10000568
1410 Ga0265325_10001242
1411 Ga0265325_10007949
1412 Ga0265325_10090448
1413 Ga0265325_10118878
1414 Ga0265329_10051651
1415 Ga0265340_10011649
1416 Ga0265340_10058550
1417 Ga0265340_10068395
1418 Ga0265339_10000060
1419 Ga0265339_10004978
1420 Ga0265339_10061175
1421 Ga0265339_10108445
1422 Ga0265316_10124161
1423 Ga0265316_10154592
1424 Ga0265313_10000072
1425 Ga0265313_10000094
1426 Ga0265313_10002026
1427 Ga0265313_10013232
1428 Ga0265313_10027718
1429 Ga0265313_10094571
1430 Ga0316579_10011195
1431 Ga0265314_10011949
1432 Ga0265314_10060949
1433 Ga0265314_10087310
1434 Ga0265342_10001132
1435 Ga0265342_10017648
1436 Ga0373948_0004653
1437 Ga0373950_0000252
1438 Ga0373950_0013749
1439 Ga0373958_0000253
1440 Ga0373958_0051445
1441 Ga0373959_0042536
1442 Ga0373926_0006367
1443 Ga0373926_0009032
1444 Ga0373928_0016950
1445 Ga0373934_0178791
1446 Ga0373940_0001059
1447 Ga0373944_0016839
1448 Ga0373949_0007253
1449 Ga0373951_0012875
1450 Ga0373951_0025908
1451 Ga0373952_0003163
1452 Ga0373923_0020973
1453 Ga0373923_0188808
1454 Ga0373932_0001805
1455 Ga0373932_0015369
1456 Ga0373936_0017326
1457 Ga0373936_0023704
1458 Ga0373936_0050063
1459 Ga0373939_0002173
1460 Ga0373939_0002190
1461 Ga0373939_0063931
1462 Ga0373941_0004921
1463 Ga0373941_0005662
1464 Ga0373941_0023592
1465 Ga0373945_0000631
1466 Ga0373945_0060108
1467 Ga0373953_0112980
1468 Ga0373953_0156098
1469 Ga0373954_0041392
1470 Ga0373954_0059511
1471 Ga0373954_0088350
1472 Ga0373956_0011799
1473 Ga0373956_0048683
1474 Ga0373956_0085892
1475 Ga0373957_0084793
1476 Ga0373960_0028487
1477 Ga0373943_0000576
1478 Ga0373946_0020057
1479 Ga0373955_0000486
1480 Ga0373955_0008616
1481 Ga0373955_0011699
1482 Ga0373955_0266221
1483 Ga0373942_0003463
1484 Ga0373942_0046125
1485 Ga0373961_0015754
1486 Ga0373924_0011641
1487 Ga0373931_0022894
1488 Ga0373931_0050564
1489 Ga0373935_0009157
1490 Ga0373935_0010279
1491 Ga0373935_0098587
1492 Ga0373935_0104772
1493 Ga0373935_0121379
1494 Ga0373935_0290427
1495 Ga0373927_0000994
1496 Ga0373927_0125644
1497 Ga0373927_0247215
1498 Ga0373933_0001169
1499 Ga0373933_0011184
1500 Ga0373933_0048350
1501 Ga0373933_0056238
1502 Ga0373947_0000084
1503 Ga0373947_0000874
1504 Ga0373947_0179277
1505 Ga0373947_0338826
1506 Ga0373937_0003379
1507 Ga0373937_0015326
1508 Ga0373937_0027230
1509 Ga0373937_0029009
1510 Ga0373937_0029562
1511 Ga0373937_0351105
1512 Ga0373937_0457683
1513 Ga0373925_0002271
1514 Ga0373925_0009697
1515 Ga0373925_0097726
1516 Ga0373925_0105792
1517 Ga0373925_0155420
1518 Ga0373925_0499589
1519 Ga0395899_0018964
1520 Ga0395899_0363665
1521 Ga0395900_0013490
1522 Ga0395900_0033443
1523 Ga0395900_0265905
1524 Ga0395898_0002017
1525 Ga0395898_0019431
1526 Ga0395898_0070625
1527 Ga0395901_0033083
1528 Ga0395901_0040672
1529 Ga0395901_0731074
1530 Ga0436365_1084775
1531 Ga0436365_1446426
1532 Ga0436365_1906059
1533 Ga0439435_0051813
1534 Ga0451577_0257160
1535 Ga0466963_0011264
1536 Ga0453684_0114945
1537 Ga0466957_0444620
1538 Ga0451576_0047663
1539 Ga0466958_0069110
1540 Ga0466967_0001558
1541 Ga0495617_008848
1542 Ga0495592_0010591
1543 Ga0495592_0012448
1544 Ga0495592_0015983
1545 Ga0495603_0001529
1546 Ga0495603_0084857
1547 Ga0495629_0001129
1548 Ga0495629_0140647
1549 Ga0495629_0181730
1550 Ga0495641_0009864
1551 Ga0495641_0121583
1552 Ga0495651_0000565
1553 Ga0495651_0005013
1554 Ga0495651_0012172
1555 Ga0495651_0248990
1556 Ga0495653_0020000
1557 Ga0495653_0080969
1558 Ga0495653_0083117
1559 Ga0495653_0106269
1560 Ga0495580_0014617
1561 Ga0495580_0081545
1562 Ga0495582_0003684
1563 Ga0495582_0106862
1564 Ga0495639_0034974
1565 Ga0495639_0061948
1566 Ga0495662_0012418
1567 Ga0495662_0017919
1568 Ga0495664_0000810
1569 Ga0495664_0005186
1570 Ga0495664_0005968
1571 Ga0495664_0016079
1572 Ga0495584_0011215
1573 Ga0495584_0052830
1574 Ga0495585_0002467
1575 Ga0495594_0031402
1576 Ga0495594_0040820
1577 Ga0495607_0004861
1578 Ga0495583_0034275
1579 Ga0495608_0003844
1580 Ga0495608_0021633
1581 Ga0495608_0052610
1582 Ga0495608_0258057
1583 Ga0495618_0000917
1584 Ga0495618_0001056
1585 Ga0495618_0139377
1586 Ga0495618_0141972
1587 Ga0495628_0004353
1588 Ga0495628_0007281
1589 Ga0495628_0024488
1590 Ga0495628_0102206
1591 Ga0495630_0002361
1592 Ga0495630_0037747
1593 Ga0495630_0104139
1594 Ga0495631_0082807
1595 Ga0495644_0000977
1596 Ga0495663_0008995
1597 Ga0495666_0010301
1598 Ga0495652_0003321
1599 Ga0495652_0011095
1600 Ga0495652_0036189
1601 Ga0495652_0042569
1602 Ga0495652_0051988
1603 Ga0495652_0107167
1604 Ga0495652_0231048
1605 Ga0495665_0010372
1606 Ga0495665_0027263
1607 Ga0495665_0033062
1608 Ga0495665_0054425
1609 Ga0495640_0015820
1610 Ga0495640_0071285
1611 Ga0495640_0186056
1612 Ga0495587_0002666
1613 Ga0495587_0086202
1614 Ga0495645_0001019
1615 Ga0495645_0001763
1616 Ga0495622_0022047
1617 Ga0495633_0021747
1618 Ga0495667_0000256
1619 Ga0495667_0003202
1620 Ga0495667_0004500
1621 Ga0495667_0051698
1622 Ga0495667_0080082
1623 Ga0495667_0111204
1624 Ga0495656_0002804
1625 Ga0495634_0002529
1626 Ga0495634_0085794
1627 Ga0495634_0099557
1628 Ga0495634_0325765
1629 Ga0495611_0006278
1630 Ga0495635_0001674
1631 Ga0495635_0006462
1632 Ga0495635_0055975
1633 Ga0495635_0063562
1634 Ga0495635_0175513
1635 Ga0495659_0002865
1636 Ga0495661_0046138
1637 Ga0495588_0040840
1638 Ga0495657_0002838
1639 Ga0495657_0008836
1640 Ga0495657_0041262
1641 Ga0495599_0014560
1642 Ga0495599_0015487
1643 Ga0495599_0052311
1644 Ga0495599_0093299
1645 Ga0495623_0006304
1646 Ga0495623_0102325
1647 Ga0495623_0150627
1648 Ga0495646_0001535
1649 Ga0495646_0003056
1650 Ga0495646_0144578
1651 Ga0495647_0012134
1652 Ga0495647_0027866
1653 Ga0495658_0007273
1654 Ga0495658_0027556
1655 Ga0495658_0071135
1656 Ga0495613_0012997
1657 Ga0495613_0082469
1658 Ga0495613_0116360
1659 Ga0495624_0021752
1660 Ga0495624_0048734
1661 Ga0495670_0000385
1662 Ga0495600_0008913
1663 Ga0495600_0016927
1664 Ga0495600_0035138
1665 Ga0495581_0001980
1666 Ga0495581_0038963
1667 Ga0495581_0052331
1668 Ga0495604_0035932
1669 Ga0495604_0059042
1670 Ga0495604_0061187
1671 Ga0495604_0085385
1672 Ga0495674_0001984
1673 Ga0495674_0004803
1674 Ga0495674_0097401
1675 Ga0495674_0162477
1676 Ga0495674_0238686
1677 Ga0495674_0538587
1678 Ga0495676_0097796
1679 Ga0495680_0005186
1680 Ga0495680_0005564
1681 Ga0495680_0013978
1682 Ga0495680_0091074
1683 Ga0495680_0096580
1684 Ga0495675_0000532
1685 Ga0495675_0155300
1686 Ga0495677_0075446
1687 Ga0495684_0003231
1688 Ga0495684_0020948
1689 Ga0495684_0025239
1690 Ga0495684_0025619
1691 Ga0495684_0083439
1692 Ga0495684_0089038
1693 Ga0495593_0016546
1694 Ga0495593_0064928
1695 Ga0495593_0154936
1696 Ga0495593_0235278
1697 Ga0495602_0003582
1698 Ga0495602_0005750
1699 Ga0495614_0081315
1700 Ga0496100_0009690
1701 Ga0496100_0070886
1702 Ga0496101_0002148
1703 Ga0496101_0016521
1704 Ga0496101_0474639
1705 Ga0496102_0038521
1706 Ga0496102_0228210
1707 Ga0496102_0567603
1708 Ga0496102_0909528
1709 Ga0496103_0030585
1710 Ga0496103_0106174
1711 Ga0496104_0000575
1712 Ga0496104_0095591
1713 Ga0496104_0297870
1714 Ga0496104_0375378
1715 Ga0496105_0012737
1716 Ga0496105_0048584
1717 Ga0496105_0116922
1718 Ga0496105_0408681
1719 Ga0496106_0015507
1720 Ga0496106_0025013
1721 Ga0496106_0238314
1722 Ga0496107_0004066
1723 Ga0496107_0274991
1724 Ga0496108_0017973
1725 Ga0496108_0040534
1726 Ga0496108_0054196
1727 Ga0496108_0427739
1728 Ga0496109_0004277
1729 Ga0496109_0026022
1730 Ga0496109_0043968
1731 Ga0496109_0064398
1732 Ga0496109_0178818
1733 Ga0496110_0039711
1734 Ga0496110_0042792
1735 Ga0496110_0082037
1736 Ga0496111_0067953
1737 Ga0496111_0076128
1738 Ga0496111_0137455
1739 Ga0496112_0022849
1740 Ga0496112_0027238
1741 Ga0496112_0076436
1742 Ga0496112_0373305
1743 Ga0496112_0555739
1744 Ga0496113_0024623
1745 Ga0496113_0035969
1746 Ga0496113_0108250
1747 Ga0496113_0216578
1748 Ga0496114_0005575
1749 Ga0496114_0016691
1750 Ga0496115_0027862
1751 Ga0496115_0031167
1752 Ga0496115_0069516
1753 Ga0496115_0127538
1754 Ga0496115_0156486
1755 Ga0496119_0000906
1756 Ga0496121_0245841
1757 Ga0496122_0016749
1758 Ga0496123_0001118
1759 Ga0501033_0003913
1760 Ga0501033_0091848
1761 Ga0501033_0239233
1762 Ga0501033_0429803
1763 Ga0501034_0000516
1764 Ga0501034_0037478
1765 Ga0501036_0392257
1766 Ga0501038_0063990
1767 Ga0501038_0066609
1768 Ga0501039_0006041
1769 Ga0501039_0054336
1770 Ga0501040_0014268
1771 Ga0501041_0006521
1772 Ga0501042_0048779
1773 Ga0501043_0048654
1774 Ga0501046_0063893
1775 Ga0501046_0098596
1776 Ga0501047_0004478
1777 Ga0501047_0044782
1778 Ga0501047_0078933
1779 Ga0501047_0463921
1780 Ga0501070_0018727
1781 Ga0501070_0037859
1782 Ga0501070_0260332
1783 Ga0501070_0690068
1784 Ga0501071_0038665
1785 Ga0501072_0139806
1786 Ga0501072_0227857
1787 Ga0501073_0009746
1788 Ga0501075_0006847
1789 Ga0501076_0002990
1790 Ga0501076_0043052
1791 Ga0501079_0000379
1792 Ga0501079_0125498
1793 Ga0501079_0243350
1794 Ga0501080_0012910
1795 Ga0501080_0032326
1796 Ga0501080_0308225
1797 Ga0501081_0000033
1798 Ga0501083_0091167
1799 Ga0501035_0004436
1800 Ga0501044_0005860
1801 Ga0501044_0094254
1802 Ga0501044_0132508
1803 Ga0501045_0036136
1804 nmdc:mga07m45_327029_c1
1805 nmdc:mga05p37_3041_c1
1806 nmdc:mga09592_324265_c1
1807 nmdc:mga09592_5026_c1
1808 nmdc:mga0qj67_1705_c1
1809 nmdc:mga0qj67_231261_c1
1810 nmdc:mga06r32_2163_c1
1811 nmdc:mga06r32_226428_c1
1812 nmdc:mga08y16_289_c1
1813 nmdc:mga08y16_31530_c1
1814 nmdc:mga0n895_112788_c1
1815 nmdc:mga0n895_140865_c1
1816 nmdc:mga0n895_361831_c1
1817 nmdc:mga0n895_392128_c1
1818 nmdc:mga0n895_4459_c1
1819 nmdc:mga0rr50_11469_c1
1820 nmdc:mga0rr50_141250_c1
1821 nmdc:mga0rr50_168968_c1
1822 nmdc:mga0rr50_308633_c1
1823 nmdc:mga0rr50_576477_c1
1824 nmdc:mga08x19_198328_c1
1825 nmdc:mga0a205_17258_c1
1826 nmdc:mga0a205_249588_c1
1827 nmdc:mga0a205_3619_c1
1828 nmdc:mga0a205_733_c2
1829 Ga0495601_0000418
1830 Ga0495601_0002208
1831 Ga0495601_0003992
1832 Ga0495601_0017457
1833 Ga0495601_0041803
1834 Ga0495612_0000666
1835 Ga0495612_0011282
1836 Ga0495612_0011744
1837 Ga0495612_0020362
1838 Ga0495595_0003514
1839 Ga0495595_0013087
1840 Ga0495595_0025852
1841 Ga0495595_0026794
1842 Ga0495595_0047076
1843 Ga0495619_0002359
1844 Ga0495619_0002566
1845 Ga0495619_0007346
1846 Ga0495619_0007524
1847 Ga0495619_0017182
1848 Ga0495619_0021147
1849 Ga0495619_0036672
1850 Ga0495619_0061266
1851 Ga0495619_0098848
1852 Ga0500643_002005
1853 Ga0500644_0013518
1854 Ga0500566_0105691
1855 Ga0500650_0097840
1856 Ga0500593_035093
1857 Ga0500594_0047025
1858 Ga0500595_000002
1859 Ga0500652_003429
1860 Ga0500652_154862
1861 Ga0500616_0000002
1862 Ga0500645_000086
1863 Ga0500645_004764
1864 Ga0501084_0074934
1865 Ga0501082_0003399
1866 Ga0501082_0203082
1867 Ga0501082_0306932
1868 Ga0501082_0439431
1869 Ga0466962_0080838
1870 Ga0530510_0167878

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

29

276

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g0w-assembly1.cif.gz_A crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution 0.8866 8 275
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.879 7 273
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.877 7 273
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8655 7 273
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8653 7 273
ID Description Score Start End Superfamily
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8783 8 275 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.837 6 268 3.20.20.150
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8308 7 269 3.20.20.150
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8254 8 275 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8219 8 279 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A5J5GCL0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.99 2 279 GO:0016853
AF-A0A7C3JPR9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9853 7 273 GO:0016853
AF-A0A5J5GCL0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.983 2 279 GO:0016853
AF-A0A537N724-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9792 3 241 GO:0016853
AF-A0A2E9I2B3-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9776 3 273

Map