F486177
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 412 | 1870 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0063357|Ga0501034_0063357_1268_2128 |
| Length | 286 |
| Sequence | MGAFPMTDRFGRLSLHMWTIDTTPLGTALDAARAAGYDAVELRRTDFKRLLDTGQSNAQILDLIRKSGIKVGILGVEYGWLFAKGDESKRLFGVLRESCQNAVALGCDMLMCAPGQISAPLSEAVENLKIGGDIVGEFPGLRLAIEFNSQHAVLNSVHALRDLLAGARRKNCGYLLDAYHLTRSGSPGRGFEDVPGEEIFVFQYSDVPPAPVETGVKRPTDRLPPGKGLVRWREMLGLLAEKGYTGYLSYEAPNPEQWARSPYDVAKEGVELTRKLLKEAVPSYAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 405 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0 |
| Rhizoplane | 5.88 |
| Rhizosphere | 91.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0063357 | 3300049571 | Bacteria | 3711 |
| 2 | ARSoilYngRDRAFT_c00118 | 3300000042 | Bacteria | 13503 |
| 3 | ARcpr5yngRDRAFT_c000035 | 3300000043 | Bacteria | 21396 |
| 4 | ARCol0yngRDRAFT_1000516 | 3300000652 | Bacteria | 4478 |
| 5 | JGI24752J21851_1007583 | 3300001976 | Bacteria | 1416 |
| 6 | JGI24746J21847_1011725 | 3300001977 | Bacteria | 1287 |
| 7 | JGI24747J21853_1002987 | 3300001978 | Bacteria | 1431 |
| 8 | JGI24739J22299_10000158 | 3300001989 | Bacteria | 22012 |
| 9 | JGI24737J22298_10001510 | 3300001990 | Bacteria | 8284 |
| 10 | JGI24737J22298_10001948 | 3300001990 | Bacteria | 7386 |
| 11 | JGI24750J21931_1000477 | 3300002070 | Bacteria | 6371 |
| 12 | JGI24745J21846_1000120 | 3300002073 | Bacteria | 6024 |
| 13 | JGI24738J21930_10001316 | 3300002075 | Bacteria | 6946 |
| 14 | JGI24749J21850_1000215 | 3300002076 | Bacteria | 9013 |
| 15 | JGI24749J21850_1004682 | 3300002076 | Bacteria | 1918 |
| 16 | JGI24744J21845_10012002 | 3300002077 | Bacteria | 1763 |
| 17 | JGI24035J26624_1000023 | 3300002126 | Bacteria | 11063 |
| 18 | JGI24034J26672_10000641 | 3300002239 | Plasmid | 4487 |
| 19 | JGI24742J22300_10002624 | 3300002244 | Plasmid | 2883 |
| 20 | Ga0065717_1000203 | 3300005276 | Bacteria | 2019 |
| 21 | Ga0065704_10090673 | 3300005289 | Bacteria | 2768 |
| 22 | Ga0065712_10018330 | 3300005290 | Bacteria | 1732 |
| 23 | Ga0065712_10093636 | 3300005290 | Unclassified | 2284 |
| 24 | Ga0065715_10001166 | 3300005293 | Bacteria | 15369 |
| 25 | Ga0065715_10021066 | 3300005293 | Bacteria | 1926 |
| 26 | Ga0065715_10099722 | 3300005293 | Plasmid | 3378 |
| 27 | Ga0070658_10006919 | 3300005327 | Bacteria | 9160 |
| 28 | Ga0070658_10028299 | 3300005327 | Bacteria | 4498 |
| 29 | Ga0070658_10055484 | 3300005327 | Bacteria | 3219 |
| 30 | Ga0070676_10015064 | 3300005328 | Bacteria | 4260 |
| 31 | Ga0070683_100012601 | 3300005329 | Bacteria | 7351 |
| 32 | Ga0070683_100051385 | 3300005329 | Plasmid | 3817 |
| 33 | Ga0070690_100000727 | 3300005330 | Bacteria | 16862 |
| 34 | Ga0070690_100023181 | 3300005330 | Plasmid | 3805 |
| 35 | Ga0070690_100038800 | 3300005330 | Bacteria | 3007 |
| 36 | Ga0070690_100291883 | 3300005330 | Unclassified | 1166 |
| 37 | Ga0070670_100040022 | 3300005331 | Plasmid | 4031 |
| 38 | Ga0070670_100046230 | 3300005331 | Plasmid | 3743 |
| 39 | Ga0070670_100566337 | 3300005331 | Unclassified | 1014 |
| 40 | Ga0070677_10002396 | 3300005333 | Bacteria | 5981 |
| 41 | Ga0068869_100002166 | 3300005334 | Bacteria | 11815 |
| 42 | Ga0068869_100312538 | 3300005334 | Unclassified | 1272 |
| 43 | Ga0070666_10022637 | 3300005335 | Plasmid | 4082 |
| 44 | Ga0070666_10025033 | 3300005335 | Plasmid | 3890 |
| 45 | Ga0070680_100006389 | 3300005336 | Bacteria | 8955 |
| 46 | Ga0070680_100018615 | 3300005336 | Bacteria | 5491 |
| 47 | Ga0070680_100057732 | 3300005336 | Plasmid | 3173 |
| 48 | Ga0070680_100073630 | 3300005336 | Bacteria | 2809 |
| 49 | Ga0070680_100189244 | 3300005336 | Bacteria | 1734 |
| 50 | Ga0070680_100289243 | 3300005336 | Unclassified | 1389 |
| 51 | Ga0070680_100448654 | 3300005336 | Unclassified | 1102 |
| 52 | Ga0070682_100002724 | 3300005337 | Bacteria | 9789 |
| 53 | Ga0070682_100038338 | 3300005337 | Unclassified | 2939 |
| 54 | Ga0070682_100130177 | 3300005337 | Bacteria | 1702 |
| 55 | Ga0068868_100002949 | 3300005338 | Bacteria | 11812 |
| 56 | Ga0068868_100021585 | 3300005338 | Plasmid | 4850 |
| 57 | Ga0070660_100000985 | 3300005339 | Bacteria | 19067 |
| 58 | Ga0070660_100026353 | 3300005339 | Bacteria | 4327 |
| 59 | Ga0070689_100000646 | 3300005340 | Bacteria | 21086 |
| 60 | Ga0070689_100002989 | 3300005340 | Bacteria | 11115 |
| 61 | Ga0070689_100014280 | 3300005340 | Bacteria | 5766 |
| 62 | Ga0070691_10000060 | 3300005341 | Bacteria | 30257 |
| 63 | Ga0070687_100000773 | 3300005343 | Bacteria | 10637 |
| 64 | Ga0070661_100015592 | 3300005344 | Bacteria | 5363 |
| 65 | Ga0070661_100206021 | 3300005344 | Bacteria | 1504 |
| 66 | Ga0070692_10000273 | 3300005345 | Bacteria | 14477 |
| 67 | Ga0070668_100007804 | 3300005347 | Bacteria | 7946 |
| 68 | Ga0070669_100019129 | 3300005353 | Bacteria | 4895 |
| 69 | Ga0070675_100003854 | 3300005354 | Bacteria | 11384 |
| 70 | Ga0070675_100036283 | 3300005354 | Plasmid | 4011 |
| 71 | Ga0070671_100000349 | 3300005355 | Bacteria | 31741 |
| 72 | Ga0070671_100032167 | 3300005355 | Bacteria | 4338 |
| 73 | Ga0070671_100111836 | 3300005355 | Bacteria | 2294 |
| 74 | Ga0070674_100000152 | 3300005356 | Bacteria | 32268 |
| 75 | Ga0070674_100026791 | 3300005356 | Bacteria | 3770 |
| 76 | Ga0070674_100031793 | 3300005356 | Plasmid | 3500 |
| 77 | Ga0070673_100007455 | 3300005364 | Bacteria | 7216 |
| 78 | Ga0070688_100002079 | 3300005365 | Bacteria | 10108 |
| 79 | Ga0070688_100002194 | 3300005365 | Bacteria | 9852 |
| 80 | Ga0070688_100091062 | 3300005365 | Bacteria | 1992 |
| 81 | Ga0070659_100000621 | 3300005366 | Bacteria | 25919 |
| 82 | Ga0070659_100037533 | 3300005366 | Bacteria | 3777 |
| 83 | Ga0070667_100000810 | 3300005367 | Bacteria | 29225 |
| 84 | Ga0070703_10002626 | 3300005406 | Bacteria | 5171 |
| 85 | Ga0070709_10024168 | 3300005434 | Bacteria | 3574 |
| 86 | Ga0070714_100027007 | 3300005435 | Bacteria | 4750 |
| 87 | Ga0070714_100049823 | 3300005435 | Bacteria | 3565 |
| 88 | Ga0070714_100068290 | 3300005435 | Bacteria | 3066 |
| 89 | Ga0070714_100102916 | 3300005435 | Plasmid | 2519 |
| 90 | Ga0070714_100617703 | 3300005435 | Bacteria | 1042 |
| 91 | Ga0070713_100015547 | 3300005436 | Bacteria | 5697 |
| 92 | Ga0070713_100045893 | 3300005436 | Plasmid | 3583 |
| 93 | Ga0070713_100081039 | 3300005436 | Bacteria | 2769 |
| 94 | Ga0070713_100084255 | 3300005436 | Bacteria | 2720 |
| 95 | Ga0070710_10029249 | 3300005437 | Bacteria | 2954 |
| 96 | Ga0070701_10000042 | 3300005438 | Bacteria | 32304 |
| 97 | Ga0070701_10008593 | 3300005438 | Plasmid | 4427 |
| 98 | Ga0070711_100008373 | 3300005439 | Bacteria | 6335 |
| 99 | Ga0070711_100132629 | 3300005439 | Unclassified | 1857 |
| 100 | Ga0070705_100005564 | 3300005440 | Bacteria | 6146 |
| 101 | Ga0070705_100096394 | 3300005440 | Unclassified | 1857 |
| 102 | Ga0070705_100147919 | 3300005440 | Bacteria | 1555 |
| 103 | Ga0070700_100000329 | 3300005441 | Bacteria | 24667 |
| 104 | Ga0070700_100023379 | 3300005441 | Plasmid | 3613 |
| 105 | Ga0070694_100002007 | 3300005444 | Bacteria | 12098 |
| 106 | Ga0070694_100002748 | 3300005444 | Bacteria | 10437 |
| 107 | Ga0070708_100045860 | 3300005445 | Plasmid | 3854 |
| 108 | Ga0070663_100037014 | 3300005455 | Plasmid | 3394 |
| 109 | Ga0070663_100090670 | 3300005455 | Unclassified | 2264 |
| 110 | Ga0070678_100013734 | 3300005456 | Bacteria | 5089 |
| 111 | Ga0070678_100062841 | 3300005456 | Plasmid | 2744 |
| 112 | Ga0070662_100064811 | 3300005457 | Plasmid | 2676 |
| 113 | Ga0070662_100182156 | 3300005457 | Unclassified | 1656 |
| 114 | Ga0070662_100333215 | 3300005457 | Unclassified | 1240 |
| 115 | Ga0070662_100548462 | 3300005457 | Unclassified | 968 |
| 116 | Ga0070681_10004332 | 3300005458 | Bacteria | 13487 |
| 117 | Ga0070681_10005076 | 3300005458 | Bacteria | 12700 |
| 118 | Ga0070681_10016427 | 3300005458 | Bacteria | 7390 |
| 119 | Ga0070681_10148826 | 3300005458 | Unclassified | 2269 |
| 120 | Ga0068867_100007473 | 3300005459 | Bacteria | 7727 |
| 121 | Ga0068867_100119720 | 3300005459 | Unclassified | 2033 |
| 122 | Ga0070685_10006180 | 3300005466 | Bacteria | 6097 |
| 123 | Ga0070685_10007245 | 3300005466 | Bacteria | 5670 |
| 124 | Ga0070685_10129989 | 3300005466 | Bacteria | 1573 |
| 125 | Ga0070706_100157073 | 3300005467 | Bacteria | 2123 |
| 126 | Ga0070699_100270906 | 3300005518 | Bacteria | 1520 |
| 127 | Ga0070679_100002742 | 3300005530 | Bacteria | 16042 |
| 128 | Ga0070679_100157221 | 3300005530 | Unclassified | 2248 |
| 129 | Ga0070679_100206314 | 3300005530 | Bacteria | 1930 |
| 130 | Ga0070679_100222698 | 3300005530 | Bacteria | 1847 |
| 131 | Ga0070679_100236175 | 3300005530 | Bacteria | 1787 |
| 132 | Ga0070684_100000464 | 3300005535 | Bacteria | 27749 |
| 133 | Ga0070684_100376832 | 3300005535 | Bacteria | 1307 |
| 134 | Ga0070697_100013327 | 3300005536 | Bacteria | 6448 |
| 135 | Ga0068853_100001029 | 3300005539 | Bacteria | 19655 |
| 136 | Ga0070672_100020218 | 3300005543 | Bacteria | 4851 |
| 137 | Ga0070672_100078130 | 3300005543 | Bacteria | 2648 |
| 138 | Ga0070686_100001527 | 3300005544 | Bacteria | 13007 |
| 139 | Ga0070695_100010249 | 3300005545 | Bacteria | 5593 |
| 140 | Ga0070695_100047425 | 3300005545 | Plasmid | 2744 |
| 141 | Ga0070695_100097437 | 3300005545 | Bacteria | 1975 |
| 142 | Ga0070696_100015481 | 3300005546 | Bacteria | 5123 |
| 143 | Ga0070696_100098522 | 3300005546 | Unclassified | 2091 |
| 144 | Ga0070693_100000266 | 3300005547 | Bacteria | 24669 |
| 145 | Ga0070693_100036753 | 3300005547 | Bacteria | 2725 |
| 146 | Ga0070693_100060687 | 3300005547 | Unclassified | 2196 |
| 147 | Ga0070665_100108939 | 3300005548 | Plasmid | 2772 |
| 148 | Ga0070665_100168547 | 3300005548 | Bacteria | 2191 |
| 149 | Ga0070704_100010668 | 3300005549 | Bacteria | 5596 |
| 150 | Ga0070704_100104573 | 3300005549 | Bacteria | 2141 |
| 151 | Ga0068855_100041697 | 3300005563 | Bacteria | 5439 |
| 152 | Ga0068855_100061239 | 3300005563 | Bacteria | 4398 |
| 153 | Ga0070664_100015424 | 3300005564 | Bacteria | 6249 |
| 154 | Ga0070664_100023574 | 3300005564 | Bacteria | 5084 |
| 155 | Ga0068857_100000888 | 3300005577 | Bacteria | 22595 |
| 156 | Ga0068857_100239796 | 3300005577 | Bacteria | 1660 |
| 157 | Ga0068857_100691623 | 3300005577 | Unclassified | 968 |
| 158 | Ga0068854_100005378 | 3300005578 | Bacteria | 8082 |
| 159 | Ga0068856_100003260 | 3300005614 | Bacteria | 16512 |
| 160 | Ga0068856_100126633 | 3300005614 | Bacteria | 2557 |
| 161 | Ga0068856_100160523 | 3300005614 | Bacteria | 2258 |
| 162 | Ga0068856_100494033 | 3300005614 | Unclassified | 1244 |
| 163 | Ga0070702_100053415 | 3300005615 | Unclassified | 2321 |
| 164 | Ga0068852_100000579 | 3300005616 | Bacteria | 24117 |
| 165 | Ga0068852_100580680 | 3300005616 | Bacteria | 1124 |
| 166 | Ga0068859_100003690 | 3300005617 | Bacteria | 15603 |
| 167 | Ga0068859_100146749 | 3300005617 | Bacteria | 2434 |
| 168 | Ga0068859_100231653 | 3300005617 | Bacteria | 1935 |
| 169 | Ga0068859_100233619 | 3300005617 | Bacteria | 1927 |
| 170 | Ga0068864_100001260 | 3300005618 | Bacteria | 21062 |
| 171 | Ga0068864_100106019 | 3300005618 | Bacteria | 2498 |
| 172 | Ga0068864_100236411 | 3300005618 | Bacteria | 1691 |
| 173 | Ga0068864_100710527 | 3300005618 | Bacteria | 982 |
| 174 | Ga0068866_10001077 | 3300005718 | Bacteria | 12040 |
| 175 | Ga0068866_10018692 | 3300005718 | Unclassified | 3140 |
| 176 | Ga0068861_100001782 | 3300005719 | Bacteria | 13850 |
| 177 | Ga0068861_100351967 | 3300005719 | Unclassified | 1292 |
| 178 | Ga0068851_10046717 | 3300005834 | Bacteria | 2191 |
| 179 | Ga0068870_10000108 | 3300005840 | Bacteria | 28313 |
| 180 | Ga0068863_100001201 | 3300005841 | Bacteria | 25868 |
| 181 | Ga0068863_100324236 | 3300005841 | Unclassified | 1496 |
| 182 | Ga0068858_100000419 | 3300005842 | Bacteria | 44155 |
| 183 | Ga0068858_100054459 | 3300005842 | Plasmid | 3699 |
| 184 | Ga0068858_100181366 | 3300005842 | Unclassified | 1988 |
| 185 | Ga0068860_100001359 | 3300005843 | Bacteria | 26585 |
| 186 | Ga0068860_100475076 | 3300005843 | Unclassified | 1245 |
| 187 | Ga0068860_100875780 | 3300005843 | Bacteria | 913 |
| 188 | Ga0068860_100896963 | 3300005843 | Unclassified | 902 |
| 189 | Ga0068862_100005815 | 3300005844 | Bacteria | 10279 |
| 190 | Ga0068862_100056562 | 3300005844 | Plasmid | 3361 |
| 191 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 192 | Ga0081455_10004982 | 3300005937 | Bacteria | 14691 |
| 193 | Ga0081455_10117653 | 3300005937 | Bacteria | 2100 |
| 194 | Ga0070717_10021459 | 3300006028 | Bacteria | 5089 |
| 195 | Ga0070717_10527144 | 3300006028 | Unclassified | 1069 |
| 196 | Ga0075432_10021698 | 3300006058 | Bacteria | 2195 |
| 197 | Ga0070715_10020498 | 3300006163 | Unclassified | 2551 |
| 198 | Ga0070716_100001823 | 3300006173 | Bacteria | 9652 |
| 199 | Ga0070716_100016982 | 3300006173 | Unclassified | 3766 |
| 200 | Ga0070712_100014499 | 3300006175 | Bacteria | 5058 |
| 201 | Ga0070712_100032441 | 3300006175 | Unclassified | 3527 |
| 202 | Ga0070712_100050661 | 3300006175 | Bacteria | 2890 |
| 203 | Ga0070712_100051125 | 3300006175 | Plasmid | 2878 |
| 204 | Ga0070712_100499292 | 3300006175 | Bacteria | 1020 |
| 205 | Ga0075367_10009088 | 3300006178 | Bacteria | 5176 |
| 206 | Ga0075427_10001549 | 3300006194 | Bacteria | 2969 |
| 207 | Ga0097621_100021768 | 3300006237 | Bacteria | 4967 |
| 208 | Ga0097621_100031346 | 3300006237 | Bacteria | 4218 |
| 209 | Ga0097621_100073441 | 3300006237 | Unclassified | 2831 |
| 210 | Ga0075370_10131248 | 3300006353 | Unclassified | 1462 |
| 211 | Ga0075370_10252665 | 3300006353 | Unclassified | 1045 |
| 212 | Ga0068871_100000417 | 3300006358 | Bacteria | 29416 |
| 213 | Ga0068871_100011895 | 3300006358 | Bacteria | 6403 |
| 214 | Ga0068871_100357746 | 3300006358 | Unclassified | 1292 |
| 215 | Ga0075428_100010422 | 3300006844 | Bacteria | 10321 |
| 216 | Ga0075430_100001576 | 3300006846 | Bacteria | 18645 |
| 217 | Ga0075430_100095225 | 3300006846 | Bacteria | 2489 |
| 218 | Ga0075431_100002654 | 3300006847 | Bacteria | 17313 |
| 219 | Ga0075433_10011770 | 3300006852 | Bacteria | 7046 |
| 220 | Ga0075433_10017308 | 3300006852 | Bacteria | 5967 |
| 221 | Ga0075433_10047158 | 3300006852 | Bacteria | 3748 |
| 222 | Ga0075433_10221434 | 3300006852 | Unclassified | 1681 |
| 223 | Ga0075434_100001354 | 3300006871 | Bacteria | 20567 |
| 224 | Ga0075434_100002767 | 3300006871 | Bacteria | 15520 |
| 225 | Ga0075434_100011160 | 3300006871 | Bacteria | 8453 |
| 226 | Ga0075434_100188185 | 3300006871 | Bacteria | 2084 |
| 227 | Ga0075429_100001895 | 3300006880 | Bacteria | 17336 |
| 228 | Ga0075429_100309124 | 3300006880 | Bacteria | 1384 |
| 229 | Ga0068865_100000450 | 3300006881 | Bacteria | 22865 |
| 230 | Ga0068865_100149202 | 3300006881 | Bacteria | 1772 |
| 231 | Ga0097620_100003690 | 3300006931 | Bacteria | 15603 |
| 232 | Ga0097620_100146739 | 3300006931 | Bacteria | 2434 |
| 233 | Ga0097620_100231649 | 3300006931 | Bacteria | 1935 |
| 234 | Ga0097620_100233630 | 3300006931 | Bacteria | 1927 |
| 235 | Ga0075435_100003745 | 3300007076 | Bacteria | 10359 |
| 236 | Ga0075435_100014388 | 3300007076 | Bacteria | 5912 |
| 237 | Ga0075435_100154700 | 3300007076 | Bacteria | 1929 |
| 238 | Ga0075435_100228984 | 3300007076 | Bacteria | 1579 |
| 239 | Ga0075435_100346988 | 3300007076 | Unclassified | 1272 |
| 240 | Ga0105240_10059540 | 3300009093 | Bacteria | 4765 |
| 241 | Ga0105240_10177548 | 3300009093 | Plasmid | 2517 |
| 242 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 243 | Ga0111539_10013383 | 3300009094 | Bacteria | 10255 |
| 244 | Ga0111539_10027016 | 3300009094 | Bacteria | 7010 |
| 245 | Ga0111539_10655615 | 3300009094 | Bacteria | 1222 |
| 246 | Ga0111539_11067943 | 3300009094 | Bacteria | 938 |
| 247 | Ga0105245_10026898 | 3300009098 | Bacteria | 5065 |
| 248 | Ga0105245_10458835 | 3300009098 | Unclassified | 1284 |
| 249 | Ga0105247_10013936 | 3300009101 | Plasmid | 4821 |
| 250 | Ga0105247_10182088 | 3300009101 | Unclassified | 1403 |
| 251 | Ga0105247_10212672 | 3300009101 | Bacteria | 1305 |
| 252 | Ga0105247_10234103 | 3300009101 | Bacteria | 1248 |
| 253 | Ga0114129_10013413 | 3300009147 | Bacteria | 11678 |
| 254 | Ga0114129_10020551 | 3300009147 | Bacteria | 9391 |
| 255 | Ga0105243_10002051 | 3300009148 | Bacteria | 17085 |
| 256 | Ga0105243_10044187 | 3300009148 | Unclassified | 3494 |
| 257 | Ga0105243_10702399 | 3300009148 | Bacteria | 986 |
| 258 | Ga0105241_10001526 | 3300009174 | Bacteria | 17741 |
| 259 | Ga0105241_10132786 | 3300009174 | Bacteria | 2018 |
| 260 | Ga0105241_10383803 | 3300009174 | Bacteria | 1228 |
| 261 | Ga0105242_10000399 | 3300009176 | Bacteria | 34466 |
| 262 | Ga0105242_10066427 | 3300009176 | Plasmid | 2978 |
| 263 | Ga0105242_10285747 | 3300009176 | Unclassified | 1500 |
| 264 | Ga0105248_10004145 | 3300009177 | Bacteria | 16029 |
| 265 | Ga0105248_10068292 | 3300009177 | Unclassified | 3991 |
| 266 | Ga0105248_10085160 | 3300009177 | Bacteria | 3557 |
| 267 | Ga0105237_10006666 | 3300009545 | Bacteria | 12762 |
| 268 | Ga0105237_10038653 | 3300009545 | Bacteria | 4818 |
| 269 | Ga0105237_10040533 | 3300009545 | Bacteria | 4696 |
| 270 | Ga0105237_10458258 | 3300009545 | Bacteria | 1281 |
| 271 | Ga0105238_10111550 | 3300009551 | Plasmid | 2715 |
| 272 | Ga0105238_10432216 | 3300009551 | Unclassified | 1312 |
| 273 | Ga0105249_10002756 | 3300009553 | Bacteria | 15191 |
| 274 | Ga0105249_10013099 | 3300009553 | Bacteria | 7319 |
| 275 | Ga0105249_10831782 | 3300009553 | Unclassified | 988 |
| 276 | Ga0105239_10043528 | 3300010375 | Plasmid | 4922 |
| 277 | Ga0105239_10105506 | 3300010375 | Bacteria | 3121 |
| 278 | Ga0105239_10478136 | 3300010375 | Unclassified | 1415 |
| 279 | Ga0105239_10493535 | 3300010375 | Unclassified | 1392 |
| 280 | Ga0105246_10000033 | 3300011119 | Bacteria | 50575 |
| 281 | Ga0105246_10203566 | 3300011119 | Unclassified | 1540 |
| 282 | Ga0105246_10254007 | 3300011119 | Bacteria | 1397 |
| 283 | Ga0157373_10006645 | 3300013100 | Bacteria | 8615 |
| 284 | Ga0157371_10015424 | 3300013102 | Bacteria | 5731 |
| 285 | Ga0157371_10052511 | 3300013102 | Bacteria | 2895 |
| 286 | Ga0157370_10114232 | 3300013104 | Bacteria | 2523 |
| 287 | Ga0157370_10144803 | 3300013104 | Unclassified | 2213 |
| 288 | Ga0157369_10494186 | 3300013105 | Unclassified | 1266 |
| 289 | Ga0157374_10002423 | 3300013296 | Bacteria | 15718 |
| 290 | Ga0157374_10201748 | 3300013296 | Bacteria | 1948 |
| 291 | Ga0157374_10209982 | 3300013296 | Bacteria | 1909 |
| 292 | Ga0157374_10228712 | 3300013296 | Bacteria | 1827 |
| 293 | Ga0157378_10011328 | 3300013297 | Bacteria | 7804 |
| 294 | Ga0163162_10175648 | 3300013306 | Unclassified | 2267 |
| 295 | Ga0163162_10429942 | 3300013306 | Bacteria | 1452 |
| 296 | Ga0157372_10001162 | 3300013307 | Bacteria | 28497 |
| 297 | Ga0157372_10531519 | 3300013307 | Bacteria | 1371 |
| 298 | Ga0157372_10783681 | 3300013307 | Unclassified | 1108 |
| 299 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 300 | Ga0157375_10022011 | 3300013308 | Bacteria | 5861 |
| 301 | Ga0157375_10193278 | 3300013308 | Bacteria | 2190 |
| 302 | Ga0163163_10000745 | 3300014325 | Bacteria | 27709 |
| 303 | Ga0163163_10173646 | 3300014325 | Unclassified | 2201 |
| 304 | Ga0163163_10591800 | 3300014325 | Bacteria | 1172 |
| 305 | Ga0157380_10000140 | 3300014326 | Bacteria | 40628 |
| 306 | Ga0157380_10294780 | 3300014326 | Bacteria | 1491 |
| 307 | Ga0157377_10000117 | 3300014745 | Bacteria | 53219 |
| 308 | Ga0157377_10120726 | 3300014745 | Unclassified | 1588 |
| 309 | Ga0157379_10000785 | 3300014968 | Bacteria | 25777 |
| 310 | Ga0157379_10020035 | 3300014968 | Bacteria | 5912 |
| 311 | Ga0157379_10055182 | 3300014968 | Unclassified | 3550 |
| 312 | Ga0157379_10507186 | 3300014968 | Unclassified | 1119 |
| 313 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 314 | Ga0206354_10939082 | 3300020081 | Unclassified | 1036 |
| 315 | Ga0213876_10037930 | 3300021384 | Bacteria | 2542 |
| 316 | Ga0207666_1000017 | 3300025271 | Bacteria | 40049 |
| 317 | Ga0207666_1000448 | 3300025271 | Bacteria | 5327 |
| 318 | Ga0207673_1000258 | 3300025290 | Bacteria | 5406 |
| 319 | Ga0207697_10000009 | 3300025315 | Bacteria | 67526 |
| 320 | Ga0207697_10001569 | 3300025315 | Bacteria | 12343 |
| 321 | Ga0207682_10000301 | 3300025893 | Bacteria | 22279 |
| 322 | Ga0207692_10005897 | 3300025898 | Bacteria | 4940 |
| 323 | Ga0207642_10001973 | 3300025899 | Bacteria | 6336 |
| 324 | Ga0207710_10004684 | 3300025900 | Bacteria | 5936 |
| 325 | Ga0207710_10094733 | 3300025900 | Bacteria | 1402 |
| 326 | Ga0207688_10000012 | 3300025901 | Bacteria | 60353 |
| 327 | Ga0207688_10287309 | 3300025901 | Bacteria | 1003 |
| 328 | Ga0207647_10005111 | 3300025904 | Bacteria | 9660 |
| 329 | Ga0207647_10017208 | 3300025904 | Plasmid | 4919 |
| 330 | Ga0207685_10005072 | 3300025905 | Plasmid | 3431 |
| 331 | Ga0207699_10001620 | 3300025906 | Bacteria | 10680 |
| 332 | Ga0207699_10002309 | 3300025906 | Bacteria | 9013 |
| 333 | Ga0207645_10000124 | 3300025907 | Bacteria | 58746 |
| 334 | Ga0207645_10008610 | 3300025907 | Bacteria | 7104 |
| 335 | Ga0207643_10000046 | 3300025908 | Bacteria | 80736 |
| 336 | Ga0207705_10008788 | 3300025909 | Bacteria | 7363 |
| 337 | Ga0207705_10027090 | 3300025909 | Bacteria | 4085 |
| 338 | Ga0207705_10209221 | 3300025909 | Bacteria | 1479 |
| 339 | Ga0207654_10003867 | 3300025911 | Bacteria | 7546 |
| 340 | Ga0207654_10051066 | 3300025911 | Bacteria | 2378 |
| 341 | Ga0207707_10021900 | 3300025912 | Bacteria | 5586 |
| 342 | Ga0207707_10052526 | 3300025912 | Bacteria | 3548 |
| 343 | Ga0207707_10065374 | 3300025912 | Bacteria | 3168 |
| 344 | Ga0207707_10140111 | 3300025912 | Bacteria | 2115 |
| 345 | Ga0207707_10414139 | 3300025912 | Bacteria | 1156 |
| 346 | Ga0207707_10530181 | 3300025912 | Unclassified | 1002 |
| 347 | Ga0207671_10253315 | 3300025914 | Bacteria | 1384 |
| 348 | Ga0207693_10005252 | 3300025915 | Bacteria | 10836 |
| 349 | Ga0207693_10158542 | 3300025915 | Unclassified | 1780 |
| 350 | Ga0207693_10185006 | 3300025915 | Bacteria | 1640 |
| 351 | Ga0207663_10012608 | 3300025916 | Bacteria | 4577 |
| 352 | Ga0207663_10066915 | 3300025916 | Bacteria | 2302 |
| 353 | Ga0207663_10186245 | 3300025916 | Bacteria | 1486 |
| 354 | Ga0207660_10001510 | 3300025917 | Bacteria | 15663 |
| 355 | Ga0207660_10020034 | 3300025917 | Bacteria | 4482 |
| 356 | Ga0207660_10139087 | 3300025917 | Bacteria | 1855 |
| 357 | Ga0207660_10264613 | 3300025917 | Bacteria | 1361 |
| 358 | Ga0207662_10000222 | 3300025918 | Bacteria | 26332 |
| 359 | Ga0207657_10000162 | 3300025919 | Bacteria | 68121 |
| 360 | Ga0207657_10008982 | 3300025919 | Bacteria | 10097 |
| 361 | Ga0207657_10031279 | 3300025919 | Bacteria | 4824 |
| 362 | Ga0207649_10000798 | 3300025920 | Bacteria | 20284 |
| 363 | Ga0207649_10050147 | 3300025920 | Bacteria | 2581 |
| 364 | Ga0207649_10074301 | 3300025920 | Unclassified | 2181 |
| 365 | Ga0207652_10066691 | 3300025921 | Bacteria | 3120 |
| 366 | Ga0207652_10126524 | 3300025921 | Unclassified | 2277 |
| 367 | Ga0207652_10150391 | 3300025921 | Bacteria | 2084 |
| 368 | Ga0207652_10157030 | 3300025921 | Bacteria | 2038 |
| 369 | Ga0207652_10272769 | 3300025921 | Unclassified | 1526 |
| 370 | Ga0207652_10343981 | 3300025921 | Bacteria | 1346 |
| 371 | Ga0207646_10153575 | 3300025922 | Unclassified | 2076 |
| 372 | Ga0207681_10003611 | 3300025923 | Bacteria | 9628 |
| 373 | Ga0207694_10090129 | 3300025924 | Unclassified | 2419 |
| 374 | Ga0207694_10326208 | 3300025924 | Unclassified | 1268 |
| 375 | Ga0207650_10031847 | 3300025925 | Plasmid | 3811 |
| 376 | Ga0207650_10059776 | 3300025925 | Unclassified | 2842 |
| 377 | Ga0207650_10230395 | 3300025925 | Bacteria | 1494 |
| 378 | Ga0207659_10016376 | 3300025926 | Bacteria | 4823 |
| 379 | Ga0207687_10011784 | 3300025927 | Bacteria | 5721 |
| 380 | Ga0207687_10236956 | 3300025927 | Unclassified | 1444 |
| 381 | Ga0207700_10000290 | 3300025928 | Bacteria | 29736 |
| 382 | Ga0207700_10022250 | 3300025928 | Bacteria | 4346 |
| 383 | Ga0207664_10026121 | 3300025929 | Unclassified | 4409 |
| 384 | Ga0207664_10097295 | 3300025929 | Unclassified | 2424 |
| 385 | Ga0207664_10162640 | 3300025929 | Unclassified | 1905 |
| 386 | Ga0207644_10018037 | 3300025931 | Bacteria | 4771 |
| 387 | Ga0207644_10124978 | 3300025931 | Unclassified | 1962 |
| 388 | Ga0207706_10000368 | 3300025933 | Bacteria | 48834 |
| 389 | Ga0207706_10007484 | 3300025933 | Bacteria | 10098 |
| 390 | Ga0207706_10058572 | 3300025933 | Plasmid | 3393 |
| 391 | Ga0207686_10010832 | 3300025934 | Bacteria | 4971 |
| 392 | Ga0207686_10034817 | 3300025934 | Plasmid | 3017 |
| 393 | Ga0207709_10000256 | 3300025935 | Bacteria | 63853 |
| 394 | Ga0207709_10147387 | 3300025935 | Unclassified | 1626 |
| 395 | Ga0207670_10450041 | 3300025936 | Bacteria | 1038 |
| 396 | Ga0207669_10001765 | 3300025937 | Bacteria | 9180 |
| 397 | Ga0207669_10315477 | 3300025937 | Bacteria | 1194 |
| 398 | Ga0207669_10585300 | 3300025937 | Unclassified | 905 |
| 399 | Ga0207704_10002423 | 3300025938 | Bacteria | 8389 |
| 400 | Ga0207665_10024323 | 3300025939 | Plasmid | 3993 |
| 401 | Ga0207691_10000303 | 3300025940 | Bacteria | 48873 |
| 402 | Ga0207711_10048233 | 3300025941 | Bacteria | 3644 |
| 403 | Ga0207689_10000109 | 3300025942 | Bacteria | 67941 |
| 404 | Ga0207661_10010457 | 3300025944 | Bacteria | 6680 |
| 405 | Ga0207661_10106083 | 3300025944 | Unclassified | 2368 |
| 406 | Ga0207661_10528559 | 3300025944 | Bacteria | 1079 |
| 407 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 408 | Ga0207679_10068452 | 3300025945 | Bacteria | 2667 |
| 409 | Ga0207667_10002481 | 3300025949 | Bacteria | 22990 |
| 410 | Ga0207667_10015271 | 3300025949 | Bacteria | 8732 |
| 411 | Ga0207667_10078969 | 3300025949 | Unclassified | 3410 |
| 412 | Ga0207651_10404483 | 3300025960 | Bacteria | 1162 |
| 413 | Ga0207712_10001848 | 3300025961 | Bacteria | 13972 |
| 414 | Ga0207712_10307709 | 3300025961 | Unclassified | 1303 |
| 415 | Ga0207668_10001339 | 3300025972 | Bacteria | 14601 |
| 416 | Ga0207640_10001185 | 3300025981 | Bacteria | 14246 |
| 417 | Ga0207658_10016049 | 3300025986 | Bacteria | 5144 |
| 418 | Ga0207658_10056945 | 3300025986 | Unclassified | 2903 |
| 419 | Ga0207658_10102245 | 3300025986 | Unclassified | 2247 |
| 420 | Ga0207677_10335012 | 3300026023 | Unclassified | 1262 |
| 421 | Ga0207703_10008545 | 3300026035 | Bacteria | 8088 |
| 422 | Ga0207639_10050194 | 3300026041 | Plasmid | 3167 |
| 423 | Ga0207678_10000158 | 3300026067 | Bacteria | 56255 |
| 424 | Ga0207678_10030340 | 3300026067 | Bacteria | 4720 |
| 425 | Ga0207678_10073370 | 3300026067 | Plasmid | 2933 |
| 426 | Ga0207678_10141821 | 3300026067 | Unclassified | 2051 |
| 427 | Ga0207708_10000098 | 3300026075 | Bacteria | 67005 |
| 428 | Ga0207708_10005985 | 3300026075 | Bacteria | 9009 |
| 429 | Ga0207708_10122629 | 3300026075 | Unclassified | 2026 |
| 430 | Ga0207702_10043424 | 3300026078 | Bacteria | 3774 |
| 431 | Ga0207702_10319440 | 3300026078 | Bacteria | 1478 |
| 432 | Ga0207702_10375330 | 3300026078 | Unclassified | 1366 |
| 433 | Ga0207702_10739746 | 3300026078 | Bacteria | 970 |
| 434 | Ga0207641_10025880 | 3300026088 | Bacteria | 4839 |
| 435 | Ga0207641_10656842 | 3300026088 | Unclassified | 1030 |
| 436 | Ga0207648_10000696 | 3300026089 | Bacteria | 37592 |
| 437 | Ga0207648_10211259 | 3300026089 | Unclassified | 1723 |
| 438 | Ga0207676_10005342 | 3300026095 | Bacteria | 9098 |
| 439 | Ga0207676_10105319 | 3300026095 | Bacteria | 2348 |
| 440 | Ga0207676_10269041 | 3300026095 | Bacteria | 1542 |
| 441 | Ga0207674_10000420 | 3300026116 | Bacteria | 55287 |
| 442 | Ga0207675_100001146 | 3300026118 | Bacteria | 26264 |
| 443 | Ga0207675_100184391 | 3300026118 | Unclassified | 2000 |
| 444 | Ga0207675_100383127 | 3300026118 | Unclassified | 1383 |
| 445 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 446 | Ga0207683_10001766 | 3300026121 | Bacteria | 19131 |
| 447 | Ga0207683_10016095 | 3300026121 | Bacteria | 6365 |
| 448 | Ga0207698_10015254 | 3300026142 | Bacteria | 5143 |
| 449 | Ga0207698_10021138 | 3300026142 | Bacteria | 4495 |
| 450 | Ga0209973_1013981 | 3300027252 | Unclassified | 996 |
| 451 | Ga0209984_1007530 | 3300027424 | Bacteria | 1353 |
| 452 | Ga0209970_1017406 | 3300027614 | Unclassified | 1203 |
| 453 | Ga0210002_1002603 | 3300027617 | Plasmid | 2610 |
| 454 | Ga0209971_1011172 | 3300027682 | Bacteria | 2126 |
| 455 | Ga0209971_1014527 | 3300027682 | Archaea | 1867 |
| 456 | Ga0209998_10003042 | 3300027717 | Plasmid | 3726 |
| 457 | Ga0209998_10009889 | 3300027717 | Unclassified | 1977 |
| 458 | Ga0209974_10000117 | 3300027876 | Bacteria | 23200 |
| 459 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 460 | Ga0207428_10001707 | 3300027907 | Bacteria | 22539 |
| 461 | Ga0207428_10007251 | 3300027907 | Bacteria | 10137 |
| 462 | Ga0268266_10009789 | 3300028379 | Bacteria | 8432 |
| 463 | Ga0268265_10005880 | 3300028380 | Bacteria | 8360 |
| 464 | Ga0268265_10054430 | 3300028380 | Plasmid | 3036 |
| 465 | Ga0268264_10076905 | 3300028381 | Bacteria | 2841 |
| 466 | Ga0268264_10108780 | 3300028381 | Unclassified | 2424 |
| 467 | Ga0268264_10157143 | 3300028381 | Unclassified | 2044 |
| 468 | Ga0265337_1005419 | 3300028556 | Bacteria | 5064 |
| 469 | Ga0265318_10072287 | 3300028577 | Bacteria | 1278 |
| 470 | Ga0265338_10009970 | 3300028800 | Bacteria | 11231 |
| 471 | Ga0265338_10205712 | 3300028800 | Unclassified | 1481 |
| 472 | Ga0265338_10261562 | 3300028800 | Bacteria | 1272 |
| 473 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 474 | Ga0265325_10000568 | 3300031241 | Bacteria | 26844 |
| 475 | Ga0265325_10001242 | 3300031241 | Bacteria | 18188 |
| 476 | Ga0265325_10007949 | 3300031241 | Bacteria | 6301 |
| 477 | Ga0265325_10090448 | 3300031241 | Unclassified | 1510 |
| 478 | Ga0265325_10118878 | 3300031241 | Bacteria | 1276 |
| 479 | Ga0265329_10051651 | 3300031242 | Bacteria | 1309 |
| 480 | Ga0265340_10011649 | 3300031247 | Bacteria | 4667 |
| 481 | Ga0265340_10058550 | 3300031247 | Bacteria | 1850 |
| 482 | Ga0265340_10068395 | 3300031247 | Bacteria | 1687 |
| 483 | Ga0265339_10000060 | 3300031249 | Bacteria | 97276 |
| 484 | Ga0265339_10004978 | 3300031249 | Bacteria | 8945 |
| 485 | Ga0265339_10061175 | 3300031249 | Bacteria | 2027 |
| 486 | Ga0265339_10108445 | 3300031249 | Bacteria | 1439 |
| 487 | Ga0265316_10124161 | 3300031344 | Bacteria | 1948 |
| 488 | Ga0265316_10154592 | 3300031344 | Bacteria | 1717 |
| 489 | Ga0265313_10000072 | 3300031595 | Bacteria | 98635 |
| 490 | Ga0265313_10000094 | 3300031595 | Bacteria | 89774 |
| 491 | Ga0265313_10002026 | 3300031595 | Bacteria | 18179 |
| 492 | Ga0265313_10013232 | 3300031595 | Bacteria | 4967 |
| 493 | Ga0265313_10027718 | 3300031595 | Bacteria | 2961 |
| 494 | Ga0265313_10094571 | 3300031595 | Bacteria | 1335 |
| 495 | Ga0316579_10011195 | 3300031691 | Bacteria | 3808 |
| 496 | Ga0265314_10011949 | 3300031711 | Bacteria | 7123 |
| 497 | Ga0265314_10060949 | 3300031711 | Bacteria | 2572 |
| 498 | Ga0265314_10087310 | 3300031711 | Bacteria | 2040 |
| 499 | Ga0265342_10001132 | 3300031712 | Bacteria | 25514 |
| 500 | Ga0265342_10017648 | 3300031712 | Bacteria | 4638 |
| 501 | Ga0373948_0004653 | 3300034817 | Unclassified | 2184 |
| 502 | Ga0373950_0000252 | 3300034818 | Bacteria | 6789 |
| 503 | Ga0373950_0013749 | 3300034818 | Bacteria | 1354 |
| 504 | Ga0373958_0000253 | 3300034819 | Bacteria | 6279 |
| 505 | Ga0373958_0051445 | 3300034819 | Bacteria | 871 |
| 506 | Ga0373959_0042536 | 3300034820 | Unclassified | 958 |
| 507 | Ga0373926_0006367 | 3300035083 | Bacteria | 3921 |
| 508 | Ga0373926_0009032 | 3300035083 | Bacteria | 3324 |
| 509 | Ga0373928_0016950 | 3300035084 | Bacteria | 1495 |
| 510 | Ga0373934_0178791 | 3300035086 | Bacteria | 872 |
| 511 | Ga0373940_0001059 | 3300035088 | Bacteria | 4755 |
| 512 | Ga0373944_0016839 | 3300035089 | Bacteria | 2067 |
| 513 | Ga0373949_0007253 | 3300035090 | Unclassified | 2427 |
| 514 | Ga0373951_0012875 | 3300035091 | Bacteria | 1881 |
| 515 | Ga0373951_0025908 | 3300035091 | Bacteria | 1363 |
| 516 | Ga0373952_0003163 | 3300035092 | Plasmid | 2963 |
| 517 | Ga0373923_0020973 | 3300035111 | Unclassified | 2546 |
| 518 | Ga0373923_0188808 | 3300035111 | Bacteria | 949 |
| 519 | Ga0373932_0001805 | 3300035112 | Bacteria | 5763 |
| 520 | Ga0373932_0015369 | 3300035112 | Unclassified | 1939 |
| 521 | Ga0373936_0017326 | 3300035113 | Unclassified | 2773 |
| 522 | Ga0373936_0023704 | 3300035113 | Bacteria | 2393 |
| 523 | Ga0373936_0050063 | 3300035113 | Unclassified | 1689 |
| 524 | Ga0373939_0002173 | 3300035114 | Bacteria | 4651 |
| 525 | Ga0373939_0002190 | 3300035114 | Plasmid | 4629 |
| 526 | Ga0373939_0063931 | 3300035114 | Bacteria | 1180 |
| 527 | Ga0373941_0004921 | 3300035115 | Bacteria | 3112 |
| 528 | Ga0373941_0005662 | 3300035115 | Unclassified | 2957 |
| 529 | Ga0373941_0023592 | 3300035115 | Bacteria | 1758 |
| 530 | Ga0373945_0000631 | 3300035116 | Bacteria | 10130 |
| 531 | Ga0373945_0060108 | 3300035116 | Bacteria | 1416 |
| 532 | Ga0373953_0112980 | 3300035117 | Bacteria | 1150 |
| 533 | Ga0373953_0156098 | 3300035117 | Bacteria | 980 |
| 534 | Ga0373954_0041392 | 3300035118 | Unclassified | 2148 |
| 535 | Ga0373954_0059511 | 3300035118 | Bacteria | 1800 |
| 536 | Ga0373954_0088350 | 3300035118 | Bacteria | 1486 |
| 537 | Ga0373956_0011799 | 3300035119 | Bacteria | 3607 |
| 538 | Ga0373956_0048683 | 3300035119 | Bacteria | 1899 |
| 539 | Ga0373956_0085892 | 3300035119 | Bacteria | 1447 |
| 540 | Ga0373957_0084793 | 3300035120 | Bacteria | 1253 |
| 541 | Ga0373960_0028487 | 3300035121 | Unclassified | 1542 |
| 542 | Ga0373943_0000576 | 3300035170 | Bacteria | 15908 |
| 543 | Ga0373946_0020057 | 3300035171 | Bacteria | 2580 |
| 544 | Ga0373955_0000486 | 3300035172 | Bacteria | 16843 |
| 545 | Ga0373955_0008616 | 3300035172 | Bacteria | 4744 |
| 546 | Ga0373955_0011699 | 3300035172 | Bacteria | 4193 |
| 547 | Ga0373955_0266221 | 3300035172 | Bacteria | 1029 |
| 548 | Ga0373942_0003463 | 3300035207 | Plasmid | 3705 |
| 549 | Ga0373942_0046125 | 3300035207 | Bacteria | 1206 |
| 550 | Ga0373961_0015754 | 3300035241 | Bacteria | 1937 |
| 551 | Ga0373924_0011641 | 3300035410 | Bacteria | 3271 |
| 552 | Ga0373931_0022894 | 3300035691 | Unclassified | 3148 |
| 553 | Ga0373931_0050564 | 3300035691 | Unclassified | 2211 |
| 554 | Ga0373935_0009157 | 3300035692 | Bacteria | 5924 |
| 555 | Ga0373935_0010279 | 3300035692 | Bacteria | 5611 |
| 556 | Ga0373935_0098587 | 3300035692 | Unclassified | 1923 |
| 557 | Ga0373935_0104772 | 3300035692 | Bacteria | 1870 |
| 558 | Ga0373935_0121379 | 3300035692 | Unclassified | 1746 |
| 559 | Ga0373935_0290427 | 3300035692 | Bacteria | 1153 |
| 560 | Ga0373927_0000994 | 3300035695 | Bacteria | 21579 |
| 561 | Ga0373927_0125644 | 3300035695 | Bacteria | 1674 |
| 562 | Ga0373927_0247215 | 3300035695 | Bacteria | 1172 |
| 563 | Ga0373933_0001169 | 3300035724 | Bacteria | 15570 |
| 564 | Ga0373933_0011184 | 3300035724 | Unclassified | 4938 |
| 565 | Ga0373933_0048350 | 3300035724 | Bacteria | 2533 |
| 566 | Ga0373933_0056238 | 3300035724 | Bacteria | 2361 |
| 567 | Ga0373947_0000084 | 3300035725 | Bacteria | 46913 |
| 568 | Ga0373947_0000874 | 3300035725 | Bacteria | 18211 |
| 569 | Ga0373947_0179277 | 3300035725 | Bacteria | 1378 |
| 570 | Ga0373947_0338826 | 3300035725 | Bacteria | 1007 |
| 571 | Ga0373937_0003379 | 3300036401 | Bacteria | 13396 |
| 572 | Ga0373937_0015326 | 3300036401 | Bacteria | 6778 |
| 573 | Ga0373937_0027230 | 3300036401 | Bacteria | 5169 |
| 574 | Ga0373937_0029009 | 3300036401 | Bacteria | 5011 |
| 575 | Ga0373937_0029562 | 3300036401 | Bacteria | 4963 |
| 576 | Ga0373937_0351105 | 3300036401 | Bacteria | 1397 |
| 577 | Ga0373937_0457683 | 3300036401 | Bacteria | 1212 |
| 578 | Ga0373925_0002271 | 3300037068 | Bacteria | 15571 |
| 579 | Ga0373925_0009697 | 3300037068 | Bacteria | 7005 |
| 580 | Ga0373925_0097726 | 3300037068 | Bacteria | 2252 |
| 581 | Ga0373925_0105792 | 3300037068 | Bacteria | 2168 |
| 582 | Ga0373925_0155420 | 3300037068 | Unclassified | 1798 |
| 583 | Ga0373925_0499589 | 3300037068 | Bacteria | 998 |
| 584 | Ga0395899_0018964 | 3300037312 | Bacteria | 5227 |
| 585 | Ga0395899_0363665 | 3300037312 | Unclassified | 965 |
| 586 | Ga0395900_0013490 | 3300037418 | Bacteria | 8349 |
| 587 | Ga0395900_0033443 | 3300037418 | Bacteria | 5291 |
| 588 | Ga0395900_0265905 | 3300037418 | Bacteria | 1711 |
| 589 | Ga0395898_0002017 | 3300037466 | Bacteria | 25468 |
| 590 | Ga0395898_0019431 | 3300037466 | Bacteria | 6914 |
| 591 | Ga0395898_0070625 | 3300037466 | Bacteria | 3375 |
| 592 | Ga0395901_0033083 | 3300038443 | Bacteria | 5335 |
| 593 | Ga0395901_0040672 | 3300038443 | Bacteria | 4816 |
| 594 | Ga0395901_0731074 | 3300038443 | Unclassified | 984 |
| 595 | Ga0436365_1084775 | 3300039437 | Bacteria | 2258 |
| 596 | Ga0436365_1446426 | 3300039437 | Bacteria | 6334 |
| 597 | Ga0436365_1906059 | 3300039437 | Bacteria | 2235 |
| 598 | Ga0439435_0051813 | 3300042436 | Unclassified | 1177 |
| 599 | Ga0451577_0257160 | 3300042876 | Bacteria | 1581 |
| 600 | Ga0466963_0011264 | 3300044694 | Bacteria | 5442 |
| 601 | Ga0453684_0114945 | 3300044712 | Plasmid | 3262 |
| 602 | Ga0466957_0444620 | 3300044842 | Bacteria | 892 |
| 603 | Ga0451576_0047663 | 3300045051 | Plasmid | 4504 |
| 604 | Ga0466958_0069110 | 3300045836 | Unclassified | 2160 |
| 605 | Ga0466967_0001558 | 3300045976 | Bacteria | 13445 |
| 606 | Ga0495617_008848 | 3300046452 | Bacteria | 3465 |
| 607 | Ga0495592_0010591 | 3300046454 | Bacteria | 6955 |
| 608 | Ga0495592_0012448 | 3300046454 | Bacteria | 6461 |
| 609 | Ga0495592_0015983 | 3300046454 | Bacteria | 5693 |
| 610 | Ga0495603_0001529 | 3300046455 | Bacteria | 13515 |
| 611 | Ga0495603_0084857 | 3300046455 | Bacteria | 1854 |
| 612 | Ga0495629_0001129 | 3300046459 | Bacteria | 21115 |
| 613 | Ga0495629_0140647 | 3300046459 | Bacteria | 1679 |
| 614 | Ga0495629_0181730 | 3300046459 | Bacteria | 1457 |
| 615 | Ga0495641_0009864 | 3300046461 | Bacteria | 5622 |
| 616 | Ga0495641_0121583 | 3300046461 | Unclassified | 1165 |
| 617 | Ga0495651_0000565 | 3300046462 | Bacteria | 28643 |
| 618 | Ga0495651_0005013 | 3300046462 | Bacteria | 10117 |
| 619 | Ga0495651_0012172 | 3300046462 | Bacteria | 6623 |
| 620 | Ga0495651_0248990 | 3300046462 | Bacteria | 1214 |
| 621 | Ga0495653_0020000 | 3300046463 | Bacteria | 5425 |
| 622 | Ga0495653_0080969 | 3300046463 | Bacteria | 2400 |
| 623 | Ga0495653_0083117 | 3300046463 | Bacteria | 2362 |
| 624 | Ga0495653_0106269 | 3300046463 | Bacteria | 2025 |
| 625 | Ga0495580_0014617 | 3300046472 | Bacteria | 5950 |
| 626 | Ga0495580_0081545 | 3300046472 | Bacteria | 2254 |
| 627 | Ga0495582_0003684 | 3300046473 | Bacteria | 8636 |
| 628 | Ga0495582_0106862 | 3300046473 | Unclassified | 1570 |
| 629 | Ga0495639_0034974 | 3300046475 | Bacteria | 2247 |
| 630 | Ga0495639_0061948 | 3300046475 | Unclassified | 1716 |
| 631 | Ga0495662_0012418 | 3300046476 | Bacteria | 4156 |
| 632 | Ga0495662_0017919 | 3300046476 | Plasmid | 3427 |
| 633 | Ga0495664_0000810 | 3300046477 | Bacteria | 15995 |
| 634 | Ga0495664_0005186 | 3300046477 | Bacteria | 7151 |
| 635 | Ga0495664_0005968 | 3300046477 | Bacteria | 6711 |
| 636 | Ga0495664_0016079 | 3300046477 | Unclassified | 4261 |
| 637 | Ga0495584_0011215 | 3300046491 | Bacteria | 4591 |
| 638 | Ga0495584_0052830 | 3300046491 | Unclassified | 2045 |
| 639 | Ga0495585_0002467 | 3300046492 | Bacteria | 13224 |
| 640 | Ga0495594_0031402 | 3300046499 | Unclassified | 2879 |
| 641 | Ga0495594_0040820 | 3300046499 | Bacteria | 2540 |
| 642 | Ga0495607_0004861 | 3300046501 | Bacteria | 9794 |
| 643 | Ga0495583_0034275 | 3300046506 | Bacteria | 2434 |
| 644 | Ga0495608_0003844 | 3300046511 | Bacteria | 10793 |
| 645 | Ga0495608_0021633 | 3300046511 | Bacteria | 4414 |
| 646 | Ga0495608_0052610 | 3300046511 | Bacteria | 2695 |
| 647 | Ga0495608_0258057 | 3300046511 | Bacteria | 1086 |
| 648 | Ga0495618_0000917 | 3300046514 | Bacteria | 20251 |
| 649 | Ga0495618_0001056 | 3300046514 | Bacteria | 18774 |
| 650 | Ga0495618_0139377 | 3300046514 | Bacteria | 1551 |
| 651 | Ga0495618_0141972 | 3300046514 | Bacteria | 1536 |
| 652 | Ga0495628_0004353 | 3300046516 | Bacteria | 12563 |
| 653 | Ga0495628_0007281 | 3300046516 | Bacteria | 9588 |
| 654 | Ga0495628_0024488 | 3300046516 | Bacteria | 4940 |
| 655 | Ga0495628_0102206 | 3300046516 | Bacteria | 2212 |
| 656 | Ga0495630_0002361 | 3300046517 | Bacteria | 13096 |
| 657 | Ga0495630_0037747 | 3300046517 | Bacteria | 3612 |
| 658 | Ga0495630_0104139 | 3300046517 | Bacteria | 2147 |
| 659 | Ga0495631_0082807 | 3300046518 | Bacteria | 1383 |
| 660 | Ga0495644_0000977 | 3300046523 | Bacteria | 11861 |
| 661 | Ga0495663_0008995 | 3300046525 | Bacteria | 2768 |
| 662 | Ga0495666_0010301 | 3300046526 | Bacteria | 4661 |
| 663 | Ga0495652_0003321 | 3300046529 | Bacteria | 15975 |
| 664 | Ga0495652_0011095 | 3300046529 | Bacteria | 8164 |
| 665 | Ga0495652_0036189 | 3300046529 | Bacteria | 4293 |
| 666 | Ga0495652_0042569 | 3300046529 | Bacteria | 3915 |
| 667 | Ga0495652_0051988 | 3300046529 | Unclassified | 3496 |
| 668 | Ga0495652_0107167 | 3300046529 | Bacteria | 2255 |
| 669 | Ga0495652_0231048 | 3300046529 | Bacteria | 1383 |
| 670 | Ga0495665_0010372 | 3300046531 | Bacteria | 5041 |
| 671 | Ga0495665_0027263 | 3300046531 | Plasmid | 3067 |
| 672 | Ga0495665_0033062 | 3300046531 | Bacteria | 2766 |
| 673 | Ga0495665_0054425 | 3300046531 | Unclassified | 2114 |
| 674 | Ga0495640_0015820 | 3300046533 | Bacteria | 5661 |
| 675 | Ga0495640_0071285 | 3300046533 | Bacteria | 2332 |
| 676 | Ga0495640_0186056 | 3300046533 | Bacteria | 1322 |
| 677 | Ga0495587_0002666 | 3300046536 | Bacteria | 11915 |
| 678 | Ga0495587_0086202 | 3300046536 | Bacteria | 1817 |
| 679 | Ga0495645_0001019 | 3300046543 | Bacteria | 19074 |
| 680 | Ga0495645_0001763 | 3300046543 | Bacteria | 14717 |
| 681 | Ga0495622_0022047 | 3300046557 | Bacteria | 2967 |
| 682 | Ga0495633_0021747 | 3300046558 | Bacteria | 3203 |
| 683 | Ga0495667_0000256 | 3300046559 | Bacteria | 34418 |
| 684 | Ga0495667_0003202 | 3300046559 | Bacteria | 10975 |
| 685 | Ga0495667_0004500 | 3300046559 | Bacteria | 9408 |
| 686 | Ga0495667_0051698 | 3300046559 | Bacteria | 2710 |
| 687 | Ga0495667_0080082 | 3300046559 | Bacteria | 2123 |
| 688 | Ga0495667_0111204 | 3300046559 | Bacteria | 1770 |
| 689 | Ga0495656_0002804 | 3300046615 | Bacteria | 5828 |
| 690 | Ga0495634_0002529 | 3300046642 | Bacteria | 15163 |
| 691 | Ga0495634_0085794 | 3300046642 | Unclassified | 2051 |
| 692 | Ga0495634_0099557 | 3300046642 | Unclassified | 1879 |
| 693 | Ga0495634_0325765 | 3300046642 | Bacteria | 924 |
| 694 | Ga0495611_0006278 | 3300046648 | Bacteria | 5071 |
| 695 | Ga0495635_0001674 | 3300046663 | Bacteria | 14916 |
| 696 | Ga0495635_0006462 | 3300046663 | Bacteria | 8173 |
| 697 | Ga0495635_0055975 | 3300046663 | Bacteria | 2716 |
| 698 | Ga0495635_0063562 | 3300046663 | Bacteria | 2535 |
| 699 | Ga0495635_0175513 | 3300046663 | Bacteria | 1457 |
| 700 | Ga0495659_0002865 | 3300046664 | Bacteria | 5540 |
| 701 | Ga0495661_0046138 | 3300046665 | Bacteria | 2662 |
| 702 | Ga0495588_0040840 | 3300046674 | Bacteria | 2367 |
| 703 | Ga0495657_0002838 | 3300046675 | Bacteria | 14378 |
| 704 | Ga0495657_0008836 | 3300046675 | Bacteria | 7671 |
| 705 | Ga0495657_0041262 | 3300046675 | Bacteria | 3160 |
| 706 | Ga0495599_0014560 | 3300046678 | Plasmid | 4870 |
| 707 | Ga0495599_0015487 | 3300046678 | Bacteria | 4733 |
| 708 | Ga0495599_0052311 | 3300046678 | Bacteria | 2558 |
| 709 | Ga0495599_0093299 | 3300046678 | Bacteria | 1878 |
| 710 | Ga0495623_0006304 | 3300046679 | Bacteria | 7713 |
| 711 | Ga0495623_0102325 | 3300046679 | Bacteria | 1744 |
| 712 | Ga0495623_0150627 | 3300046679 | Bacteria | 1375 |
| 713 | Ga0495646_0001535 | 3300046680 | Bacteria | 13774 |
| 714 | Ga0495646_0003056 | 3300046680 | Bacteria | 10373 |
| 715 | Ga0495646_0144578 | 3300046680 | Bacteria | 1327 |
| 716 | Ga0495647_0012134 | 3300046681 | Plasmid | 2963 |
| 717 | Ga0495647_0027866 | 3300046681 | Bacteria | 2078 |
| 718 | Ga0495658_0007273 | 3300046683 | Bacteria | 5472 |
| 719 | Ga0495658_0027556 | 3300046683 | Bacteria | 3058 |
| 720 | Ga0495658_0071135 | 3300046683 | Unclassified | 2020 |
| 721 | Ga0495613_0012997 | 3300046689 | Bacteria | 6186 |
| 722 | Ga0495613_0082469 | 3300046689 | Unclassified | 2335 |
| 723 | Ga0495613_0116360 | 3300046689 | Bacteria | 1923 |
| 724 | Ga0495624_0021752 | 3300046690 | Bacteria | 4249 |
| 725 | Ga0495624_0048734 | 3300046690 | Bacteria | 2687 |
| 726 | Ga0495670_0000385 | 3300046691 | Bacteria | 21067 |
| 727 | Ga0495600_0008913 | 3300046809 | Bacteria | 6180 |
| 728 | Ga0495600_0016927 | 3300046809 | Bacteria | 4633 |
| 729 | Ga0495600_0035138 | 3300046809 | Bacteria | 3254 |
| 730 | Ga0495581_0001980 | 3300047315 | Bacteria | 11493 |
| 731 | Ga0495581_0038963 | 3300047315 | Unclassified | 2751 |
| 732 | Ga0495581_0052331 | 3300047315 | Bacteria | 2358 |
| 733 | Ga0495604_0035932 | 3300047317 | Bacteria | 3909 |
| 734 | Ga0495604_0059042 | 3300047317 | Bacteria | 2943 |
| 735 | Ga0495604_0061187 | 3300047317 | Unclassified | 2880 |
| 736 | Ga0495604_0085385 | 3300047317 | Bacteria | 2355 |
| 737 | Ga0495674_0001984 | 3300047319 | Bacteria | 20115 |
| 738 | Ga0495674_0004803 | 3300047319 | Bacteria | 13003 |
| 739 | Ga0495674_0097401 | 3300047319 | Bacteria | 2505 |
| 740 | Ga0495674_0162477 | 3300047319 | Bacteria | 1868 |
| 741 | Ga0495674_0238686 | 3300047319 | Bacteria | 1498 |
| 742 | Ga0495674_0538587 | 3300047319 | Bacteria | 930 |
| 743 | Ga0495676_0097796 | 3300047321 | Unclassified | 2179 |
| 744 | Ga0495680_0005186 | 3300047322 | Bacteria | 12294 |
| 745 | Ga0495680_0005564 | 3300047322 | Bacteria | 11827 |
| 746 | Ga0495680_0013978 | 3300047322 | Bacteria | 6979 |
| 747 | Ga0495680_0091074 | 3300047322 | Bacteria | 2286 |
| 748 | Ga0495680_0096580 | 3300047322 | Bacteria | 2206 |
| 749 | Ga0495675_0000532 | 3300047444 | Bacteria | 24684 |
| 750 | Ga0495675_0155300 | 3300047444 | Bacteria | 1412 |
| 751 | Ga0495677_0075446 | 3300047445 | Bacteria | 1260 |
| 752 | Ga0495684_0003231 | 3300047471 | Bacteria | 12790 |
| 753 | Ga0495684_0020948 | 3300047471 | Bacteria | 5036 |
| 754 | Ga0495684_0025239 | 3300047471 | Bacteria | 4569 |
| 755 | Ga0495684_0025619 | 3300047471 | Bacteria | 4531 |
| 756 | Ga0495684_0083439 | 3300047471 | Bacteria | 2423 |
| 757 | Ga0495684_0089038 | 3300047471 | Bacteria | 2339 |
| 758 | Ga0495593_0016546 | 3300047673 | Plasmid | 4158 |
| 759 | Ga0495593_0064928 | 3300047673 | Unclassified | 1904 |
| 760 | Ga0495593_0154936 | 3300047673 | Bacteria | 1158 |
| 761 | Ga0495593_0235278 | 3300047673 | Bacteria | 918 |
| 762 | Ga0495602_0003582 | 3300048088 | Bacteria | 16079 |
| 763 | Ga0495602_0005750 | 3300048088 | Bacteria | 13013 |
| 764 | Ga0495614_0081315 | 3300048089 | Bacteria | 1403 |
| 765 | Ga0496100_0009690 | 3300048903 | Bacteria | 5418 |
| 766 | Ga0496100_0070886 | 3300048903 | Unclassified | 2325 |
| 767 | Ga0496101_0002148 | 3300048904 | Bacteria | 12040 |
| 768 | Ga0496101_0016521 | 3300048904 | Bacteria | 4988 |
| 769 | Ga0496101_0474639 | 3300048904 | Bacteria | 987 |
| 770 | Ga0496102_0038521 | 3300048905 | Bacteria | 4314 |
| 771 | Ga0496102_0228210 | 3300048905 | Unclassified | 1755 |
| 772 | Ga0496102_0567603 | 3300048905 | Unclassified | 1057 |
| 773 | Ga0496102_0909528 | 3300048905 | Bacteria | 801 |
| 774 | Ga0496103_0030585 | 3300048906 | Bacteria | 3277 |
| 775 | Ga0496103_0106174 | 3300048906 | Unclassified | 1781 |
| 776 | Ga0496104_0000575 | 3300048907 | Bacteria | 31363 |
| 777 | Ga0496104_0095591 | 3300048907 | Unclassified | 2842 |
| 778 | Ga0496104_0297870 | 3300048907 | Bacteria | 1525 |
| 779 | Ga0496104_0375378 | 3300048907 | Bacteria | 1334 |
| 780 | Ga0496105_0012737 | 3300048908 | Bacteria | 6662 |
| 781 | Ga0496105_0048584 | 3300048908 | Unclassified | 3502 |
| 782 | Ga0496105_0116922 | 3300048908 | Bacteria | 2199 |
| 783 | Ga0496105_0408681 | 3300048908 | Bacteria | 1076 |
| 784 | Ga0496106_0015507 | 3300048909 | Bacteria | 5638 |
| 785 | Ga0496106_0025013 | 3300048909 | Plasmid | 4441 |
| 786 | Ga0496106_0238314 | 3300048909 | Unclassified | 1453 |
| 787 | Ga0496107_0004066 | 3300048910 | Bacteria | 9849 |
| 788 | Ga0496107_0274991 | 3300048910 | Unclassified | 1253 |
| 789 | Ga0496108_0017973 | 3300048911 | Bacteria | 5784 |
| 790 | Ga0496108_0040534 | 3300048911 | Bacteria | 3882 |
| 791 | Ga0496108_0054196 | 3300048911 | Bacteria | 3365 |
| 792 | Ga0496108_0427739 | 3300048911 | Bacteria | 1156 |
| 793 | Ga0496109_0004277 | 3300048912 | Bacteria | 11931 |
| 794 | Ga0496109_0026022 | 3300048912 | Bacteria | 5215 |
| 795 | Ga0496109_0043968 | 3300048912 | Bacteria | 4050 |
| 796 | Ga0496109_0064398 | 3300048912 | Bacteria | 3354 |
| 797 | Ga0496109_0178818 | 3300048912 | Unclassified | 1992 |
| 798 | Ga0496110_0039711 | 3300048913 | Bacteria | 4098 |
| 799 | Ga0496110_0042792 | 3300048913 | Bacteria | 3953 |
| 800 | Ga0496110_0082037 | 3300048913 | Plasmid | 2875 |
| 801 | Ga0496111_0067953 | 3300048914 | Unclassified | 2590 |
| 802 | Ga0496111_0076128 | 3300048914 | Bacteria | 2446 |
| 803 | Ga0496111_0137455 | 3300048914 | Bacteria | 1810 |
| 804 | Ga0496112_0022849 | 3300048915 | Bacteria | 5966 |
| 805 | Ga0496112_0027238 | 3300048915 | Bacteria | 5511 |
| 806 | Ga0496112_0076436 | 3300048915 | Unclassified | 3311 |
| 807 | Ga0496112_0373305 | 3300048915 | Unclassified | 1368 |
| 808 | Ga0496112_0555739 | 3300048915 | Bacteria | 1081 |
| 809 | Ga0496113_0024623 | 3300048916 | Bacteria | 4280 |
| 810 | Ga0496113_0035969 | 3300048916 | Unclassified | 3626 |
| 811 | Ga0496113_0108250 | 3300048916 | Bacteria | 2160 |
| 812 | Ga0496113_0216578 | 3300048916 | Bacteria | 1525 |
| 813 | Ga0496114_0005575 | 3300048917 | Bacteria | 9865 |
| 814 | Ga0496114_0016691 | 3300048917 | Bacteria | 5920 |
| 815 | Ga0496115_0027862 | 3300048918 | Plasmid | 4423 |
| 816 | Ga0496115_0031167 | 3300048918 | Bacteria | 4199 |
| 817 | Ga0496115_0069516 | 3300048918 | Bacteria | 2852 |
| 818 | Ga0496115_0127538 | 3300048918 | Unclassified | 2096 |
| 819 | Ga0496115_0156486 | 3300048918 | Bacteria | 1883 |
| 820 | Ga0496119_0000906 | 3300048922 | Bacteria | 38547 |
| 821 | Ga0496121_0245841 | 3300048924 | Bacteria | 1244 |
| 822 | Ga0496122_0016749 | 3300048925 | Bacteria | 6907 |
| 823 | Ga0496123_0001118 | 3300048926 | Bacteria | 40071 |
| 824 | Ga0501033_0003913 | 3300049570 | Bacteria | 12090 |
| 825 | Ga0501033_0091848 | 3300049570 | Bacteria | 2221 |
| 826 | Ga0501033_0239233 | 3300049570 | Bacteria | 1288 |
| 827 | Ga0501033_0429803 | 3300049570 | Bacteria | 919 |
| 828 | Ga0501034_0000516 | 3300049571 | Bacteria | 62005 |
| 829 | Ga0501034_0037478 | 3300049571 | Bacteria | 4910 |
| 830 | Ga0501036_0392257 | 3300049572 | Bacteria | 1158 |
| 831 | Ga0501038_0063990 | 3300049574 | Bacteria | 3138 |
| 832 | Ga0501038_0066609 | 3300049574 | Bacteria | 3066 |
| 833 | Ga0501039_0006041 | 3300049575 | Bacteria | 9191 |
| 834 | Ga0501039_0054336 | 3300049575 | Bacteria | 3100 |
| 835 | Ga0501040_0014268 | 3300049576 | Bacteria | 5233 |
| 836 | Ga0501041_0006521 | 3300049577 | Bacteria | 6833 |
| 837 | Ga0501042_0048779 | 3300049578 | Bacteria | 3019 |
| 838 | Ga0501043_0048654 | 3300049579 | Bacteria | 3333 |
| 839 | Ga0501046_0063893 | 3300049580 | Bacteria | 2874 |
| 840 | Ga0501046_0098596 | 3300049580 | Bacteria | 2244 |
| 841 | Ga0501047_0004478 | 3300049581 | Bacteria | 13149 |
| 842 | Ga0501047_0044782 | 3300049581 | Bacteria | 4276 |
| 843 | Ga0501047_0078933 | 3300049581 | Bacteria | 3165 |
| 844 | Ga0501047_0463921 | 3300049581 | Bacteria | 1095 |
| 845 | Ga0501070_0018727 | 3300049586 | Bacteria | 5809 |
| 846 | Ga0501070_0037859 | 3300049586 | Bacteria | 4025 |
| 847 | Ga0501070_0260332 | 3300049586 | Bacteria | 1418 |
| 848 | Ga0501070_0690068 | 3300049586 | Unclassified | 808 |
| 849 | Ga0501071_0038665 | 3300049587 | Bacteria | 3410 |
| 850 | Ga0501072_0139806 | 3300049588 | Bacteria | 1930 |
| 851 | Ga0501072_0227857 | 3300049588 | Bacteria | 1485 |
| 852 | Ga0501073_0009746 | 3300049589 | Bacteria | 7073 |
| 853 | Ga0501075_0006847 | 3300049591 | Bacteria | 7869 |
| 854 | Ga0501076_0002990 | 3300049592 | Bacteria | 11741 |
| 855 | Ga0501076_0043052 | 3300049592 | Bacteria | 3557 |
| 856 | Ga0501079_0000379 | 3300049741 | Bacteria | 28580 |
| 857 | Ga0501079_0125498 | 3300049741 | Bacteria | 1997 |
| 858 | Ga0501079_0243350 | 3300049741 | Bacteria | 1406 |
| 859 | Ga0501080_0012910 | 3300049742 | Bacteria | 7667 |
| 860 | Ga0501080_0032326 | 3300049742 | Bacteria | 4880 |
| 861 | Ga0501080_0308225 | 3300049742 | Bacteria | 1435 |
| 862 | Ga0501081_0000033 | 3300049743 | Bacteria | 51492 |
| 863 | Ga0501083_0091167 | 3300049744 | Bacteria | 2012 |
| 864 | Ga0501035_0004436 | 3300049822 | Bacteria | 13316 |
| 865 | Ga0501044_0005860 | 3300049823 | Bacteria | 13610 |
| 866 | Ga0501044_0094254 | 3300049823 | Bacteria | 3019 |
| 867 | Ga0501044_0132508 | 3300049823 | Bacteria | 2486 |
| 868 | Ga0501045_0036136 | 3300049824 | Bacteria | 3587 |
| 869 | nmdc:mga07m45_327029_c1 | 3300050496 | Unclassified | 891 |
| 870 | nmdc:mga05p37_3041_c1 | 3300050507 | Bacteria | 19469 |
| 871 | nmdc:mga09592_324265_c1 | 3300050508 | Bacteria | 1334 |
| 872 | nmdc:mga09592_5026_c1 | 3300050508 | Bacteria | 10727 |
| 873 | nmdc:mga0qj67_1705_c1 | 3300050509 | Bacteria | 15492 |
| 874 | nmdc:mga0qj67_231261_c1 | 3300050509 | Bacteria | 1500 |
| 875 | nmdc:mga06r32_2163_c1 | 3300050510 | Bacteria | 17587 |
| 876 | nmdc:mga06r32_226428_c1 | 3300050510 | Bacteria | 1858 |
| 877 | nmdc:mga08y16_289_c1 | 3300050511 | Bacteria | 45654 |
| 878 | nmdc:mga08y16_31530_c1 | 3300050511 | Bacteria | 5575 |
| 879 | nmdc:mga0n895_112788_c1 | 3300050512 | Bacteria | 2736 |
| 880 | nmdc:mga0n895_140865_c1 | 3300050512 | Bacteria | 2440 |
| 881 | nmdc:mga0n895_361831_c1 | 3300050512 | Bacteria | 1469 |
| 882 | nmdc:mga0n895_392128_c1 | 3300050512 | Bacteria | 1405 |
| 883 | nmdc:mga0n895_4459_c1 | 3300050512 | Bacteria | 11502 |
| 884 | nmdc:mga0rr50_11469_c1 | 3300050513 | Bacteria | 5677 |
| 885 | nmdc:mga0rr50_141250_c1 | 3300050513 | Bacteria | 1937 |
| 886 | nmdc:mga0rr50_168968_c1 | 3300050513 | Bacteria | 1780 |
| 887 | nmdc:mga0rr50_308633_c1 | 3300050513 | Bacteria | 1325 |
| 888 | nmdc:mga0rr50_576477_c1 | 3300050513 | Bacteria | 959 |
| 889 | nmdc:mga08x19_198328_c1 | 3300050514 | Bacteria | 1375 |
| 890 | nmdc:mga0a205_17258_c1 | 3300050515 | Bacteria | 6763 |
| 891 | nmdc:mga0a205_249588_c1 | 3300050515 | Unclassified | 1654 |
| 892 | nmdc:mga0a205_3619_c1 | 3300050515 | Bacteria | 13829 |
| 893 | nmdc:mga0a205_733_c2 | 3300050515 | Bacteria | 10917 |
| 894 | Ga0495601_0000418 | 3300053077 | Bacteria | 22241 |
| 895 | Ga0495601_0002208 | 3300053077 | Bacteria | 10952 |
| 896 | Ga0495601_0003992 | 3300053077 | Bacteria | 8492 |
| 897 | Ga0495601_0017457 | 3300053077 | Bacteria | 4356 |
| 898 | Ga0495601_0041803 | 3300053077 | Bacteria | 2874 |
| 899 | Ga0495612_0000666 | 3300053078 | Bacteria | 13871 |
| 900 | Ga0495612_0011282 | 3300053078 | Bacteria | 3602 |
| 901 | Ga0495612_0011744 | 3300053078 | Bacteria | 3530 |
| 902 | Ga0495612_0020362 | 3300053078 | Bacteria | 2658 |
| 903 | Ga0495595_0003514 | 3300053084 | Bacteria | 6221 |
| 904 | Ga0495595_0013087 | 3300053084 | Bacteria | 3499 |
| 905 | Ga0495595_0025852 | 3300053084 | Unclassified | 2604 |
| 906 | Ga0495595_0026794 | 3300053084 | Bacteria | 2563 |
| 907 | Ga0495595_0047076 | 3300053084 | Bacteria | 1988 |
| 908 | Ga0495619_0002359 | 3300053085 | Bacteria | 12422 |
| 909 | Ga0495619_0002566 | 3300053085 | Bacteria | 11887 |
| 910 | Ga0495619_0007346 | 3300053085 | Bacteria | 6982 |
| 911 | Ga0495619_0007524 | 3300053085 | Bacteria | 6899 |
| 912 | Ga0495619_0017182 | 3300053085 | Bacteria | 4582 |
| 913 | Ga0495619_0021147 | 3300053085 | Bacteria | 4151 |
| 914 | Ga0495619_0036672 | 3300053085 | Unclassified | 3193 |
| 915 | Ga0495619_0061266 | 3300053085 | Bacteria | 2503 |
| 916 | Ga0495619_0098848 | 3300053085 | Bacteria | 1984 |
| 917 | Ga0500643_002005 | 3300053087 | Bacteria | 10963 |
| 918 | Ga0500644_0013518 | 3300053088 | Bacteria | 2281 |
| 919 | Ga0500566_0105691 | 3300053094 | Bacteria | 1537 |
| 920 | Ga0500650_0097840 | 3300053098 | Bacteria | 1374 |
| 921 | Ga0500593_035093 | 3300053117 | Bacteria | 2245 |
| 922 | Ga0500594_0047025 | 3300053118 | Bacteria | 1202 |
| 923 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 924 | Ga0500652_003429 | 3300053131 | Bacteria | 4801 |
| 925 | Ga0500652_154862 | 3300053131 | Bacteria | 949 |
| 926 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 927 | Ga0500645_000086 | 3300053730 | Bacteria | 74512 |
| 928 | Ga0500645_004764 | 3300053730 | Bacteria | 5135 |
| 929 | Ga0501084_0074934 | 3300054114 | Bacteria | 2835 |
| 930 | Ga0501082_0003399 | 3300060353 | Bacteria | 13894 |
| 931 | Ga0501082_0203082 | 3300060353 | Bacteria | 1724 |
| 932 | Ga0501082_0306932 | 3300060353 | Unclassified | 1382 |
| 933 | Ga0501082_0439431 | 3300060353 | Bacteria | 1140 |
| 934 | Ga0466962_0080838 | 3300061719 | Bacteria | 1554 |
| 935 | Ga0530510_0167878 | 3300061734 | Bacteria | 1625 |
| 936 | Ga0501034_0063357 | |||
| 937 | ARSoilYngRDRAFT_c00118 | |||
| 938 | ARcpr5yngRDRAFT_c000035 | |||
| 939 | ARCol0yngRDRAFT_1000516 | |||
| 940 | JGI24752J21851_1007583 | |||
| 941 | JGI24746J21847_1011725 | |||
| 942 | JGI24747J21853_1002987 | |||
| 943 | JGI24739J22299_10000158 | |||
| 944 | JGI24737J22298_10001510 | |||
| 945 | JGI24737J22298_10001948 | |||
| 946 | JGI24750J21931_1000477 | |||
| 947 | JGI24745J21846_1000120 | |||
| 948 | JGI24738J21930_10001316 | |||
| 949 | JGI24749J21850_1000215 | |||
| 950 | JGI24749J21850_1004682 | |||
| 951 | JGI24744J21845_10012002 | |||
| 952 | JGI24035J26624_1000023 | |||
| 953 | JGI24034J26672_10000641 | |||
| 954 | JGI24742J22300_10002624 | |||
| 955 | Ga0065717_1000203 | |||
| 956 | Ga0065704_10090673 | |||
| 957 | Ga0065712_10018330 | |||
| 958 | Ga0065712_10093636 | |||
| 959 | Ga0065715_10001166 | |||
| 960 | Ga0065715_10021066 | |||
| 961 | Ga0065715_10099722 | |||
| 962 | Ga0070658_10006919 | |||
| 963 | Ga0070658_10028299 | |||
| 964 | Ga0070658_10055484 | |||
| 965 | Ga0070676_10015064 | |||
| 966 | Ga0070683_100012601 | |||
| 967 | Ga0070683_100051385 | |||
| 968 | Ga0070690_100000727 | |||
| 969 | Ga0070690_100023181 | |||
| 970 | Ga0070690_100038800 | |||
| 971 | Ga0070690_100291883 | |||
| 972 | Ga0070670_100040022 | |||
| 973 | Ga0070670_100046230 | |||
| 974 | Ga0070670_100566337 | |||
| 975 | Ga0070677_10002396 | |||
| 976 | Ga0068869_100002166 | |||
| 977 | Ga0068869_100312538 | |||
| 978 | Ga0070666_10022637 | |||
| 979 | Ga0070666_10025033 | |||
| 980 | Ga0070680_100006389 | |||
| 981 | Ga0070680_100018615 | |||
| 982 | Ga0070680_100057732 | |||
| 983 | Ga0070680_100073630 | |||
| 984 | Ga0070680_100189244 | |||
| 985 | Ga0070680_100289243 | |||
| 986 | Ga0070680_100448654 | |||
| 987 | Ga0070682_100002724 | |||
| 988 | Ga0070682_100038338 | |||
| 989 | Ga0070682_100130177 | |||
| 990 | Ga0068868_100002949 | |||
| 991 | Ga0068868_100021585 | |||
| 992 | Ga0070660_100000985 | |||
| 993 | Ga0070660_100026353 | |||
| 994 | Ga0070689_100000646 | |||
| 995 | Ga0070689_100002989 | |||
| 996 | Ga0070689_100014280 | |||
| 997 | Ga0070691_10000060 | |||
| 998 | Ga0070687_100000773 | |||
| 999 | Ga0070661_100015592 | |||
| 1000 | Ga0070661_100206021 | |||
| 1001 | Ga0070692_10000273 | |||
| 1002 | Ga0070668_100007804 | |||
| 1003 | Ga0070669_100019129 | |||
| 1004 | Ga0070675_100003854 | |||
| 1005 | Ga0070675_100036283 | |||
| 1006 | Ga0070671_100000349 | |||
| 1007 | Ga0070671_100032167 | |||
| 1008 | Ga0070671_100111836 | |||
| 1009 | Ga0070674_100000152 | |||
| 1010 | Ga0070674_100026791 | |||
| 1011 | Ga0070674_100031793 | |||
| 1012 | Ga0070673_100007455 | |||
| 1013 | Ga0070688_100002079 | |||
| 1014 | Ga0070688_100002194 | |||
| 1015 | Ga0070688_100091062 | |||
| 1016 | Ga0070659_100000621 | |||
| 1017 | Ga0070659_100037533 | |||
| 1018 | Ga0070667_100000810 | |||
| 1019 | Ga0070703_10002626 | |||
| 1020 | Ga0070709_10024168 | |||
| 1021 | Ga0070714_100027007 | |||
| 1022 | Ga0070714_100049823 | |||
| 1023 | Ga0070714_100068290 | |||
| 1024 | Ga0070714_100102916 | |||
| 1025 | Ga0070714_100617703 | |||
| 1026 | Ga0070713_100015547 | |||
| 1027 | Ga0070713_100045893 | |||
| 1028 | Ga0070713_100081039 | |||
| 1029 | Ga0070713_100084255 | |||
| 1030 | Ga0070710_10029249 | |||
| 1031 | Ga0070701_10000042 | |||
| 1032 | Ga0070701_10008593 | |||
| 1033 | Ga0070711_100008373 | |||
| 1034 | Ga0070711_100132629 | |||
| 1035 | Ga0070705_100005564 | |||
| 1036 | Ga0070705_100096394 | |||
| 1037 | Ga0070705_100147919 | |||
| 1038 | Ga0070700_100000329 | |||
| 1039 | Ga0070700_100023379 | |||
| 1040 | Ga0070694_100002007 | |||
| 1041 | Ga0070694_100002748 | |||
| 1042 | Ga0070708_100045860 | |||
| 1043 | Ga0070663_100037014 | |||
| 1044 | Ga0070663_100090670 | |||
| 1045 | Ga0070678_100013734 | |||
| 1046 | Ga0070678_100062841 | |||
| 1047 | Ga0070662_100064811 | |||
| 1048 | Ga0070662_100182156 | |||
| 1049 | Ga0070662_100333215 | |||
| 1050 | Ga0070662_100548462 | |||
| 1051 | Ga0070681_10004332 | |||
| 1052 | Ga0070681_10005076 | |||
| 1053 | Ga0070681_10016427 | |||
| 1054 | Ga0070681_10148826 | |||
| 1055 | Ga0068867_100007473 | |||
| 1056 | Ga0068867_100119720 | |||
| 1057 | Ga0070685_10006180 | |||
| 1058 | Ga0070685_10007245 | |||
| 1059 | Ga0070685_10129989 | |||
| 1060 | Ga0070706_100157073 | |||
| 1061 | Ga0070699_100270906 | |||
| 1062 | Ga0070679_100002742 | |||
| 1063 | Ga0070679_100157221 | |||
| 1064 | Ga0070679_100206314 | |||
| 1065 | Ga0070679_100222698 | |||
| 1066 | Ga0070679_100236175 | |||
| 1067 | Ga0070684_100000464 | |||
| 1068 | Ga0070684_100376832 | |||
| 1069 | Ga0070697_100013327 | |||
| 1070 | Ga0068853_100001029 | |||
| 1071 | Ga0070672_100020218 | |||
| 1072 | Ga0070672_100078130 | |||
| 1073 | Ga0070686_100001527 | |||
| 1074 | Ga0070695_100010249 | |||
| 1075 | Ga0070695_100047425 | |||
| 1076 | Ga0070695_100097437 | |||
| 1077 | Ga0070696_100015481 | |||
| 1078 | Ga0070696_100098522 | |||
| 1079 | Ga0070693_100000266 | |||
| 1080 | Ga0070693_100036753 | |||
| 1081 | Ga0070693_100060687 | |||
| 1082 | Ga0070665_100108939 | |||
| 1083 | Ga0070665_100168547 | |||
| 1084 | Ga0070704_100010668 | |||
| 1085 | Ga0070704_100104573 | |||
| 1086 | Ga0068855_100041697 | |||
| 1087 | Ga0068855_100061239 | |||
| 1088 | Ga0070664_100015424 | |||
| 1089 | Ga0070664_100023574 | |||
| 1090 | Ga0068857_100000888 | |||
| 1091 | Ga0068857_100239796 | |||
| 1092 | Ga0068857_100691623 | |||
| 1093 | Ga0068854_100005378 | |||
| 1094 | Ga0068856_100003260 | |||
| 1095 | Ga0068856_100126633 | |||
| 1096 | Ga0068856_100160523 | |||
| 1097 | Ga0068856_100494033 | |||
| 1098 | Ga0070702_100053415 | |||
| 1099 | Ga0068852_100000579 | |||
| 1100 | Ga0068852_100580680 | |||
| 1101 | Ga0068859_100003690 | |||
| 1102 | Ga0068859_100146749 | |||
| 1103 | Ga0068859_100231653 | |||
| 1104 | Ga0068859_100233619 | |||
| 1105 | Ga0068864_100001260 | |||
| 1106 | Ga0068864_100106019 | |||
| 1107 | Ga0068864_100236411 | |||
| 1108 | Ga0068864_100710527 | |||
| 1109 | Ga0068866_10001077 | |||
| 1110 | Ga0068866_10018692 | |||
| 1111 | Ga0068861_100001782 | |||
| 1112 | Ga0068861_100351967 | |||
| 1113 | Ga0068851_10046717 | |||
| 1114 | Ga0068870_10000108 | |||
| 1115 | Ga0068863_100001201 | |||
| 1116 | Ga0068863_100324236 | |||
| 1117 | Ga0068858_100000419 | |||
| 1118 | Ga0068858_100054459 | |||
| 1119 | Ga0068858_100181366 | |||
| 1120 | Ga0068860_100001359 | |||
| 1121 | Ga0068860_100475076 | |||
| 1122 | Ga0068860_100875780 | |||
| 1123 | Ga0068860_100896963 | |||
| 1124 | Ga0068862_100005815 | |||
| 1125 | Ga0068862_100056562 | |||
| 1126 | Ga0081455_10000009 | |||
| 1127 | Ga0081455_10004982 | |||
| 1128 | Ga0081455_10117653 | |||
| 1129 | Ga0070717_10021459 | |||
| 1130 | Ga0070717_10527144 | |||
| 1131 | Ga0075432_10021698 | |||
| 1132 | Ga0070715_10020498 | |||
| 1133 | Ga0070716_100001823 | |||
| 1134 | Ga0070716_100016982 | |||
| 1135 | Ga0070712_100014499 | |||
| 1136 | Ga0070712_100032441 | |||
| 1137 | Ga0070712_100050661 | |||
| 1138 | Ga0070712_100051125 | |||
| 1139 | Ga0070712_100499292 | |||
| 1140 | Ga0075367_10009088 | |||
| 1141 | Ga0075427_10001549 | |||
| 1142 | Ga0097621_100021768 | |||
| 1143 | Ga0097621_100031346 | |||
| 1144 | Ga0097621_100073441 | |||
| 1145 | Ga0075370_10131248 | |||
| 1146 | Ga0075370_10252665 | |||
| 1147 | Ga0068871_100000417 | |||
| 1148 | Ga0068871_100011895 | |||
| 1149 | Ga0068871_100357746 | |||
| 1150 | Ga0075428_100010422 | |||
| 1151 | Ga0075430_100001576 | |||
| 1152 | Ga0075430_100095225 | |||
| 1153 | Ga0075431_100002654 | |||
| 1154 | Ga0075433_10011770 | |||
| 1155 | Ga0075433_10017308 | |||
| 1156 | Ga0075433_10047158 | |||
| 1157 | Ga0075433_10221434 | |||
| 1158 | Ga0075434_100001354 | |||
| 1159 | Ga0075434_100002767 | |||
| 1160 | Ga0075434_100011160 | |||
| 1161 | Ga0075434_100188185 | |||
| 1162 | Ga0075429_100001895 | |||
| 1163 | Ga0075429_100309124 | |||
| 1164 | Ga0068865_100000450 | |||
| 1165 | Ga0068865_100149202 | |||
| 1166 | Ga0097620_100003690 | |||
| 1167 | Ga0097620_100146739 | |||
| 1168 | Ga0097620_100231649 | |||
| 1169 | Ga0097620_100233630 | |||
| 1170 | Ga0075435_100003745 | |||
| 1171 | Ga0075435_100014388 | |||
| 1172 | Ga0075435_100154700 | |||
| 1173 | Ga0075435_100228984 | |||
| 1174 | Ga0075435_100346988 | |||
| 1175 | Ga0105240_10059540 | |||
| 1176 | Ga0105240_10177548 | |||
| 1177 | Ga0111539_10000196 | |||
| 1178 | Ga0111539_10013383 | |||
| 1179 | Ga0111539_10027016 | |||
| 1180 | Ga0111539_10655615 | |||
| 1181 | Ga0111539_11067943 | |||
| 1182 | Ga0105245_10026898 | |||
| 1183 | Ga0105245_10458835 | |||
| 1184 | Ga0105247_10013936 | |||
| 1185 | Ga0105247_10182088 | |||
| 1186 | Ga0105247_10212672 | |||
| 1187 | Ga0105247_10234103 | |||
| 1188 | Ga0114129_10013413 | |||
| 1189 | Ga0114129_10020551 | |||
| 1190 | Ga0105243_10002051 | |||
| 1191 | Ga0105243_10044187 | |||
| 1192 | Ga0105243_10702399 | |||
| 1193 | Ga0105241_10001526 | |||
| 1194 | Ga0105241_10132786 | |||
| 1195 | Ga0105241_10383803 | |||
| 1196 | Ga0105242_10000399 | |||
| 1197 | Ga0105242_10066427 | |||
| 1198 | Ga0105242_10285747 | |||
| 1199 | Ga0105248_10004145 | |||
| 1200 | Ga0105248_10068292 | |||
| 1201 | Ga0105248_10085160 | |||
| 1202 | Ga0105237_10006666 | |||
| 1203 | Ga0105237_10038653 | |||
| 1204 | Ga0105237_10040533 | |||
| 1205 | Ga0105237_10458258 | |||
| 1206 | Ga0105238_10111550 | |||
| 1207 | Ga0105238_10432216 | |||
| 1208 | Ga0105249_10002756 | |||
| 1209 | Ga0105249_10013099 | |||
| 1210 | Ga0105249_10831782 | |||
| 1211 | Ga0105239_10043528 | |||
| 1212 | Ga0105239_10105506 | |||
| 1213 | Ga0105239_10478136 | |||
| 1214 | Ga0105239_10493535 | |||
| 1215 | Ga0105246_10000033 | |||
| 1216 | Ga0105246_10203566 | |||
| 1217 | Ga0105246_10254007 | |||
| 1218 | Ga0157373_10006645 | |||
| 1219 | Ga0157371_10015424 | |||
| 1220 | Ga0157371_10052511 | |||
| 1221 | Ga0157370_10114232 | |||
| 1222 | Ga0157370_10144803 | |||
| 1223 | Ga0157369_10494186 | |||
| 1224 | Ga0157374_10002423 | |||
| 1225 | Ga0157374_10201748 | |||
| 1226 | Ga0157374_10209982 | |||
| 1227 | Ga0157374_10228712 | |||
| 1228 | Ga0157378_10011328 | |||
| 1229 | Ga0163162_10175648 | |||
| 1230 | Ga0163162_10429942 | |||
| 1231 | Ga0157372_10001162 | |||
| 1232 | Ga0157372_10531519 | |||
| 1233 | Ga0157372_10783681 | |||
| 1234 | Ga0157375_10000124 | |||
| 1235 | Ga0157375_10022011 | |||
| 1236 | Ga0157375_10193278 | |||
| 1237 | Ga0163163_10000745 | |||
| 1238 | Ga0163163_10173646 | |||
| 1239 | Ga0163163_10591800 | |||
| 1240 | Ga0157380_10000140 | |||
| 1241 | Ga0157380_10294780 | |||
| 1242 | Ga0157377_10000117 | |||
| 1243 | Ga0157377_10120726 | |||
| 1244 | Ga0157379_10000785 | |||
| 1245 | Ga0157379_10020035 | |||
| 1246 | Ga0157379_10055182 | |||
| 1247 | Ga0157379_10507186 | |||
| 1248 | Ga0157376_10000034 | |||
| 1249 | Ga0206354_10939082 | |||
| 1250 | Ga0213876_10037930 | |||
| 1251 | Ga0207666_1000017 | |||
| 1252 | Ga0207666_1000448 | |||
| 1253 | Ga0207673_1000258 | |||
| 1254 | Ga0207697_10000009 | |||
| 1255 | Ga0207697_10001569 | |||
| 1256 | Ga0207682_10000301 | |||
| 1257 | Ga0207692_10005897 | |||
| 1258 | Ga0207642_10001973 | |||
| 1259 | Ga0207710_10004684 | |||
| 1260 | Ga0207710_10094733 | |||
| 1261 | Ga0207688_10000012 | |||
| 1262 | Ga0207688_10287309 | |||
| 1263 | Ga0207647_10005111 | |||
| 1264 | Ga0207647_10017208 | |||
| 1265 | Ga0207685_10005072 | |||
| 1266 | Ga0207699_10001620 | |||
| 1267 | Ga0207699_10002309 | |||
| 1268 | Ga0207645_10000124 | |||
| 1269 | Ga0207645_10008610 | |||
| 1270 | Ga0207643_10000046 | |||
| 1271 | Ga0207705_10008788 | |||
| 1272 | Ga0207705_10027090 | |||
| 1273 | Ga0207705_10209221 | |||
| 1274 | Ga0207654_10003867 | |||
| 1275 | Ga0207654_10051066 | |||
| 1276 | Ga0207707_10021900 | |||
| 1277 | Ga0207707_10052526 | |||
| 1278 | Ga0207707_10065374 | |||
| 1279 | Ga0207707_10140111 | |||
| 1280 | Ga0207707_10414139 | |||
| 1281 | Ga0207707_10530181 | |||
| 1282 | Ga0207671_10253315 | |||
| 1283 | Ga0207693_10005252 | |||
| 1284 | Ga0207693_10158542 | |||
| 1285 | Ga0207693_10185006 | |||
| 1286 | Ga0207663_10012608 | |||
| 1287 | Ga0207663_10066915 | |||
| 1288 | Ga0207663_10186245 | |||
| 1289 | Ga0207660_10001510 | |||
| 1290 | Ga0207660_10020034 | |||
| 1291 | Ga0207660_10139087 | |||
| 1292 | Ga0207660_10264613 | |||
| 1293 | Ga0207662_10000222 | |||
| 1294 | Ga0207657_10000162 | |||
| 1295 | Ga0207657_10008982 | |||
| 1296 | Ga0207657_10031279 | |||
| 1297 | Ga0207649_10000798 | |||
| 1298 | Ga0207649_10050147 | |||
| 1299 | Ga0207649_10074301 | |||
| 1300 | Ga0207652_10066691 | |||
| 1301 | Ga0207652_10126524 | |||
| 1302 | Ga0207652_10150391 | |||
| 1303 | Ga0207652_10157030 | |||
| 1304 | Ga0207652_10272769 | |||
| 1305 | Ga0207652_10343981 | |||
| 1306 | Ga0207646_10153575 | |||
| 1307 | Ga0207681_10003611 | |||
| 1308 | Ga0207694_10090129 | |||
| 1309 | Ga0207694_10326208 | |||
| 1310 | Ga0207650_10031847 | |||
| 1311 | Ga0207650_10059776 | |||
| 1312 | Ga0207650_10230395 | |||
| 1313 | Ga0207659_10016376 | |||
| 1314 | Ga0207687_10011784 | |||
| 1315 | Ga0207687_10236956 | |||
| 1316 | Ga0207700_10000290 | |||
| 1317 | Ga0207700_10022250 | |||
| 1318 | Ga0207664_10026121 | |||
| 1319 | Ga0207664_10097295 | |||
| 1320 | Ga0207664_10162640 | |||
| 1321 | Ga0207644_10018037 | |||
| 1322 | Ga0207644_10124978 | |||
| 1323 | Ga0207706_10000368 | |||
| 1324 | Ga0207706_10007484 | |||
| 1325 | Ga0207706_10058572 | |||
| 1326 | Ga0207686_10010832 | |||
| 1327 | Ga0207686_10034817 | |||
| 1328 | Ga0207709_10000256 | |||
| 1329 | Ga0207709_10147387 | |||
| 1330 | Ga0207670_10450041 | |||
| 1331 | Ga0207669_10001765 | |||
| 1332 | Ga0207669_10315477 | |||
| 1333 | Ga0207669_10585300 | |||
| 1334 | Ga0207704_10002423 | |||
| 1335 | Ga0207665_10024323 | |||
| 1336 | Ga0207691_10000303 | |||
| 1337 | Ga0207711_10048233 | |||
| 1338 | Ga0207689_10000109 | |||
| 1339 | Ga0207661_10010457 | |||
| 1340 | Ga0207661_10106083 | |||
| 1341 | Ga0207661_10528559 | |||
| 1342 | Ga0207679_10000031 | |||
| 1343 | Ga0207679_10068452 | |||
| 1344 | Ga0207667_10002481 | |||
| 1345 | Ga0207667_10015271 | |||
| 1346 | Ga0207667_10078969 | |||
| 1347 | Ga0207651_10404483 | |||
| 1348 | Ga0207712_10001848 | |||
| 1349 | Ga0207712_10307709 | |||
| 1350 | Ga0207668_10001339 | |||
| 1351 | Ga0207640_10001185 | |||
| 1352 | Ga0207658_10016049 | |||
| 1353 | Ga0207658_10056945 | |||
| 1354 | Ga0207658_10102245 | |||
| 1355 | Ga0207677_10335012 | |||
| 1356 | Ga0207703_10008545 | |||
| 1357 | Ga0207639_10050194 | |||
| 1358 | Ga0207678_10000158 | |||
| 1359 | Ga0207678_10030340 | |||
| 1360 | Ga0207678_10073370 | |||
| 1361 | Ga0207678_10141821 | |||
| 1362 | Ga0207708_10000098 | |||
| 1363 | Ga0207708_10005985 | |||
| 1364 | Ga0207708_10122629 | |||
| 1365 | Ga0207702_10043424 | |||
| 1366 | Ga0207702_10319440 | |||
| 1367 | Ga0207702_10375330 | |||
| 1368 | Ga0207702_10739746 | |||
| 1369 | Ga0207641_10025880 | |||
| 1370 | Ga0207641_10656842 | |||
| 1371 | Ga0207648_10000696 | |||
| 1372 | Ga0207648_10211259 | |||
| 1373 | Ga0207676_10005342 | |||
| 1374 | Ga0207676_10105319 | |||
| 1375 | Ga0207676_10269041 | |||
| 1376 | Ga0207674_10000420 | |||
| 1377 | Ga0207675_100001146 | |||
| 1378 | Ga0207675_100184391 | |||
| 1379 | Ga0207675_100383127 | |||
| 1380 | Ga0207683_10000004 | |||
| 1381 | Ga0207683_10001766 | |||
| 1382 | Ga0207683_10016095 | |||
| 1383 | Ga0207698_10015254 | |||
| 1384 | Ga0207698_10021138 | |||
| 1385 | Ga0209973_1013981 | |||
| 1386 | Ga0209984_1007530 | |||
| 1387 | Ga0209970_1017406 | |||
| 1388 | Ga0210002_1002603 | |||
| 1389 | Ga0209971_1011172 | |||
| 1390 | Ga0209971_1014527 | |||
| 1391 | Ga0209998_10003042 | |||
| 1392 | Ga0209998_10009889 | |||
| 1393 | Ga0209974_10000117 | |||
| 1394 | Ga0207428_10000250 | |||
| 1395 | Ga0207428_10001707 | |||
| 1396 | Ga0207428_10007251 | |||
| 1397 | Ga0268266_10009789 | |||
| 1398 | Ga0268265_10005880 | |||
| 1399 | Ga0268265_10054430 | |||
| 1400 | Ga0268264_10076905 | |||
| 1401 | Ga0268264_10108780 | |||
| 1402 | Ga0268264_10157143 | |||
| 1403 | Ga0265337_1005419 | |||
| 1404 | Ga0265318_10072287 | |||
| 1405 | Ga0265338_10009970 | |||
| 1406 | Ga0265338_10205712 | |||
| 1407 | Ga0265338_10261562 | |||
| 1408 | Ga0265325_10000039 | |||
| 1409 | Ga0265325_10000568 | |||
| 1410 | Ga0265325_10001242 | |||
| 1411 | Ga0265325_10007949 | |||
| 1412 | Ga0265325_10090448 | |||
| 1413 | Ga0265325_10118878 | |||
| 1414 | Ga0265329_10051651 | |||
| 1415 | Ga0265340_10011649 | |||
| 1416 | Ga0265340_10058550 | |||
| 1417 | Ga0265340_10068395 | |||
| 1418 | Ga0265339_10000060 | |||
| 1419 | Ga0265339_10004978 | |||
| 1420 | Ga0265339_10061175 | |||
| 1421 | Ga0265339_10108445 | |||
| 1422 | Ga0265316_10124161 | |||
| 1423 | Ga0265316_10154592 | |||
| 1424 | Ga0265313_10000072 | |||
| 1425 | Ga0265313_10000094 | |||
| 1426 | Ga0265313_10002026 | |||
| 1427 | Ga0265313_10013232 | |||
| 1428 | Ga0265313_10027718 | |||
| 1429 | Ga0265313_10094571 | |||
| 1430 | Ga0316579_10011195 | |||
| 1431 | Ga0265314_10011949 | |||
| 1432 | Ga0265314_10060949 | |||
| 1433 | Ga0265314_10087310 | |||
| 1434 | Ga0265342_10001132 | |||
| 1435 | Ga0265342_10017648 | |||
| 1436 | Ga0373948_0004653 | |||
| 1437 | Ga0373950_0000252 | |||
| 1438 | Ga0373950_0013749 | |||
| 1439 | Ga0373958_0000253 | |||
| 1440 | Ga0373958_0051445 | |||
| 1441 | Ga0373959_0042536 | |||
| 1442 | Ga0373926_0006367 | |||
| 1443 | Ga0373926_0009032 | |||
| 1444 | Ga0373928_0016950 | |||
| 1445 | Ga0373934_0178791 | |||
| 1446 | Ga0373940_0001059 | |||
| 1447 | Ga0373944_0016839 | |||
| 1448 | Ga0373949_0007253 | |||
| 1449 | Ga0373951_0012875 | |||
| 1450 | Ga0373951_0025908 | |||
| 1451 | Ga0373952_0003163 | |||
| 1452 | Ga0373923_0020973 | |||
| 1453 | Ga0373923_0188808 | |||
| 1454 | Ga0373932_0001805 | |||
| 1455 | Ga0373932_0015369 | |||
| 1456 | Ga0373936_0017326 | |||
| 1457 | Ga0373936_0023704 | |||
| 1458 | Ga0373936_0050063 | |||
| 1459 | Ga0373939_0002173 | |||
| 1460 | Ga0373939_0002190 | |||
| 1461 | Ga0373939_0063931 | |||
| 1462 | Ga0373941_0004921 | |||
| 1463 | Ga0373941_0005662 | |||
| 1464 | Ga0373941_0023592 | |||
| 1465 | Ga0373945_0000631 | |||
| 1466 | Ga0373945_0060108 | |||
| 1467 | Ga0373953_0112980 | |||
| 1468 | Ga0373953_0156098 | |||
| 1469 | Ga0373954_0041392 | |||
| 1470 | Ga0373954_0059511 | |||
| 1471 | Ga0373954_0088350 | |||
| 1472 | Ga0373956_0011799 | |||
| 1473 | Ga0373956_0048683 | |||
| 1474 | Ga0373956_0085892 | |||
| 1475 | Ga0373957_0084793 | |||
| 1476 | Ga0373960_0028487 | |||
| 1477 | Ga0373943_0000576 | |||
| 1478 | Ga0373946_0020057 | |||
| 1479 | Ga0373955_0000486 | |||
| 1480 | Ga0373955_0008616 | |||
| 1481 | Ga0373955_0011699 | |||
| 1482 | Ga0373955_0266221 | |||
| 1483 | Ga0373942_0003463 | |||
| 1484 | Ga0373942_0046125 | |||
| 1485 | Ga0373961_0015754 | |||
| 1486 | Ga0373924_0011641 | |||
| 1487 | Ga0373931_0022894 | |||
| 1488 | Ga0373931_0050564 | |||
| 1489 | Ga0373935_0009157 | |||
| 1490 | Ga0373935_0010279 | |||
| 1491 | Ga0373935_0098587 | |||
| 1492 | Ga0373935_0104772 | |||
| 1493 | Ga0373935_0121379 | |||
| 1494 | Ga0373935_0290427 | |||
| 1495 | Ga0373927_0000994 | |||
| 1496 | Ga0373927_0125644 | |||
| 1497 | Ga0373927_0247215 | |||
| 1498 | Ga0373933_0001169 | |||
| 1499 | Ga0373933_0011184 | |||
| 1500 | Ga0373933_0048350 | |||
| 1501 | Ga0373933_0056238 | |||
| 1502 | Ga0373947_0000084 | |||
| 1503 | Ga0373947_0000874 | |||
| 1504 | Ga0373947_0179277 | |||
| 1505 | Ga0373947_0338826 | |||
| 1506 | Ga0373937_0003379 | |||
| 1507 | Ga0373937_0015326 | |||
| 1508 | Ga0373937_0027230 | |||
| 1509 | Ga0373937_0029009 | |||
| 1510 | Ga0373937_0029562 | |||
| 1511 | Ga0373937_0351105 | |||
| 1512 | Ga0373937_0457683 | |||
| 1513 | Ga0373925_0002271 | |||
| 1514 | Ga0373925_0009697 | |||
| 1515 | Ga0373925_0097726 | |||
| 1516 | Ga0373925_0105792 | |||
| 1517 | Ga0373925_0155420 | |||
| 1518 | Ga0373925_0499589 | |||
| 1519 | Ga0395899_0018964 | |||
| 1520 | Ga0395899_0363665 | |||
| 1521 | Ga0395900_0013490 | |||
| 1522 | Ga0395900_0033443 | |||
| 1523 | Ga0395900_0265905 | |||
| 1524 | Ga0395898_0002017 | |||
| 1525 | Ga0395898_0019431 | |||
| 1526 | Ga0395898_0070625 | |||
| 1527 | Ga0395901_0033083 | |||
| 1528 | Ga0395901_0040672 | |||
| 1529 | Ga0395901_0731074 | |||
| 1530 | Ga0436365_1084775 | |||
| 1531 | Ga0436365_1446426 | |||
| 1532 | Ga0436365_1906059 | |||
| 1533 | Ga0439435_0051813 | |||
| 1534 | Ga0451577_0257160 | |||
| 1535 | Ga0466963_0011264 | |||
| 1536 | Ga0453684_0114945 | |||
| 1537 | Ga0466957_0444620 | |||
| 1538 | Ga0451576_0047663 | |||
| 1539 | Ga0466958_0069110 | |||
| 1540 | Ga0466967_0001558 | |||
| 1541 | Ga0495617_008848 | |||
| 1542 | Ga0495592_0010591 | |||
| 1543 | Ga0495592_0012448 | |||
| 1544 | Ga0495592_0015983 | |||
| 1545 | Ga0495603_0001529 | |||
| 1546 | Ga0495603_0084857 | |||
| 1547 | Ga0495629_0001129 | |||
| 1548 | Ga0495629_0140647 | |||
| 1549 | Ga0495629_0181730 | |||
| 1550 | Ga0495641_0009864 | |||
| 1551 | Ga0495641_0121583 | |||
| 1552 | Ga0495651_0000565 | |||
| 1553 | Ga0495651_0005013 | |||
| 1554 | Ga0495651_0012172 | |||
| 1555 | Ga0495651_0248990 | |||
| 1556 | Ga0495653_0020000 | |||
| 1557 | Ga0495653_0080969 | |||
| 1558 | Ga0495653_0083117 | |||
| 1559 | Ga0495653_0106269 | |||
| 1560 | Ga0495580_0014617 | |||
| 1561 | Ga0495580_0081545 | |||
| 1562 | Ga0495582_0003684 | |||
| 1563 | Ga0495582_0106862 | |||
| 1564 | Ga0495639_0034974 | |||
| 1565 | Ga0495639_0061948 | |||
| 1566 | Ga0495662_0012418 | |||
| 1567 | Ga0495662_0017919 | |||
| 1568 | Ga0495664_0000810 | |||
| 1569 | Ga0495664_0005186 | |||
| 1570 | Ga0495664_0005968 | |||
| 1571 | Ga0495664_0016079 | |||
| 1572 | Ga0495584_0011215 | |||
| 1573 | Ga0495584_0052830 | |||
| 1574 | Ga0495585_0002467 | |||
| 1575 | Ga0495594_0031402 | |||
| 1576 | Ga0495594_0040820 | |||
| 1577 | Ga0495607_0004861 | |||
| 1578 | Ga0495583_0034275 | |||
| 1579 | Ga0495608_0003844 | |||
| 1580 | Ga0495608_0021633 | |||
| 1581 | Ga0495608_0052610 | |||
| 1582 | Ga0495608_0258057 | |||
| 1583 | Ga0495618_0000917 | |||
| 1584 | Ga0495618_0001056 | |||
| 1585 | Ga0495618_0139377 | |||
| 1586 | Ga0495618_0141972 | |||
| 1587 | Ga0495628_0004353 | |||
| 1588 | Ga0495628_0007281 | |||
| 1589 | Ga0495628_0024488 | |||
| 1590 | Ga0495628_0102206 | |||
| 1591 | Ga0495630_0002361 | |||
| 1592 | Ga0495630_0037747 | |||
| 1593 | Ga0495630_0104139 | |||
| 1594 | Ga0495631_0082807 | |||
| 1595 | Ga0495644_0000977 | |||
| 1596 | Ga0495663_0008995 | |||
| 1597 | Ga0495666_0010301 | |||
| 1598 | Ga0495652_0003321 | |||
| 1599 | Ga0495652_0011095 | |||
| 1600 | Ga0495652_0036189 | |||
| 1601 | Ga0495652_0042569 | |||
| 1602 | Ga0495652_0051988 | |||
| 1603 | Ga0495652_0107167 | |||
| 1604 | Ga0495652_0231048 | |||
| 1605 | Ga0495665_0010372 | |||
| 1606 | Ga0495665_0027263 | |||
| 1607 | Ga0495665_0033062 | |||
| 1608 | Ga0495665_0054425 | |||
| 1609 | Ga0495640_0015820 | |||
| 1610 | Ga0495640_0071285 | |||
| 1611 | Ga0495640_0186056 | |||
| 1612 | Ga0495587_0002666 | |||
| 1613 | Ga0495587_0086202 | |||
| 1614 | Ga0495645_0001019 | |||
| 1615 | Ga0495645_0001763 | |||
| 1616 | Ga0495622_0022047 | |||
| 1617 | Ga0495633_0021747 | |||
| 1618 | Ga0495667_0000256 | |||
| 1619 | Ga0495667_0003202 | |||
| 1620 | Ga0495667_0004500 | |||
| 1621 | Ga0495667_0051698 | |||
| 1622 | Ga0495667_0080082 | |||
| 1623 | Ga0495667_0111204 | |||
| 1624 | Ga0495656_0002804 | |||
| 1625 | Ga0495634_0002529 | |||
| 1626 | Ga0495634_0085794 | |||
| 1627 | Ga0495634_0099557 | |||
| 1628 | Ga0495634_0325765 | |||
| 1629 | Ga0495611_0006278 | |||
| 1630 | Ga0495635_0001674 | |||
| 1631 | Ga0495635_0006462 | |||
| 1632 | Ga0495635_0055975 | |||
| 1633 | Ga0495635_0063562 | |||
| 1634 | Ga0495635_0175513 | |||
| 1635 | Ga0495659_0002865 | |||
| 1636 | Ga0495661_0046138 | |||
| 1637 | Ga0495588_0040840 | |||
| 1638 | Ga0495657_0002838 | |||
| 1639 | Ga0495657_0008836 | |||
| 1640 | Ga0495657_0041262 | |||
| 1641 | Ga0495599_0014560 | |||
| 1642 | Ga0495599_0015487 | |||
| 1643 | Ga0495599_0052311 | |||
| 1644 | Ga0495599_0093299 | |||
| 1645 | Ga0495623_0006304 | |||
| 1646 | Ga0495623_0102325 | |||
| 1647 | Ga0495623_0150627 | |||
| 1648 | Ga0495646_0001535 | |||
| 1649 | Ga0495646_0003056 | |||
| 1650 | Ga0495646_0144578 | |||
| 1651 | Ga0495647_0012134 | |||
| 1652 | Ga0495647_0027866 | |||
| 1653 | Ga0495658_0007273 | |||
| 1654 | Ga0495658_0027556 | |||
| 1655 | Ga0495658_0071135 | |||
| 1656 | Ga0495613_0012997 | |||
| 1657 | Ga0495613_0082469 | |||
| 1658 | Ga0495613_0116360 | |||
| 1659 | Ga0495624_0021752 | |||
| 1660 | Ga0495624_0048734 | |||
| 1661 | Ga0495670_0000385 | |||
| 1662 | Ga0495600_0008913 | |||
| 1663 | Ga0495600_0016927 | |||
| 1664 | Ga0495600_0035138 | |||
| 1665 | Ga0495581_0001980 | |||
| 1666 | Ga0495581_0038963 | |||
| 1667 | Ga0495581_0052331 | |||
| 1668 | Ga0495604_0035932 | |||
| 1669 | Ga0495604_0059042 | |||
| 1670 | Ga0495604_0061187 | |||
| 1671 | Ga0495604_0085385 | |||
| 1672 | Ga0495674_0001984 | |||
| 1673 | Ga0495674_0004803 | |||
| 1674 | Ga0495674_0097401 | |||
| 1675 | Ga0495674_0162477 | |||
| 1676 | Ga0495674_0238686 | |||
| 1677 | Ga0495674_0538587 | |||
| 1678 | Ga0495676_0097796 | |||
| 1679 | Ga0495680_0005186 | |||
| 1680 | Ga0495680_0005564 | |||
| 1681 | Ga0495680_0013978 | |||
| 1682 | Ga0495680_0091074 | |||
| 1683 | Ga0495680_0096580 | |||
| 1684 | Ga0495675_0000532 | |||
| 1685 | Ga0495675_0155300 | |||
| 1686 | Ga0495677_0075446 | |||
| 1687 | Ga0495684_0003231 | |||
| 1688 | Ga0495684_0020948 | |||
| 1689 | Ga0495684_0025239 | |||
| 1690 | Ga0495684_0025619 | |||
| 1691 | Ga0495684_0083439 | |||
| 1692 | Ga0495684_0089038 | |||
| 1693 | Ga0495593_0016546 | |||
| 1694 | Ga0495593_0064928 | |||
| 1695 | Ga0495593_0154936 | |||
| 1696 | Ga0495593_0235278 | |||
| 1697 | Ga0495602_0003582 | |||
| 1698 | Ga0495602_0005750 | |||
| 1699 | Ga0495614_0081315 | |||
| 1700 | Ga0496100_0009690 | |||
| 1701 | Ga0496100_0070886 | |||
| 1702 | Ga0496101_0002148 | |||
| 1703 | Ga0496101_0016521 | |||
| 1704 | Ga0496101_0474639 | |||
| 1705 | Ga0496102_0038521 | |||
| 1706 | Ga0496102_0228210 | |||
| 1707 | Ga0496102_0567603 | |||
| 1708 | Ga0496102_0909528 | |||
| 1709 | Ga0496103_0030585 | |||
| 1710 | Ga0496103_0106174 | |||
| 1711 | Ga0496104_0000575 | |||
| 1712 | Ga0496104_0095591 | |||
| 1713 | Ga0496104_0297870 | |||
| 1714 | Ga0496104_0375378 | |||
| 1715 | Ga0496105_0012737 | |||
| 1716 | Ga0496105_0048584 | |||
| 1717 | Ga0496105_0116922 | |||
| 1718 | Ga0496105_0408681 | |||
| 1719 | Ga0496106_0015507 | |||
| 1720 | Ga0496106_0025013 | |||
| 1721 | Ga0496106_0238314 | |||
| 1722 | Ga0496107_0004066 | |||
| 1723 | Ga0496107_0274991 | |||
| 1724 | Ga0496108_0017973 | |||
| 1725 | Ga0496108_0040534 | |||
| 1726 | Ga0496108_0054196 | |||
| 1727 | Ga0496108_0427739 | |||
| 1728 | Ga0496109_0004277 | |||
| 1729 | Ga0496109_0026022 | |||
| 1730 | Ga0496109_0043968 | |||
| 1731 | Ga0496109_0064398 | |||
| 1732 | Ga0496109_0178818 | |||
| 1733 | Ga0496110_0039711 | |||
| 1734 | Ga0496110_0042792 | |||
| 1735 | Ga0496110_0082037 | |||
| 1736 | Ga0496111_0067953 | |||
| 1737 | Ga0496111_0076128 | |||
| 1738 | Ga0496111_0137455 | |||
| 1739 | Ga0496112_0022849 | |||
| 1740 | Ga0496112_0027238 | |||
| 1741 | Ga0496112_0076436 | |||
| 1742 | Ga0496112_0373305 | |||
| 1743 | Ga0496112_0555739 | |||
| 1744 | Ga0496113_0024623 | |||
| 1745 | Ga0496113_0035969 | |||
| 1746 | Ga0496113_0108250 | |||
| 1747 | Ga0496113_0216578 | |||
| 1748 | Ga0496114_0005575 | |||
| 1749 | Ga0496114_0016691 | |||
| 1750 | Ga0496115_0027862 | |||
| 1751 | Ga0496115_0031167 | |||
| 1752 | Ga0496115_0069516 | |||
| 1753 | Ga0496115_0127538 | |||
| 1754 | Ga0496115_0156486 | |||
| 1755 | Ga0496119_0000906 | |||
| 1756 | Ga0496121_0245841 | |||
| 1757 | Ga0496122_0016749 | |||
| 1758 | Ga0496123_0001118 | |||
| 1759 | Ga0501033_0003913 | |||
| 1760 | Ga0501033_0091848 | |||
| 1761 | Ga0501033_0239233 | |||
| 1762 | Ga0501033_0429803 | |||
| 1763 | Ga0501034_0000516 | |||
| 1764 | Ga0501034_0037478 | |||
| 1765 | Ga0501036_0392257 | |||
| 1766 | Ga0501038_0063990 | |||
| 1767 | Ga0501038_0066609 | |||
| 1768 | Ga0501039_0006041 | |||
| 1769 | Ga0501039_0054336 | |||
| 1770 | Ga0501040_0014268 | |||
| 1771 | Ga0501041_0006521 | |||
| 1772 | Ga0501042_0048779 | |||
| 1773 | Ga0501043_0048654 | |||
| 1774 | Ga0501046_0063893 | |||
| 1775 | Ga0501046_0098596 | |||
| 1776 | Ga0501047_0004478 | |||
| 1777 | Ga0501047_0044782 | |||
| 1778 | Ga0501047_0078933 | |||
| 1779 | Ga0501047_0463921 | |||
| 1780 | Ga0501070_0018727 | |||
| 1781 | Ga0501070_0037859 | |||
| 1782 | Ga0501070_0260332 | |||
| 1783 | Ga0501070_0690068 | |||
| 1784 | Ga0501071_0038665 | |||
| 1785 | Ga0501072_0139806 | |||
| 1786 | Ga0501072_0227857 | |||
| 1787 | Ga0501073_0009746 | |||
| 1788 | Ga0501075_0006847 | |||
| 1789 | Ga0501076_0002990 | |||
| 1790 | Ga0501076_0043052 | |||
| 1791 | Ga0501079_0000379 | |||
| 1792 | Ga0501079_0125498 | |||
| 1793 | Ga0501079_0243350 | |||
| 1794 | Ga0501080_0012910 | |||
| 1795 | Ga0501080_0032326 | |||
| 1796 | Ga0501080_0308225 | |||
| 1797 | Ga0501081_0000033 | |||
| 1798 | Ga0501083_0091167 | |||
| 1799 | Ga0501035_0004436 | |||
| 1800 | Ga0501044_0005860 | |||
| 1801 | Ga0501044_0094254 | |||
| 1802 | Ga0501044_0132508 | |||
| 1803 | Ga0501045_0036136 | |||
| 1804 | nmdc:mga07m45_327029_c1 | |||
| 1805 | nmdc:mga05p37_3041_c1 | |||
| 1806 | nmdc:mga09592_324265_c1 | |||
| 1807 | nmdc:mga09592_5026_c1 | |||
| 1808 | nmdc:mga0qj67_1705_c1 | |||
| 1809 | nmdc:mga0qj67_231261_c1 | |||
| 1810 | nmdc:mga06r32_2163_c1 | |||
| 1811 | nmdc:mga06r32_226428_c1 | |||
| 1812 | nmdc:mga08y16_289_c1 | |||
| 1813 | nmdc:mga08y16_31530_c1 | |||
| 1814 | nmdc:mga0n895_112788_c1 | |||
| 1815 | nmdc:mga0n895_140865_c1 | |||
| 1816 | nmdc:mga0n895_361831_c1 | |||
| 1817 | nmdc:mga0n895_392128_c1 | |||
| 1818 | nmdc:mga0n895_4459_c1 | |||
| 1819 | nmdc:mga0rr50_11469_c1 | |||
| 1820 | nmdc:mga0rr50_141250_c1 | |||
| 1821 | nmdc:mga0rr50_168968_c1 | |||
| 1822 | nmdc:mga0rr50_308633_c1 | |||
| 1823 | nmdc:mga0rr50_576477_c1 | |||
| 1824 | nmdc:mga08x19_198328_c1 | |||
| 1825 | nmdc:mga0a205_17258_c1 | |||
| 1826 | nmdc:mga0a205_249588_c1 | |||
| 1827 | nmdc:mga0a205_3619_c1 | |||
| 1828 | nmdc:mga0a205_733_c2 | |||
| 1829 | Ga0495601_0000418 | |||
| 1830 | Ga0495601_0002208 | |||
| 1831 | Ga0495601_0003992 | |||
| 1832 | Ga0495601_0017457 | |||
| 1833 | Ga0495601_0041803 | |||
| 1834 | Ga0495612_0000666 | |||
| 1835 | Ga0495612_0011282 | |||
| 1836 | Ga0495612_0011744 | |||
| 1837 | Ga0495612_0020362 | |||
| 1838 | Ga0495595_0003514 | |||
| 1839 | Ga0495595_0013087 | |||
| 1840 | Ga0495595_0025852 | |||
| 1841 | Ga0495595_0026794 | |||
| 1842 | Ga0495595_0047076 | |||
| 1843 | Ga0495619_0002359 | |||
| 1844 | Ga0495619_0002566 | |||
| 1845 | Ga0495619_0007346 | |||
| 1846 | Ga0495619_0007524 | |||
| 1847 | Ga0495619_0017182 | |||
| 1848 | Ga0495619_0021147 | |||
| 1849 | Ga0495619_0036672 | |||
| 1850 | Ga0495619_0061266 | |||
| 1851 | Ga0495619_0098848 | |||
| 1852 | Ga0500643_002005 | |||
| 1853 | Ga0500644_0013518 | |||
| 1854 | Ga0500566_0105691 | |||
| 1855 | Ga0500650_0097840 | |||
| 1856 | Ga0500593_035093 | |||
| 1857 | Ga0500594_0047025 | |||
| 1858 | Ga0500595_000002 | |||
| 1859 | Ga0500652_003429 | |||
| 1860 | Ga0500652_154862 | |||
| 1861 | Ga0500616_0000002 | |||
| 1862 | Ga0500645_000086 | |||
| 1863 | Ga0500645_004764 | |||
| 1864 | Ga0501084_0074934 | |||
| 1865 | Ga0501082_0003399 | |||
| 1866 | Ga0501082_0203082 | |||
| 1867 | Ga0501082_0306932 | |||
| 1868 | Ga0501082_0439431 | |||
| 1869 | Ga0466962_0080838 | |||
| 1870 | Ga0530510_0167878 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g0w-assembly1.cif.gz_A | crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution | 0.8866 | 8 | 275 |
| 5hmq-assembly3.cif.gz_E | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.879 | 7 | 273 |
| 5hmq-assembly1.cif.gz_C | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.877 | 7 | 273 |
| 5hmq-assembly3.cif.gz_D | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8655 | 7 | 273 |
| 5hmq-assembly2.cif.gz_B | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8653 | 7 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g0wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8783 | 8 | 275 | 3.20.20.150 |
| af_P45541_1_270_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.837 | 6 | 268 | 3.20.20.150 |
| 3qc0A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8308 | 7 | 269 | 3.20.20.150 |
| 2g0wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8254 | 8 | 275 | 3.20.20.150 |
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8219 | 8 | 279 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J5GCL0-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.99 | 2 | 279 |
GO:0016853
|
| AF-A0A7C3JPR9-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.9853 | 7 | 273 |
GO:0016853
|
| AF-A0A5J5GCL0-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.983 | 2 | 279 |
GO:0016853
|
| AF-A0A537N724-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.9792 | 3 | 241 |
GO:0016853
|
| AF-A0A2E9I2B3-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.9776 | 3 | 273 |
|