F486181

General Info

Members Datasets Scaffolds Average Seq Length
935 404 1870 106

Family's Representative Sequence

Representative Sequence 3300059477|Ga0587084_011725|Ga0587084_011725_444_761
Length 105
Sequence MAKKQAAAVDNRHSDVIVAPHITEKSTMVSEHNAVVFKVARDATKPEIKAAVEALFPSVKVTGVNTIVQKGKTKKWKGKPYTRSDVKKAIVTLADGDQIDVTQGI

Samples

Sample ID Description Type Environment
1 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
302 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
326 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
327 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
328 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
329 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
330 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
331 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
332 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
333 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
339 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
340 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
341 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
342 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
404 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 12.09
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 3.21
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587084_011725 3300059477 Bacteria 1174
2 JGI24034J14986_101847 3300001432 Bacteria 1154
3 JGI24741J21665_1001920 3300001915 Bacteria 5620
4 JGI24741J21665_1015360 3300001915 Bacteria 1265
5 JGI24752J21851_1000007 3300001976 Bacteria 24778
6 JGI24747J21853_1005899 3300001978 Bacteria 1143
7 JGI24740J21852_10015856 3300001979 Bacteria 2738
8 JGI24739J22299_10134605 3300001989 Bacteria 734
9 JGI24737J22298_10043760 3300001990 Bacteria 1370
10 JGI24737J22298_10139036 3300001990 Bacteria 717
11 JGI24735J21928_10011436 3300002067 Bacteria 2813
12 JGI24750J21931_1000298 3300002070 Bacteria 8551
13 JGI24748J21848_1000070 3300002074 Bacteria 36407
14 JGI24748J21848_1008969 3300002074 Bacteria 1178
15 JGI24749J21850_1000118 3300002076 Bacteria 13310
16 JGI24033J26618_1044558 3300002155 Bacteria 625
17 JGI24034J26672_10000038 3300002239 Bacteria 75372
18 JGI24034J26672_10014302 3300002239 Bacteria 1210
19 JGI24034J26672_10049632 3300002239 Bacteria 719
20 JGI24742J22300_10001588 3300002244 Bacteria 3613
21 JGI24742J22300_10003980 3300002244 Bacteria 2410
22 JGI24751J29686_10010345 3300002459 Bacteria 1922
23 JGI25165J46597_1000023 3300003214 Bacteria 338873
24 JGI25153J46596_10000173 3300003215 Bacteria 64195
25 Ga0032354_1119435 3300003693 Bacteria 542
26 Ga0055525_1000012 3300003759 Bacteria 486564
27 Ga0055542_1001518 3300003762 Bacteria 11230
28 Ga0055529_1000014 3300003763 Bacteria 367283
29 Ga0055530_10015010 3300003791 Bacteria 2552
30 Ga0055531_10032620 3300003794 Bacteria 1697
31 Ga0055531_10100522 3300003794 Bacteria 595
32 Ga0058860_11860095 3300004801 Bacteria 568
33 Ga0065712_10100550 3300005290 Bacteria 2059
34 Ga0065712_10213194 3300005290 Bacteria 1065
35 Ga0065712_10339614 3300005290 Bacteria 801
36 Ga0065715_10029418 3300005293 Bacteria 1977
37 Ga0065715_10051509 3300005293 Bacteria 992
38 Ga0065715_10448200 3300005293 Bacteria 829
39 Ga0065715_10565818 3300005293 Bacteria 730
40 Ga0065715_10598461 3300005293 Bacteria 687
41 Ga0065707_10525541 3300005295 Bacteria 739
42 Ga0070658_10034849 3300005327 Bacteria 4051
43 Ga0070658_10354895 3300005327 Bacteria 1255
44 Ga0070658_10470961 3300005327 Bacteria 1083
45 Ga0070658_10488853 3300005327 Bacteria 1062
46 Ga0070658_10739176 3300005327 Bacteria 854
47 Ga0070658_10790314 3300005327 Bacteria 824
48 Ga0070658_11019730 3300005327 Bacteria 720
49 Ga0070658_11444257 3300005327 Bacteria 597
50 Ga0070676_10033009 3300005328 Bacteria 2968
51 Ga0070676_10585954 3300005328 Bacteria 802
52 Ga0070676_10770661 3300005328 Bacteria 708
53 Ga0070683_100438274 3300005329 Bacteria 1247
54 Ga0070683_100974924 3300005329 Bacteria 814
55 Ga0070683_101634463 3300005329 Bacteria 619
56 Ga0070690_100000097 3300005330 Bacteria 44576
57 Ga0070670_100010675 3300005331 Bacteria 7846
58 Ga0070670_100034259 3300005331 Bacteria 4370
59 Ga0070670_100161717 3300005331 Bacteria 1940
60 Ga0070670_100436289 3300005331 Bacteria 1159
61 Ga0070677_10037474 3300005333 Bacteria 1892
62 Ga0070677_10062061 3300005333 Bacteria 1544
63 Ga0070677_10074850 3300005333 Bacteria 1433
64 Ga0068869_101112408 3300005334 Bacteria 692
65 Ga0070666_10000004 3300005335 Bacteria 372098
66 Ga0070666_10191087 3300005335 Bacteria 1439
67 Ga0070666_10490911 3300005335 Bacteria 890
68 Ga0070680_100363294 3300005336 Bacteria 1231
69 Ga0070682_100379432 3300005337 Bacteria 1063
70 Ga0070682_101020532 3300005337 Bacteria 688
71 Ga0068868_100049745 3300005338 Bacteria 3290
72 Ga0070660_100096538 3300005339 Bacteria 2337
73 Ga0070660_100188024 3300005339 Bacteria 1672
74 Ga0070660_100205715 3300005339 Bacteria 1597
75 Ga0070660_100390605 3300005339 Bacteria 1149
76 Ga0070660_100419886 3300005339 Bacteria 1107
77 Ga0070660_100682995 3300005339 Bacteria 860
78 Ga0070660_101060484 3300005339 Bacteria 685
79 Ga0070689_100106270 3300005340 Bacteria 2227
80 Ga0070687_100263328 3300005343 Bacteria 1077
81 Ga0070661_100033195 3300005344 Bacteria 3738
82 Ga0070661_100101205 3300005344 Bacteria 2143
83 Ga0070661_100122997 3300005344 Bacteria 1944
84 Ga0070661_100353376 3300005344 Bacteria 1153
85 Ga0070661_100410927 3300005344 Bacteria 1071
86 Ga0070661_100763169 3300005344 Bacteria 791
87 Ga0070661_101222862 3300005344 Bacteria 629
88 Ga0070692_10047048 3300005345 Bacteria 2231
89 Ga0070668_100078782 3300005347 Bacteria 2578
90 Ga0070668_100164638 3300005347 Bacteria 1801
91 Ga0070668_100367114 3300005347 Bacteria 1222
92 Ga0070668_100773108 3300005347 Bacteria 851
93 Ga0070669_100000296 3300005353 Bacteria 39004
94 Ga0070669_100177439 3300005353 Bacteria 1665
95 Ga0070669_100200612 3300005353 Bacteria 1569
96 Ga0070669_100285920 3300005353 Bacteria 1322
97 Ga0070669_100485009 3300005353 Bacteria 1023
98 Ga0070669_100971176 3300005353 Bacteria 728
99 Ga0070669_101061793 3300005353 Bacteria 696
100 Ga0070669_101128734 3300005353 Bacteria 676
101 Ga0070669_101391820 3300005353 Bacteria 609
102 Ga0070675_100190962 3300005354 Bacteria 1775
103 Ga0070675_100775834 3300005354 Bacteria 875
104 Ga0070675_100929592 3300005354 Bacteria 797
105 Ga0070671_100012607 3300005355 Bacteria 6811
106 Ga0070671_100023714 3300005355 Bacteria 5023
107 Ga0070671_100203448 3300005355 Bacteria 1679
108 Ga0070671_100258242 3300005355 Bacteria 1481
109 Ga0070671_100402823 3300005355 Bacteria 1170
110 Ga0070671_100490132 3300005355 Bacteria 1057
111 Ga0070674_100112061 3300005356 Bacteria 2005
112 Ga0070674_100242117 3300005356 Bacteria 1413
113 Ga0070673_100127669 3300005364 Bacteria 2129
114 Ga0070673_100880830 3300005364 Bacteria 829
115 Ga0070688_100002383 3300005365 Bacteria 9493
116 Ga0070659_100033177 3300005366 Bacteria 4008
117 Ga0070659_100235299 3300005366 Bacteria 1514
118 Ga0070659_100242738 3300005366 Bacteria 1491
119 Ga0070659_100278332 3300005366 Bacteria 1392
120 Ga0070659_101135244 3300005366 Bacteria 690
121 Ga0070659_101152500 3300005366 Bacteria 684
122 Ga0070659_101427295 3300005366 Bacteria 616
123 Ga0070667_100061703 3300005367 Bacteria 3174
124 Ga0070667_100200068 3300005367 Bacteria 1772
125 Ga0070667_102150601 3300005367 Bacteria 526
126 Ga0070714_100025886 3300005435 Bacteria 4845
127 Ga0070714_100507601 3300005435 Bacteria 1150
128 Ga0070713_100239005 3300005436 Bacteria 1654
129 Ga0070700_101543717 3300005441 Bacteria 566
130 Ga0070663_100080949 3300005455 Bacteria 2386
131 Ga0070663_100751747 3300005455 Bacteria 832
132 Ga0070663_101348259 3300005455 Bacteria 630
133 Ga0070678_100017885 3300005456 Bacteria 4578
134 Ga0070678_100403125 3300005456 Bacteria 1189
135 Ga0070662_100046495 3300005457 Bacteria 3119
136 Ga0070662_100064573 3300005457 Bacteria 2681
137 Ga0070662_100483155 3300005457 Bacteria 1031
138 Ga0070681_10807026 3300005458 Bacteria 856
139 Ga0070681_10847619 3300005458 Bacteria 832
140 Ga0068867_100321187 3300005459 Bacteria 1283
141 Ga0070685_10000262 3300005466 Bacteria 33728
142 Ga0070679_100226535 3300005530 Bacteria 1829
143 Ga0070679_100321123 3300005530 Bacteria 1498
144 Ga0070679_101542479 3300005530 Bacteria 611
145 Ga0070684_100653704 3300005535 Bacteria 979
146 Ga0070684_101371812 3300005535 Bacteria 665
147 Ga0068853_100079177 3300005539 Bacteria 2873
148 Ga0068853_100151532 3300005539 Bacteria 2087
149 Ga0068853_100535457 3300005539 Bacteria 1108
150 Ga0068853_100674894 3300005539 Bacteria 984
151 Ga0068853_102312984 3300005539 Bacteria 521
152 Ga0070672_100207425 3300005543 Bacteria 1640
153 Ga0070686_100000061 3300005544 Bacteria 83811
154 Ga0070696_100112118 3300005546 Bacteria 1965
155 Ga0070665_100000004 3300005548 Bacteria 785500
156 Ga0070665_100009730 3300005548 Bacteria 9719
157 Ga0070665_100280359 3300005548 Bacteria 1668
158 Ga0070665_100339978 3300005548 Bacteria 1506
159 Ga0070665_101500274 3300005548 Bacteria 683
160 Ga0068855_100616645 3300005563 Bacteria 1168
161 Ga0070664_100101975 3300005564 Bacteria 2496
162 Ga0070664_100216063 3300005564 Bacteria 1714
163 Ga0070664_100325070 3300005564 Bacteria 1394
164 Ga0070664_100520843 3300005564 Bacteria 1097
165 Ga0070664_100749325 3300005564 Bacteria 912
166 Ga0070664_100898377 3300005564 Bacteria 830
167 Ga0070664_101327312 3300005564 Bacteria 679
168 Ga0070664_101808126 3300005564 Bacteria 579
169 Ga0070664_102074491 3300005564 Bacteria 539
170 Ga0068857_100226553 3300005577 Bacteria 1708
171 Ga0068857_100686033 3300005577 Bacteria 972
172 Ga0068857_100808385 3300005577 Bacteria 895
173 Ga0068857_101067976 3300005577 Bacteria 779
174 Ga0068854_100063035 3300005578 Bacteria 2690
175 Ga0068854_100217907 3300005578 Bacteria 1509
176 Ga0068856_100050714 3300005614 Bacteria 4091
177 Ga0068856_100150227 3300005614 Bacteria 2338
178 Ga0068856_102249078 3300005614 Bacteria 554
179 Ga0068852_100218546 3300005616 Bacteria 1811
180 Ga0068852_100329391 3300005616 Bacteria 1485
181 Ga0068852_100931418 3300005616 Bacteria 886
182 Ga0068852_100947817 3300005616 Bacteria 879
183 Ga0068859_100001416 3300005617 Bacteria 24328
184 Ga0068859_100010520 3300005617 Bacteria 9310
185 Ga0068859_100275602 3300005617 Bacteria 1774
186 Ga0068859_100839699 3300005617 Bacteria 1005
187 Ga0068859_101860805 3300005617 Bacteria 665
188 Ga0068864_100002567 3300005618 Bacteria 14987
189 Ga0068864_101049438 3300005618 Bacteria 810
190 Ga0068861_100000040 3300005719 Bacteria 59725
191 Ga0068861_100002842 3300005719 Bacteria 11386
192 Ga0068861_101088385 3300005719 Bacteria 768
193 Ga0068851_10011439 3300005834 Bacteria 4162
194 Ga0068851_10360727 3300005834 Bacteria 847
195 Ga0068851_10423600 3300005834 Bacteria 786
196 Ga0068870_10272613 3300005840 Bacteria 1058
197 Ga0068870_11021802 3300005840 Bacteria 591
198 Ga0068863_100000013 3300005841 Bacteria 220357
199 Ga0068863_100909232 3300005841 Bacteria 881
200 Ga0068858_100000664 3300005842 Bacteria 35973
201 Ga0068858_100008722 3300005842 Bacteria 9734
202 Ga0068860_100000009 3300005843 Bacteria 372089
203 Ga0068860_100007808 3300005843 Bacteria 10684
204 Ga0068860_100544238 3300005843 Bacteria 1163
205 Ga0068862_100001446 3300005844 Bacteria 21877
206 Ga0081539_10018995 3300005985 Bacteria 4732
207 Ga0070717_11649270 3300006028 Bacteria 581
208 Ga0075367_10454611 3300006178 Bacteria 812
209 Ga0097621_100066302 3300006237 Bacteria 2973
210 Ga0075370_10375338 3300006353 Bacteria 851
211 Ga0075370_10388167 3300006353 Bacteria 837
212 Ga0068871_100064899 3300006358 Bacteria 2990
213 Ga0075430_101382922 3300006846 Bacteria 579
214 Ga0068865_100650878 3300006881 Bacteria 896
215 Ga0068865_101545290 3300006881 Bacteria 596
216 Ga0097620_100001416 3300006931 Bacteria 24328
217 Ga0097620_100010519 3300006931 Bacteria 9310
218 Ga0097620_100275611 3300006931 Bacteria 1774
219 Ga0097620_100839823 3300006931 Bacteria 1005
220 Ga0097620_101860871 3300006931 Bacteria 665
221 Ga0105250_10073036 3300009092 Bacteria 1387
222 Ga0105240_10206568 3300009093 Bacteria 2298
223 Ga0105240_10700183 3300009093 Bacteria 1106
224 Ga0105245_12705906 3300009098 Bacteria 549
225 Ga0105243_10003106 3300009148 Bacteria 13657
226 Ga0105243_10737663 3300009148 Bacteria 964
227 Ga0105241_12401405 3300009174 Bacteria 526
228 Ga0105241_12609145 3300009174 Bacteria 508
229 Ga0105248_10023935 3300009177 Bacteria 6788
230 Ga0105248_10316717 3300009177 Bacteria 1757
231 Ga0105248_10573441 3300009177 Bacteria 1273
232 Ga0105248_11013124 3300009177 Bacteria 938
233 Ga0105248_11284805 3300009177 Bacteria 828
234 Ga0105237_12029783 3300009545 Bacteria 584
235 Ga0105238_10931313 3300009551 Bacteria 888
236 Ga0105238_11034238 3300009551 Bacteria 843
237 Ga0105238_11508862 3300009551 Bacteria 701
238 Ga0105249_10000006 3300009553 Bacteria 354449
239 Ga0105148_117490 3300009978 Bacteria 569
240 Ga0105239_10090567 3300010375 Bacteria 3374
241 Ga0105239_13502082 3300010375 Bacteria 510
242 Ga0105246_10099608 3300011119 Bacteria 2113
243 Ga0157317_1000418 3300012475 Bacteria 1780
244 Ga0157327_1023822 3300012512 Bacteria 713
245 Ga0157373_10425298 3300013100 Bacteria 954
246 Ga0157373_10426491 3300013100 Bacteria 952
247 Ga0157373_10501180 3300013100 Bacteria 877
248 Ga0157373_11121058 3300013100 Bacteria 591
249 Ga0157371_10000059 3300013102 Bacteria 170541
250 Ga0157371_10123034 3300013102 Bacteria 1845
251 Ga0157371_11159258 3300013102 Bacteria 594
252 Ga0157370_10024969 3300013104 Bacteria 5914
253 Ga0157370_11334238 3300013104 Bacteria 646
254 Ga0157370_11633359 3300013104 Bacteria 579
255 Ga0157369_10034063 3300013105 Bacteria 5592
256 Ga0157369_10552266 3300013105 Bacteria 1190
257 Ga0157369_11190963 3300013105 Bacteria 778
258 Ga0157369_11220717 3300013105 Bacteria 767
259 Ga0157374_10104316 3300013296 Bacteria 2722
260 Ga0157374_10414168 3300013296 Bacteria 1346
261 Ga0157378_10232281 3300013297 Bacteria 1758
262 Ga0157378_10273729 3300013297 Bacteria 1625
263 Ga0163162_10034071 3300013306 Bacteria 5066
264 Ga0163162_10072394 3300013306 Bacteria 3501
265 Ga0163162_10109281 3300013306 Bacteria 2862
266 Ga0163162_10789338 3300013306 Bacteria 1067
267 Ga0163162_11697639 3300013306 Bacteria 721
268 Ga0157372_10308225 3300013307 Bacteria 1842
269 Ga0157372_10659289 3300013307 Bacteria 1218
270 Ga0157372_10774507 3300013307 Bacteria 1115
271 Ga0157372_11061209 3300013307 Bacteria 938
272 Ga0157372_11111232 3300013307 Bacteria 914
273 Ga0157375_10657450 3300013308 Bacteria 1204
274 Ga0157375_12866978 3300013308 Bacteria 576
275 Ga0157375_13433680 3300013308 Bacteria 527
276 Ga0157375_13535204 3300013308 Bacteria 520
277 Ga0163163_10019994 3300014325 Bacteria 6300
278 Ga0157380_10116019 3300014326 Bacteria 2259
279 Ga0157380_10235709 3300014326 Bacteria 1647
280 Ga0157380_11993450 3300014326 Bacteria 642
281 Ga0157379_10001735 3300014968 Bacteria 18043
282 Ga0157379_10003973 3300014968 Bacteria 12609
283 Ga0163161_10000208 3300017792 Bacteria 53837
284 Ga0163161_10222559 3300017792 Bacteria 1462
285 Ga0163161_10441763 3300017792 Bacteria 1050
286 Ga0163161_10751429 3300017792 Bacteria 816
287 Ga0197907_10820967 3300020069 Bacteria 835
288 Ga0197907_10990692 3300020069 Bacteria 515
289 Ga0206355_1017096 3300020076 Bacteria 1277
290 Ga0206352_10437088 3300020078 Bacteria 792
291 Ga0213876_10166713 3300021384 Bacteria 1172
292 Ga0213875_10001626 3300021388 Bacteria 14182
293 Ga0207672_1001700 3300025223 Bacteria 1545
294 Ga0209674_102700 3300025226 Bacteria 3641
295 Ga0209563_100030 3300025230 Bacteria 489259
296 Ga0207427_100986 3300025231 Bacteria 12010
297 Ga0209026_1000352 3300025250 Bacteria 43432
298 Ga0209148_1000011 3300025254 Bacteria 1196503
299 Ga0209759_1033090 3300025256 Bacteria 985
300 Ga0209233_1000003 3300025261 Bacteria 1607366
301 Ga0209455_1000006 3300025272 Bacteria 1196503
302 Ga0209758_1000001 3300025297 Bacteria 1981790
303 Ga0209050_1021913 3300025298 Bacteria 2308
304 Ga0209257_1000577 3300025304 Bacteria 61710
305 Ga0209257_1000597 3300025304 Bacteria 59900
306 Ga0209257_1006247 3300025304 Bacteria 7796
307 Ga0207697_10101229 3300025315 Bacteria 1228
308 Ga0207697_10161798 3300025315 Bacteria 977
309 Ga0207697_10172294 3300025315 Bacteria 947
310 Ga0207656_10002150 3300025321 Bacteria 6586
311 Ga0207656_10043235 3300025321 Bacteria 1921
312 Ga0207682_10073759 3300025893 Bacteria 1450
313 Ga0207682_10092570 3300025893 Bacteria 1312
314 Ga0207682_10487689 3300025893 Bacteria 584
315 Ga0207680_10000010 3300025903 Bacteria 414170
316 Ga0207680_10225072 3300025903 Bacteria 1287
317 Ga0207680_10490110 3300025903 Bacteria 875
318 Ga0207645_10026399 3300025907 Bacteria 3754
319 Ga0207645_10174952 3300025907 Bacteria 1408
320 Ga0207645_10567128 3300025907 Bacteria 770
321 Ga0207645_10728755 3300025907 Bacteria 674
322 Ga0207643_10178103 3300025908 Bacteria 1285
323 Ga0207643_10411592 3300025908 Bacteria 856
324 Ga0207705_10000511 3300025909 Bacteria 33036
325 Ga0207705_10001825 3300025909 Bacteria 16767
326 Ga0207705_10026545 3300025909 Bacteria 4130
327 Ga0207705_10207656 3300025909 Bacteria 1485
328 Ga0207705_10460666 3300025909 Bacteria 986
329 Ga0207654_11246107 3300025911 Bacteria 542
330 Ga0207707_10362538 3300025912 Bacteria 1248
331 Ga0207707_10757610 3300025912 Bacteria 811
332 Ga0207695_10003496 3300025913 Bacteria 22050
333 Ga0207695_11296827 3300025913 Bacteria 609
334 Ga0207671_10004021 3300025914 Bacteria 14287
335 Ga0207660_10884083 3300025917 Bacteria 729
336 Ga0207662_10431934 3300025918 Bacteria 898
337 Ga0207662_10438171 3300025918 Bacteria 892
338 Ga0207662_10741161 3300025918 Bacteria 690
339 Ga0207662_10813593 3300025918 Bacteria 659
340 Ga0207657_10061226 3300025919 Bacteria 3228
341 Ga0207657_10132430 3300025919 Bacteria 2043
342 Ga0207657_10231765 3300025919 Bacteria 1477
343 Ga0207657_10348096 3300025919 Bacteria 1169
344 Ga0207657_10587063 3300025919 Bacteria 870
345 Ga0207657_10671567 3300025919 Bacteria 806
346 Ga0207649_10363671 3300025920 Bacteria 1074
347 Ga0207649_10366653 3300025920 Bacteria 1070
348 Ga0207649_11415093 3300025920 Bacteria 550
349 Ga0207652_10226817 3300025921 Bacteria 1684
350 Ga0207652_10573323 3300025921 Bacteria 1013
351 Ga0207681_10000197 3300025923 Bacteria 48475
352 Ga0207681_10104132 3300025923 Bacteria 2052
353 Ga0207681_10226635 3300025923 Bacteria 1449
354 Ga0207681_10446773 3300025923 Bacteria 1051
355 Ga0207681_10788222 3300025923 Bacteria 793
356 Ga0207694_10054679 3300025924 Bacteria 3097
357 Ga0207694_10417758 3300025924 Bacteria 1117
358 Ga0207650_10001567 3300025925 Bacteria 16344
359 Ga0207650_10102411 3300025925 Bacteria 2206
360 Ga0207650_10181519 3300025925 Bacteria 1677
361 Ga0207659_10002689 3300025926 Bacteria 10592
362 Ga0207659_10035680 3300025926 Bacteria 3440
363 Ga0207659_10521695 3300025926 Bacteria 1007
364 Ga0207659_10830814 3300025926 Bacteria 794
365 Ga0207700_10528921 3300025928 Bacteria 1045
366 Ga0207664_10356883 3300025929 Bacteria 1294
367 Ga0207644_10005181 3300025931 Bacteria 8514
368 Ga0207644_10008230 3300025931 Bacteria 6831
369 Ga0207644_10261373 3300025931 Bacteria 1384
370 Ga0207690_10003585 3300025932 Bacteria 9247
371 Ga0207690_10063154 3300025932 Bacteria 2524
372 Ga0207690_10596524 3300025932 Bacteria 901
373 Ga0207690_11047541 3300025932 Bacteria 679
374 Ga0207690_11379996 3300025932 Bacteria 589
375 Ga0207706_10041209 3300025933 Bacteria 4094
376 Ga0207706_10079122 3300025933 Bacteria 2891
377 Ga0207706_10141807 3300025933 Bacteria 2114
378 Ga0207706_10178089 3300025933 Bacteria 1868
379 Ga0207686_10324797 3300025934 Bacteria 1151
380 Ga0207709_10000246 3300025935 Bacteria 66685
381 Ga0207670_10087907 3300025936 Bacteria 2190
382 Ga0207669_10190199 3300025937 Bacteria 1480
383 Ga0207669_10390138 3300025937 Bacteria 1087
384 Ga0207704_11679469 3300025938 Bacteria 546
385 Ga0207691_10036228 3300025940 Bacteria 4571
386 Ga0207691_10040894 3300025940 Bacteria 4282
387 Ga0207691_10201747 3300025940 Bacteria 1730
388 Ga0207711_10006762 3300025941 Bacteria 9642
389 Ga0207711_10023215 3300025941 Bacteria 5191
390 Ga0207711_10258467 3300025941 Bacteria 1600
391 Ga0207711_11042046 3300025941 Bacteria 758
392 Ga0207689_10983605 3300025942 Bacteria 712
393 Ga0207661_11104522 3300025944 Bacteria 730
394 Ga0207661_11515151 3300025944 Bacteria 614
395 Ga0207661_11593960 3300025944 Bacteria 597
396 Ga0207679_10001466 3300025945 Bacteria 14785
397 Ga0207679_10010673 3300025945 Bacteria 5922
398 Ga0207679_10082101 3300025945 Bacteria 2467
399 Ga0207679_10408309 3300025945 Bacteria 1196
400 Ga0207679_10410191 3300025945 Bacteria 1193
401 Ga0207679_10571387 3300025945 Bacteria 1016
402 Ga0207679_10978667 3300025945 Bacteria 775
403 Ga0207679_11063512 3300025945 Bacteria 742
404 Ga0207679_11467690 3300025945 Bacteria 626
405 Ga0207667_10000002 3300025949 Bacteria 895662
406 Ga0207667_10742685 3300025949 Bacteria 981
407 Ga0207651_10407069 3300025960 Bacteria 1158
408 Ga0207651_10764349 3300025960 Bacteria 855
409 Ga0207651_11202960 3300025960 Bacteria 680
410 Ga0207712_10000014 3300025961 Bacteria 375393
411 Ga0207668_10000402 3300025972 Bacteria 27270
412 Ga0207668_10066198 3300025972 Bacteria 2560
413 Ga0207668_10348910 3300025972 Bacteria 1237
414 Ga0207668_11637182 3300025972 Bacteria 581
415 Ga0207640_10002027 3300025981 Bacteria 10944
416 Ga0207640_10075290 3300025981 Bacteria 2287
417 Ga0207640_10461720 3300025981 Bacteria 1049
418 Ga0207640_10924496 3300025981 Bacteria 763
419 Ga0207658_10000428 3300025986 Bacteria 39861
420 Ga0207658_10364702 3300025986 Bacteria 1261
421 Ga0207677_10292498 3300026023 Bacteria 1342
422 Ga0207703_10002426 3300026035 Bacteria 16170
423 Ga0207703_10101770 3300026035 Bacteria 2436
424 Ga0207639_10003616 3300026041 Bacteria 10382
425 Ga0207639_10371981 3300026041 Bacteria 1281
426 Ga0207639_11075163 3300026041 Bacteria 754
427 Ga0207639_11347168 3300026041 Bacteria 670
428 Ga0207639_12146318 3300026041 Bacteria 520
429 Ga0207639_12242416 3300026041 Bacteria 507
430 Ga0207678_10004876 3300026067 Bacteria 12048
431 Ga0207678_10053905 3300026067 Bacteria 3464
432 Ga0207678_10224561 3300026067 Bacteria 1608
433 Ga0207678_10253198 3300026067 Bacteria 1508
434 Ga0207678_11674042 3300026067 Bacteria 559
435 Ga0207702_10050310 3300026078 Bacteria 3518
436 Ga0207702_10425095 3300026078 Bacteria 1285
437 Ga0207702_11087542 3300026078 Bacteria 793
438 Ga0207641_10000099 3300026088 Bacteria 122892
439 Ga0207641_11103809 3300026088 Bacteria 792
440 Ga0207641_11530673 3300026088 Bacteria 669
441 Ga0207648_10339403 3300026089 Bacteria 1353
442 Ga0207648_10432267 3300026089 Bacteria 1197
443 Ga0207676_10001345 3300026095 Bacteria 18261
444 Ga0207676_10214204 3300026095 Bacteria 1711
445 Ga0207676_10710927 3300026095 Bacteria 974
446 Ga0207676_11166737 3300026095 Bacteria 763
447 Ga0207676_11852928 3300026095 Bacteria 602
448 Ga0207674_10060601 3300026116 Bacteria 3826
449 Ga0207674_10219882 3300026116 Bacteria 1848
450 Ga0207674_10295063 3300026116 Bacteria 1570
451 Ga0207674_10397602 3300026116 Bacteria 1332
452 Ga0207675_100000157 3300026118 Bacteria 59865
453 Ga0207675_100006214 3300026118 Bacteria 11342
454 Ga0207675_101390482 3300026118 Bacteria 722
455 Ga0207675_102107866 3300026118 Bacteria 580
456 Ga0207683_10054331 3300026121 Bacteria 3512
457 Ga0207683_10092626 3300026121 Bacteria 2693
458 Ga0207683_10647030 3300026121 Bacteria 979
459 Ga0207683_11075667 3300026121 Bacteria 746
460 Ga0207683_12118535 3300026121 Bacteria 510
461 Ga0207698_10002491 3300026142 Bacteria 10925
462 Ga0207698_10177021 3300026142 Bacteria 1885
463 Ga0207698_10476228 3300026142 Bacteria 1210
464 Ga0207698_10829115 3300026142 Bacteria 929
465 Ga0207698_12055575 3300026142 Bacteria 585
466 Ga0209967_1018450 3300027364 Bacteria 1011
467 Ga0209967_1023094 3300027364 Bacteria 914
468 Ga0209984_1015877 3300027424 Bacteria 1003
469 Ga0210000_1086907 3300027462 Bacteria 515
470 Ga0209999_1039061 3300027543 Bacteria 888
471 Ga0209998_10071771 3300027717 Bacteria 828
472 Ga0209974_10165900 3300027876 Bacteria 803
473 Ga0268266_10000009 3300028379 Bacteria 1097737
474 Ga0268266_10022523 3300028379 Bacteria 5368
475 Ga0268266_10140961 3300028379 Bacteria 2163
476 Ga0268266_10396572 3300028379 Bacteria 1304
477 Ga0268265_10000047 3300028380 Bacteria 179354
478 Ga0268265_10000074 3300028380 Bacteria 127599
479 Ga0268264_10000023 3300028381 Bacteria 471408
480 Ga0268264_10000215 3300028381 Bacteria 113994
481 Ga0307408_100006443 3300031548 Bacteria 7780
482 Ga0307408_100199693 3300031548 Bacteria 1617
483 Ga0307408_100206209 3300031548 Bacteria 1594
484 Ga0307408_100225187 3300031548 Bacteria 1532
485 Ga0307408_100287569 3300031548 Bacteria 1371
486 Ga0307408_100342407 3300031548 Bacteria 1266
487 Ga0307408_100485545 3300031548 Bacteria 1078
488 Ga0307408_100553889 3300031548 Bacteria 1015
489 Ga0307408_100790692 3300031548 Bacteria 860
490 Ga0307408_100910882 3300031548 Bacteria 805
491 Ga0307408_102519534 3300031548 Bacteria 500
492 Ga0307405_10019698 3300031731 Bacteria 3754
493 Ga0307405_10059852 3300031731 Bacteria 2401
494 Ga0307405_10194476 3300031731 Bacteria 1467
495 Ga0307405_10207937 3300031731 Bacteria 1426
496 Ga0307405_10266437 3300031731 Bacteria 1282
497 Ga0307405_10272146 3300031731 Bacteria 1270
498 Ga0307405_10295455 3300031731 Bacteria 1226
499 Ga0307405_10375159 3300031731 Bacteria 1105
500 Ga0307405_10407978 3300031731 Bacteria 1065
501 Ga0307405_11027308 3300031731 Bacteria 705
502 Ga0307413_10008194 3300031824 Bacteria 4915
503 Ga0307413_10029315 3300031824 Bacteria 3077
504 Ga0307413_10070575 3300031824 Bacteria 2197
505 Ga0307413_10129469 3300031824 Bacteria 1724
506 Ga0307413_10140586 3300031824 Bacteria 1667
507 Ga0307413_10154999 3300031824 Bacteria 1601
508 Ga0307413_10272832 3300031824 Bacteria 1267
509 Ga0307413_10295163 3300031824 Bacteria 1226
510 Ga0307413_10297407 3300031824 Bacteria 1222
511 Ga0307413_10307518 3300031824 Bacteria 1205
512 Ga0307413_10386170 3300031824 Bacteria 1092
513 Ga0307413_10532399 3300031824 Bacteria 949
514 Ga0307413_10569105 3300031824 Bacteria 922
515 Ga0307413_10655336 3300031824 Bacteria 866
516 Ga0307413_10851390 3300031824 Bacteria 770
517 Ga0307413_10910711 3300031824 Bacteria 747
518 Ga0307413_11294230 3300031824 Bacteria 637
519 Ga0307413_12093706 3300031824 Bacteria 511
520 Ga0307410_10030817 3300031852 Bacteria 3432
521 Ga0307410_10043934 3300031852 Bacteria 2964
522 Ga0307410_10049247 3300031852 Bacteria 2827
523 Ga0307410_10059688 3300031852 Bacteria 2604
524 Ga0307410_10096687 3300031852 Bacteria 2108
525 Ga0307410_10112543 3300031852 Bacteria 1971
526 Ga0307410_10134883 3300031852 Bacteria 1818
527 Ga0307410_10206925 3300031852 Bacteria 1501
528 Ga0307410_10401523 3300031852 Bacteria 1107
529 Ga0307410_10443534 3300031852 Bacteria 1057
530 Ga0307410_10448809 3300031852 Bacteria 1051
531 Ga0307410_10462985 3300031852 Bacteria 1036
532 Ga0307410_10830753 3300031852 Bacteria 787
533 Ga0307410_12099412 3300031852 Bacteria 505
534 Ga0307406_10020638 3300031901 Bacteria 3883
535 Ga0307406_10061019 3300031901 Bacteria 2433
536 Ga0307406_10186863 3300031901 Bacteria 1513
537 Ga0307406_10251545 3300031901 Bacteria 1331
538 Ga0307406_10344780 3300031901 Bacteria 1161
539 Ga0307406_10352551 3300031901 Bacteria 1150
540 Ga0307406_10557983 3300031901 Bacteria 938
541 Ga0307406_10864871 3300031901 Bacteria 767
542 Ga0307406_10874259 3300031901 Bacteria 763
543 Ga0307406_11863970 3300031901 Bacteria 535
544 Ga0307406_12037098 3300031901 Bacteria 513
545 Ga0307407_10002227 3300031903 Bacteria 7491
546 Ga0307407_10060971 3300031903 Bacteria 2203
547 Ga0307407_10063358 3300031903 Bacteria 2168
548 Ga0307407_10086266 3300031903 Bacteria 1912
549 Ga0307407_10127566 3300031903 Bacteria 1622
550 Ga0307407_10263189 3300031903 Bacteria 1187
551 Ga0307407_10285829 3300031903 Bacteria 1144
552 Ga0307407_10328575 3300031903 Bacteria 1075
553 Ga0307407_10818762 3300031903 Bacteria 709
554 Ga0307407_11047507 3300031903 Bacteria 632
555 Ga0307407_11057895 3300031903 Bacteria 629
556 Ga0307412_10005349 3300031911 Bacteria 7203
557 Ga0307412_10063129 3300031911 Bacteria 2497
558 Ga0307412_10096207 3300031911 Bacteria 2083
559 Ga0307412_10148277 3300031911 Bacteria 1727
560 Ga0307412_10151533 3300031911 Bacteria 1711
561 Ga0307412_10192076 3300031911 Bacteria 1544
562 Ga0307412_10256539 3300031911 Bacteria 1360
563 Ga0307412_10344895 3300031911 Bacteria 1193
564 Ga0307412_10668682 3300031911 Bacteria 888
565 Ga0307412_10734973 3300031911 Bacteria 850
566 Ga0307412_10906005 3300031911 Bacteria 773
567 Ga0307412_11710472 3300031911 Bacteria 577
568 Ga0307409_100028799 3300031995 Bacteria 3964
569 Ga0307409_100048409 3300031995 Bacteria 3234
570 Ga0307409_100050697 3300031995 Bacteria 3171
571 Ga0307409_100052112 3300031995 Bacteria 3135
572 Ga0307409_100233479 3300031995 Bacteria 1669
573 Ga0307409_100277274 3300031995 Bacteria 1547
574 Ga0307409_100334980 3300031995 Bacteria 1421
575 Ga0307409_100380008 3300031995 Bacteria 1342
576 Ga0307409_100574346 3300031995 Bacteria 1110
577 Ga0307409_100734720 3300031995 Bacteria 990
578 Ga0307409_100738005 3300031995 Bacteria 987
579 Ga0307409_100805247 3300031995 Bacteria 947
580 Ga0307409_100847781 3300031995 Bacteria 924
581 Ga0307409_101847849 3300031995 Bacteria 633
582 Ga0307416_100007111 3300032002 Bacteria 7076
583 Ga0307416_100016950 3300032002 Bacteria 5081
584 Ga0307416_100108559 3300032002 Bacteria 2438
585 Ga0307416_100171661 3300032002 Bacteria 2020
586 Ga0307416_100205947 3300032002 Bacteria 1871
587 Ga0307416_100544887 3300032002 Bacteria 1232
588 Ga0307416_100761587 3300032002 Bacteria 1061
589 Ga0307416_100786304 3300032002 Bacteria 1046
590 Ga0307416_100930422 3300032002 Bacteria 970
591 Ga0307416_101967543 3300032002 Bacteria 687
592 Ga0307416_102165424 3300032002 Bacteria 657
593 Ga0307416_102285026 3300032002 Bacteria 641
594 Ga0307416_103150535 3300032002 Bacteria 552
595 Ga0307414_10013980 3300032004 Bacteria 4795
596 Ga0307414_10020158 3300032004 Bacteria 4150
597 Ga0307414_10024828 3300032004 Bacteria 3828
598 Ga0307414_10040497 3300032004 Bacteria 3147
599 Ga0307414_10096707 3300032004 Bacteria 2210
600 Ga0307414_10101494 3300032004 Bacteria 2166
601 Ga0307414_10151662 3300032004 Bacteria 1829
602 Ga0307414_10189348 3300032004 Bacteria 1663
603 Ga0307414_10568803 3300032004 Bacteria 1012
604 Ga0307414_10635994 3300032004 Bacteria 960
605 Ga0307414_10693567 3300032004 Bacteria 921
606 Ga0307414_10821854 3300032004 Bacteria 848
607 Ga0307414_11054577 3300032004 Bacteria 749
608 Ga0307414_11285888 3300032004 Bacteria 678
609 Ga0307414_11355946 3300032004 Bacteria 660
610 Ga0307414_11780676 3300032004 Bacteria 575
611 Ga0307414_11956290 3300032004 Bacteria 547
612 Ga0307411_10004327 3300032005 Bacteria 6777
613 Ga0307411_10039443 3300032005 Bacteria 2987
614 Ga0307411_10046354 3300032005 Bacteria 2801
615 Ga0307411_10207985 3300032005 Bacteria 1508
616 Ga0307411_10211902 3300032005 Bacteria 1496
617 Ga0307411_10308714 3300032005 Bacteria 1272
618 Ga0307411_10311147 3300032005 Bacteria 1267
619 Ga0307411_10316985 3300032005 Bacteria 1257
620 Ga0307411_10413567 3300032005 Bacteria 1118
621 Ga0307411_10602835 3300032005 Bacteria 944
622 Ga0307411_10672801 3300032005 Bacteria 898
623 Ga0307411_10789134 3300032005 Bacteria 835
624 Ga0307411_10805665 3300032005 Bacteria 827
625 Ga0307411_11099298 3300032005 Bacteria 716
626 Ga0307411_11406574 3300032005 Bacteria 638
627 Ga0307411_11474747 3300032005 Bacteria 624
628 Ga0307411_11484809 3300032005 Bacteria 622
629 Ga0307411_11897157 3300032005 Bacteria 554
630 Ga0307411_11981529 3300032005 Bacteria 543
631 Ga0307411_12002180 3300032005 Bacteria 541
632 Ga0307411_12026548 3300032005 Bacteria 537
633 Ga0307411_12135839 3300032005 Bacteria 524
634 Ga0307415_100006247 3300032126 Bacteria 6400
635 Ga0307415_100083964 3300032126 Bacteria 2283
636 Ga0307415_100084799 3300032126 Bacteria 2274
637 Ga0307415_100276281 3300032126 Bacteria 1379
638 Ga0307415_100335060 3300032126 Bacteria 1267
639 Ga0307415_100357100 3300032126 Bacteria 1232
640 Ga0307415_100359095 3300032126 Bacteria 1229
641 Ga0307415_100577513 3300032126 Bacteria 996
642 Ga0307415_100647899 3300032126 Bacteria 946
643 Ga0307415_100857668 3300032126 Bacteria 834
644 Ga0307415_100862787 3300032126 Bacteria 831
645 Ga0307415_101190348 3300032126 Bacteria 717
646 Ga0307415_101958698 3300032126 Bacteria 570
647 Ga0307415_102141503 3300032126 Bacteria 546
648 Ga0373941_0300741 3300035115 Bacteria 640
649 Ga0395899_0000406 3300037312 Bacteria 50248
650 Ga0395899_0191462 3300037312 Bacteria 1431
651 Ga0395899_0220425 3300037312 Bacteria 1314
652 Ga0395900_0021924 3300037418 Bacteria 6531
653 Ga0395900_0043394 3300037418 Bacteria 4635
654 Ga0395900_0120641 3300037418 Bacteria 2690
655 Ga0395900_0595623 3300037418 Bacteria 1046
656 Ga0395900_0600356 3300037418 Bacteria 1041
657 Ga0395900_0747509 3300037418 Bacteria 908
658 Ga0395898_0250288 3300037466 Bacteria 1690
659 Ga0395898_0273138 3300037466 Bacteria 1612
660 Ga0395898_0358176 3300037466 Bacteria 1391
661 Ga0395898_0521882 3300037466 Bacteria 1129
662 Ga0395898_0742267 3300037466 Bacteria 923
663 Ga0395905_0001805 3300037471 Bacteria 24778
664 Ga0395905_0007986 3300037471 Bacteria 10455
665 Ga0395905_0022623 3300037471 Bacteria 5942
666 Ga0395905_0821624 3300037471 Bacteria 832
667 Ga0436364_1065372 3300037853 Bacteria 196587
668 Ga0436364_1491317 3300037853 Bacteria 574
669 Ga0395901_0012081 3300038443 Bacteria 8760
670 Ga0395901_0062202 3300038443 Bacteria 3885
671 Ga0395901_0278245 3300038443 Bacteria 1739
672 Ga0395901_0431323 3300038443 Bacteria 1350
673 Ga0395901_0564338 3300038443 Bacteria 1152
674 Ga0395901_1667373 3300038443 Bacteria 589
675 Ga0436365_0298268 3300039437 Bacteria 2267
676 Ga0439439_0128420 3300041406 Bacteria 711
677 Ga0439466_0079543 3300041411 Bacteria 1035
678 Ga0439465_0015647 3300041413 Bacteria 2366
679 Ga0451789_0478013 3300041443 Bacteria 850
680 Ga0451794_37204 3300041446 Bacteria 583
681 Ga0451797_1289161 3300041453 Bacteria 956
682 Ga0451802_0774086 3300041460 Bacteria 3431
683 Ga0451806_236297 3300041462 Bacteria 2200
684 Ga0451804_0241769 3300041463 Bacteria 610
685 Ga0451807_0895683 3300041486 Bacteria 2177
686 Ga0451837_1607676 3300041494 Bacteria 544
687 Ga0451839_0681194 3300041496 Bacteria 719
688 Ga0451845_0925973 3300041501 Bacteria 559
689 Ga0451843_1160977 3300041509 Bacteria 530
690 Ga0439433_0067820 3300041999 Bacteria 857
691 Ga0439445_0225339 3300042004 Bacteria 557
692 Ga0439432_055513 3300042006 Bacteria 1229
693 Ga0439449_0067357 3300042007 Bacteria 1320
694 Ga0439449_0101276 3300042007 Bacteria 1065
695 Ga0439452_044323 3300042010 Bacteria 1038
696 Ga0439452_078916 3300042010 Bacteria 719
697 Ga0439455_0005591 3300042012 Bacteria 2559
698 Ga0439462_0208767 3300042015 Bacteria 557
699 Ga0450912_010825 3300042116 Bacteria 786
700 Ga0450894_081837 3300042131 Bacteria 504
701 Ga0439458_0212146 3300042157 Bacteria 532
702 Ga0439434_0145500 3300042435 Bacteria 783
703 Ga0451577_0768435 3300042876 Bacteria 871
704 Ga0451577_1420766 3300042876 Bacteria 615
705 Ga0453684_0507510 3300044712 Bacteria 1334
706 Ga0466968_0326633 3300044735 Bacteria 742
707 Ga0466970_0066546 3300044765 Bacteria 1934
708 Ga0466957_0951414 3300044842 Bacteria 615
709 Ga0451576_2038486 3300045051 Bacteria 591
710 Ga0466958_0538395 3300045836 Bacteria 758
711 Ga0466967_1276514 3300045976 Bacteria 731
712 Ga0495584_0059740 3300046491 Bacteria 1917
713 Ga0495584_0642604 3300046491 Bacteria 541
714 Ga0495585_0207909 3300046492 Bacteria 993
715 Ga0495583_0195098 3300046506 Bacteria 825
716 Ga0495620_0214338 3300046515 Bacteria 738
717 Ga0495631_0119026 3300046518 Bacteria 1136
718 Ga0495643_0514717 3300046522 Bacteria 513
719 Ga0495663_0007544 3300046525 Bacteria 3009
720 Ga0495663_0175157 3300046525 Bacteria 741
721 Ga0495663_0395046 3300046525 Bacteria 508
722 Ga0495642_0044719 3300046528 Bacteria 1808
723 Ga0495642_0313201 3300046528 Bacteria 688
724 Ga0495654_0240736 3300046530 Bacteria 757
725 Ga0495598_0001038 3300046537 Bacteria 5332
726 Ga0495621_0036568 3300046539 Bacteria 1704
727 Ga0495622_0039363 3300046557 Bacteria 2202
728 Ga0495633_0001763 3300046558 Bacteria 16049
729 Ga0495633_0243849 3300046558 Bacteria 820
730 Ga0495656_0098455 3300046615 Bacteria 1349
731 Ga0495668_0270987 3300046616 Bacteria 930
732 Ga0495625_0267913 3300046660 Bacteria 1103
733 Ga0495669_0010966 3300046684 Bacteria 3837
734 Ga0495669_0034570 3300046684 Bacteria 2228
735 Ga0495669_0268506 3300046684 Bacteria 820
736 Ga0495669_0278529 3300046684 Bacteria 804
737 Ga0495670_0000015 3300046691 Bacteria 131137
738 Ga0495670_0049768 3300046691 Bacteria 2097
739 Ga0495670_0091225 3300046691 Bacteria 1559
740 Ga0495670_0147119 3300046691 Bacteria 1234
741 Ga0495670_0560598 3300046691 Bacteria 622
742 Ga0495671_0008086 3300046692 Bacteria 5938
743 Ga0495672_0431330 3300047320 Bacteria 598
744 Ga0495687_207677 3300047443 Bacteria 616
745 Ga0495677_0014214 3300047445 Bacteria 2899
746 Ga0495677_0105204 3300047445 Bacteria 1070
747 Ga0495677_0117747 3300047445 Bacteria 1012
748 Ga0495686_0000486 3300047472 Bacteria 58640
749 Ga0495686_0007665 3300047472 Bacteria 8057
750 Ga0495686_0158108 3300047472 Bacteria 1326
751 Ga0495686_0386994 3300047472 Bacteria 753
752 Ga0495615_0313283 3300048090 Bacteria 511
753 Ga0496100_0764831 3300048903 Bacteria 756
754 Ga0496102_0022640 3300048905 Bacteria 5568
755 Ga0496102_0194172 3300048905 Bacteria 1913
756 Ga0496102_1513698 3300048905 Bacteria 589
757 Ga0496103_0001458 3300048906 Bacteria 15842
758 Ga0496103_0215571 3300048906 Bacteria 1234
759 Ga0496103_0383193 3300048906 Bacteria 903
760 Ga0496104_0695513 3300048907 Bacteria 925
761 Ga0496105_0118457 3300048908 Bacteria 2184
762 Ga0496105_0250296 3300048908 Bacteria 1436
763 Ga0496105_0550267 3300048908 Bacteria 901
764 Ga0496108_0359849 3300048911 Bacteria 1270
765 Ga0496109_0445967 3300048912 Bacteria 1222
766 Ga0496109_0907800 3300048912 Bacteria 819
767 Ga0496109_1075906 3300048912 Bacteria 741
768 Ga0496109_1296408 3300048912 Bacteria 664
769 Ga0496109_1526623 3300048912 Bacteria 603
770 Ga0496110_0453040 3300048913 Bacteria 1169
771 Ga0496110_0987985 3300048913 Bacteria 749
772 Ga0496111_0129963 3300048914 Bacteria 1863
773 Ga0496111_0599572 3300048914 Bacteria 806
774 Ga0496111_0672456 3300048914 Bacteria 754
775 Ga0496114_0966010 3300048917 Bacteria 735
776 Ga0496117_0005438 3300048920 Bacteria 13377
777 Ga0496118_0004152 3300048921 Bacteria 17499
778 Ga0496118_0027308 3300048921 Bacteria 4835
779 Ga0496119_0096043 3300048922 Bacteria 1673
780 Ga0496120_0260064 3300048923 Bacteria 811
781 Ga0496122_0001531 3300048925 Bacteria 36790
782 Ga0496123_0021568 3300048926 Bacteria 5001
783 Ga0496124_0109237 3300048927 Bacteria 2229
784 Ga0496124_0231018 3300048927 Bacteria 1383
785 Ga0501306_006319 3300049127 Bacteria 1386
786 Ga0501306_031216 3300049127 Bacteria 792
787 Ga0501306_041409 3300049127 Bacteria 716
788 Ga0501306_060438 3300049127 Bacteria 623
789 Ga0501308_006500 3300049128 Bacteria 1200
790 Ga0501308_036283 3300049128 Bacteria 680
791 Ga0501309_008114 3300049129 Bacteria 1316
792 Ga0501309_014992 3300049129 Bacteria 1045
793 Ga0501310_001218 3300049130 Bacteria 2307
794 Ga0501310_003306 3300049130 Bacteria 1573
795 Ga0501310_028079 3300049130 Bacteria 736
796 Ga0501304_016532 3300049160 Bacteria 699
797 Ga0501304_034151 3300049160 Bacteria 550
798 Ga0501305_013093 3300049161 Bacteria 1142
799 Ga0501305_028003 3300049161 Bacteria 866
800 Ga0501305_111502 3300049161 Bacteria 518
801 Ga0501305_111658 3300049161 Bacteria 518
802 Ga0501307_009615 3300049162 Bacteria 1108
803 Ga0501307_015926 3300049162 Bacteria 933
804 Ga0501307_023755 3300049162 Bacteria 814
805 Ga0501307_026073 3300049162 Bacteria 788
806 Ga0501307_096024 3300049162 Bacteria 500
807 Ga0501292_028292 3300049515 Bacteria 933
808 Ga0501311_021033 3300049527 Bacteria 887
809 Ga0501311_025146 3300049527 Bacteria 833
810 Ga0501312_029704 3300049528 Bacteria 852
811 Ga0501312_066811 3300049528 Bacteria 631
812 Ga0501313_029182 3300049529 Bacteria 710
813 Ga0501315_037732 3300049531 Bacteria 721
814 Ga0501315_049783 3300049531 Bacteria 656
815 Ga0501316_020777 3300049532 Bacteria 826
816 Ga0501316_021899 3300049532 Bacteria 811
817 Ga0501317_014767 3300049533 Bacteria 994
818 Ga0501317_025845 3300049533 Bacteria 825
819 Ga0501320_006472 3300049536 Bacteria 1099
820 Ga0501320_048744 3300049536 Bacteria 572
821 Ga0501321_078425 3300049537 Bacteria 523
822 Ga0501322_004865 3300049538 Bacteria 916
823 Ga0501323_025314 3300049539 Bacteria 807
824 Ga0501323_076951 3300049539 Bacteria 541
825 Ga0501324_008845 3300049540 Bacteria 894
826 Ga0501325_025102 3300049541 Bacteria 652
827 Ga0501333_009111 3300049549 Bacteria 693
828 Ga0501334_23126 3300049550 Bacteria 507
829 Ga0501335_044513 3300049551 Bacteria 530
830 Ga0501340_011323 3300049556 Bacteria 663
831 Ga0501032_0502502 3300049569 Bacteria 775
832 Ga0501032_0710334 3300049569 Bacteria 637
833 Ga0501034_0190380 3300049571 Bacteria 2014
834 Ga0501036_1168557 3300049572 Bacteria 628
835 Ga0501038_1245342 3300049574 Bacteria 539
836 Ga0501039_0140668 3300049575 Bacteria 1896
837 Ga0501071_0586635 3300049587 Bacteria 857
838 Ga0501075_0816081 3300049591 Bacteria 710
839 Ga0501202_126721 3300049652 Bacteria 647
840 Ga0501209_253846 3300049656 Bacteria 550
841 Ga0501214_034943 3300049659 Bacteria 706
842 Ga0501217_044278 3300049661 Bacteria 1143
843 Ga0501224_066310 3300049664 Bacteria 568
844 Ga0501235_046846 3300049669 Bacteria 996
845 Ga0501249_178118 3300049679 Bacteria 548
846 Ga0501253_026120 3300049683 Bacteria 1074
847 Ga0501259_203007 3300049688 Bacteria 509
848 Ga0501221_086156 3300049704 Bacteria 762
849 Ga0501225_0090544 3300049705 Bacteria 886
850 Ga0501245_037372 3300049708 Bacteria 824
851 Ga0501079_1508672 3300049741 Bacteria 529
852 Ga0501266_010321 3300049763 Bacteria 1188
853 Ga0501268_004965 3300049765 Bacteria 1893
854 Ga0501270_154734 3300049767 Bacteria 525
855 Ga0501271_013331 3300049768 Bacteria 900
856 Ga0501271_058606 3300049768 Bacteria 536
857 Ga0501272_048841 3300049769 Bacteria 583
858 Ga0501279_104482 3300049775 Bacteria 514
859 Ga0501035_0767010 3300049822 Bacteria 773
860 Ga0501044_0227503 3300049823 Bacteria 1814
861 Ga0501045_0695140 3300049824 Bacteria 751
862 nmdc:mga0k408_324758_c1 3300050493 Bacteria 918
863 Ga0500643_077119 3300053087 Bacteria 919
864 Ga0500646_0059765 3300053090 Bacteria 1119
865 Ga0500647_0181633 3300053091 Bacteria 965
866 Ga0500641_0003980 3300053096 Bacteria 5223
867 Ga0500594_0005507 3300053118 Bacteria 2809
868 Ga0500658_0113824 3300053134 Bacteria 1193
869 Ga0500559_0049464 3300053136 Bacteria 1852
870 Ga0500559_0100471 3300053136 Bacteria 1332
871 Ga0500577_0253966 3300053142 Bacteria 764
872 Ga0500636_0039359 3300053177 Bacteria 2796
873 Ga0500596_003226 3300053735 Bacteria 3130
874 Ga0587084_000368 3300059477 Bacteria 3388
875 Ga0587093_018465 3300059478 Bacteria 909
876 Ga0587066_001465 3300059490 Bacteria 2373
877 Ga0587070_042355 3300059491 Bacteria 877
878 Ga0587077_001167 3300059493 Bacteria 2718
879 Ga0587077_069562 3300059493 Bacteria 783
880 Ga0587080_014969 3300059503 Bacteria 1206
881 Ga0587080_031497 3300059503 Bacteria 926
882 Ga0587080_081322 3300059503 Bacteria 665
883 Ga0587082_008501 3300059504 Bacteria 1433
884 Ga0587083_0037171 3300059505 Bacteria 1001
885 Ga0587085_007179 3300059506 Bacteria 1381
886 Ga0587086_006030 3300059507 Bacteria 1336
887 Ga0587088_007942 3300059508 Bacteria 1485
888 Ga0587088_048881 3300059508 Bacteria 822
889 Ga0587088_211511 3300059508 Bacteria 500
890 Ga0587089_006060 3300059509 Bacteria 1394
891 Ga0587090_001175 3300059510 Bacteria 2574
892 Ga0587090_028878 3300059510 Bacteria 916
893 Ga0587090_118078 3300059510 Bacteria 573
894 Ga0587091_000254 3300059511 Bacteria 3983
895 Ga0587092_007157 3300059512 Bacteria 1436
896 Ga0587092_012652 3300059512 Bacteria 1194
897 Ga0587094_000504 3300059513 Bacteria 3090
898 Ga0587098_006412 3300059604 Bacteria 1192
899 Ga0587106_011511 3300059605 Bacteria 1168
900 Ga0587121_04918 3300059606 Bacteria 762
901 Ga0587129_003262 3300059608 Bacteria 1014
902 Ga0587099_003045 3300059622 Bacteria 1366
903 Ga0587101_000706 3300059623 Bacteria 2535
904 Ga0587117_010629 3300059627 Bacteria 1127
905 Ga0587128_000194 3300059630 Bacteria 3676
906 Ga0587062_138535 3300059639 Bacteria 506
907 Ga0587068_000363 3300059641 Bacteria 3920
908 Ga0587069_009859 3300059642 Bacteria 1242
909 Ga0587072_158655 3300059643 Bacteria 551
910 Ga0587075_079900 3300059644 Bacteria 622
911 Ga0587076_014253 3300059645 Bacteria 1221
912 Ga0587076_023390 3300059645 Bacteria 1040
913 Ga0587076_060180 3300059645 Bacteria 764
914 Ga0587078_000705 3300059646 Bacteria 2686
915 Ga0587078_013100 3300059646 Bacteria 979
916 Ga0587079_008963 3300059647 Bacteria 1545
917 Ga0587100_000732 3300059648 Bacteria 1701
918 Ga0587102_000570 3300059649 Bacteria 2182
919 Ga0587104_003534 3300059650 Bacteria 962
920 Ga0587105_000848 3300059651 Bacteria 1428
921 Ga0587107_000546 3300059652 Bacteria 2535
922 Ga0587110_050021 3300059654 Bacteria 557
923 Ga0587114_008517 3300059655 Bacteria 1208
924 Ga0587118_01767 3300059657 Bacteria 1348
925 Ga0587119_000105 3300059658 Bacteria 3906
926 Ga0587120_005626 3300059659 Bacteria 967
927 Ga0587124_007519 3300059660 Bacteria 918
928 Ga0587124_037851 3300059660 Bacteria 554
929 Ga0587096_00847 3300060247 Bacteria 934
930 Ga0587071_000753 3300060344 Bacteria 3553
931 Ga0587111_0032114 3300060346 Bacteria 1078
932 Ga0587111_0112702 3300060346 Bacteria 691
933 Ga0587111_0153669 3300060346 Bacteria 620
934 2885431646 2885429604 Bacteria 3642894
935 8057102137 8057101203 Bacteria 5034064
936 Ga0587084_011725
937 JGI24034J14986_101847
938 JGI24741J21665_1001920
939 JGI24741J21665_1015360
940 JGI24752J21851_1000007
941 JGI24747J21853_1005899
942 JGI24740J21852_10015856
943 JGI24739J22299_10134605
944 JGI24737J22298_10043760
945 JGI24737J22298_10139036
946 JGI24735J21928_10011436
947 JGI24750J21931_1000298
948 JGI24748J21848_1000070
949 JGI24748J21848_1008969
950 JGI24749J21850_1000118
951 JGI24033J26618_1044558
952 JGI24034J26672_10000038
953 JGI24034J26672_10014302
954 JGI24034J26672_10049632
955 JGI24742J22300_10001588
956 JGI24742J22300_10003980
957 JGI24751J29686_10010345
958 JGI25165J46597_1000023
959 JGI25153J46596_10000173
960 Ga0032354_1119435
961 Ga0055525_1000012
962 Ga0055542_1001518
963 Ga0055529_1000014
964 Ga0055530_10015010
965 Ga0055531_10032620
966 Ga0055531_10100522
967 Ga0058860_11860095
968 Ga0065712_10100550
969 Ga0065712_10213194
970 Ga0065712_10339614
971 Ga0065715_10029418
972 Ga0065715_10051509
973 Ga0065715_10448200
974 Ga0065715_10565818
975 Ga0065715_10598461
976 Ga0065707_10525541
977 Ga0070658_10034849
978 Ga0070658_10354895
979 Ga0070658_10470961
980 Ga0070658_10488853
981 Ga0070658_10739176
982 Ga0070658_10790314
983 Ga0070658_11019730
984 Ga0070658_11444257
985 Ga0070676_10033009
986 Ga0070676_10585954
987 Ga0070676_10770661
988 Ga0070683_100438274
989 Ga0070683_100974924
990 Ga0070683_101634463
991 Ga0070690_100000097
992 Ga0070670_100010675
993 Ga0070670_100034259
994 Ga0070670_100161717
995 Ga0070670_100436289
996 Ga0070677_10037474
997 Ga0070677_10062061
998 Ga0070677_10074850
999 Ga0068869_101112408
1000 Ga0070666_10000004
1001 Ga0070666_10191087
1002 Ga0070666_10490911
1003 Ga0070680_100363294
1004 Ga0070682_100379432
1005 Ga0070682_101020532
1006 Ga0068868_100049745
1007 Ga0070660_100096538
1008 Ga0070660_100188024
1009 Ga0070660_100205715
1010 Ga0070660_100390605
1011 Ga0070660_100419886
1012 Ga0070660_100682995
1013 Ga0070660_101060484
1014 Ga0070689_100106270
1015 Ga0070687_100263328
1016 Ga0070661_100033195
1017 Ga0070661_100101205
1018 Ga0070661_100122997
1019 Ga0070661_100353376
1020 Ga0070661_100410927
1021 Ga0070661_100763169
1022 Ga0070661_101222862
1023 Ga0070692_10047048
1024 Ga0070668_100078782
1025 Ga0070668_100164638
1026 Ga0070668_100367114
1027 Ga0070668_100773108
1028 Ga0070669_100000296
1029 Ga0070669_100177439
1030 Ga0070669_100200612
1031 Ga0070669_100285920
1032 Ga0070669_100485009
1033 Ga0070669_100971176
1034 Ga0070669_101061793
1035 Ga0070669_101128734
1036 Ga0070669_101391820
1037 Ga0070675_100190962
1038 Ga0070675_100775834
1039 Ga0070675_100929592
1040 Ga0070671_100012607
1041 Ga0070671_100023714
1042 Ga0070671_100203448
1043 Ga0070671_100258242
1044 Ga0070671_100402823
1045 Ga0070671_100490132
1046 Ga0070674_100112061
1047 Ga0070674_100242117
1048 Ga0070673_100127669
1049 Ga0070673_100880830
1050 Ga0070688_100002383
1051 Ga0070659_100033177
1052 Ga0070659_100235299
1053 Ga0070659_100242738
1054 Ga0070659_100278332
1055 Ga0070659_101135244
1056 Ga0070659_101152500
1057 Ga0070659_101427295
1058 Ga0070667_100061703
1059 Ga0070667_100200068
1060 Ga0070667_102150601
1061 Ga0070714_100025886
1062 Ga0070714_100507601
1063 Ga0070713_100239005
1064 Ga0070700_101543717
1065 Ga0070663_100080949
1066 Ga0070663_100751747
1067 Ga0070663_101348259
1068 Ga0070678_100017885
1069 Ga0070678_100403125
1070 Ga0070662_100046495
1071 Ga0070662_100064573
1072 Ga0070662_100483155
1073 Ga0070681_10807026
1074 Ga0070681_10847619
1075 Ga0068867_100321187
1076 Ga0070685_10000262
1077 Ga0070679_100226535
1078 Ga0070679_100321123
1079 Ga0070679_101542479
1080 Ga0070684_100653704
1081 Ga0070684_101371812
1082 Ga0068853_100079177
1083 Ga0068853_100151532
1084 Ga0068853_100535457
1085 Ga0068853_100674894
1086 Ga0068853_102312984
1087 Ga0070672_100207425
1088 Ga0070686_100000061
1089 Ga0070696_100112118
1090 Ga0070665_100000004
1091 Ga0070665_100009730
1092 Ga0070665_100280359
1093 Ga0070665_100339978
1094 Ga0070665_101500274
1095 Ga0068855_100616645
1096 Ga0070664_100101975
1097 Ga0070664_100216063
1098 Ga0070664_100325070
1099 Ga0070664_100520843
1100 Ga0070664_100749325
1101 Ga0070664_100898377
1102 Ga0070664_101327312
1103 Ga0070664_101808126
1104 Ga0070664_102074491
1105 Ga0068857_100226553
1106 Ga0068857_100686033
1107 Ga0068857_100808385
1108 Ga0068857_101067976
1109 Ga0068854_100063035
1110 Ga0068854_100217907
1111 Ga0068856_100050714
1112 Ga0068856_100150227
1113 Ga0068856_102249078
1114 Ga0068852_100218546
1115 Ga0068852_100329391
1116 Ga0068852_100931418
1117 Ga0068852_100947817
1118 Ga0068859_100001416
1119 Ga0068859_100010520
1120 Ga0068859_100275602
1121 Ga0068859_100839699
1122 Ga0068859_101860805
1123 Ga0068864_100002567
1124 Ga0068864_101049438
1125 Ga0068861_100000040
1126 Ga0068861_100002842
1127 Ga0068861_101088385
1128 Ga0068851_10011439
1129 Ga0068851_10360727
1130 Ga0068851_10423600
1131 Ga0068870_10272613
1132 Ga0068870_11021802
1133 Ga0068863_100000013
1134 Ga0068863_100909232
1135 Ga0068858_100000664
1136 Ga0068858_100008722
1137 Ga0068860_100000009
1138 Ga0068860_100007808
1139 Ga0068860_100544238
1140 Ga0068862_100001446
1141 Ga0081539_10018995
1142 Ga0070717_11649270
1143 Ga0075367_10454611
1144 Ga0097621_100066302
1145 Ga0075370_10375338
1146 Ga0075370_10388167
1147 Ga0068871_100064899
1148 Ga0075430_101382922
1149 Ga0068865_100650878
1150 Ga0068865_101545290
1151 Ga0097620_100001416
1152 Ga0097620_100010519
1153 Ga0097620_100275611
1154 Ga0097620_100839823
1155 Ga0097620_101860871
1156 Ga0105250_10073036
1157 Ga0105240_10206568
1158 Ga0105240_10700183
1159 Ga0105245_12705906
1160 Ga0105243_10003106
1161 Ga0105243_10737663
1162 Ga0105241_12401405
1163 Ga0105241_12609145
1164 Ga0105248_10023935
1165 Ga0105248_10316717
1166 Ga0105248_10573441
1167 Ga0105248_11013124
1168 Ga0105248_11284805
1169 Ga0105237_12029783
1170 Ga0105238_10931313
1171 Ga0105238_11034238
1172 Ga0105238_11508862
1173 Ga0105249_10000006
1174 Ga0105148_117490
1175 Ga0105239_10090567
1176 Ga0105239_13502082
1177 Ga0105246_10099608
1178 Ga0157317_1000418
1179 Ga0157327_1023822
1180 Ga0157373_10425298
1181 Ga0157373_10426491
1182 Ga0157373_10501180
1183 Ga0157373_11121058
1184 Ga0157371_10000059
1185 Ga0157371_10123034
1186 Ga0157371_11159258
1187 Ga0157370_10024969
1188 Ga0157370_11334238
1189 Ga0157370_11633359
1190 Ga0157369_10034063
1191 Ga0157369_10552266
1192 Ga0157369_11190963
1193 Ga0157369_11220717
1194 Ga0157374_10104316
1195 Ga0157374_10414168
1196 Ga0157378_10232281
1197 Ga0157378_10273729
1198 Ga0163162_10034071
1199 Ga0163162_10072394
1200 Ga0163162_10109281
1201 Ga0163162_10789338
1202 Ga0163162_11697639
1203 Ga0157372_10308225
1204 Ga0157372_10659289
1205 Ga0157372_10774507
1206 Ga0157372_11061209
1207 Ga0157372_11111232
1208 Ga0157375_10657450
1209 Ga0157375_12866978
1210 Ga0157375_13433680
1211 Ga0157375_13535204
1212 Ga0163163_10019994
1213 Ga0157380_10116019
1214 Ga0157380_10235709
1215 Ga0157380_11993450
1216 Ga0157379_10001735
1217 Ga0157379_10003973
1218 Ga0163161_10000208
1219 Ga0163161_10222559
1220 Ga0163161_10441763
1221 Ga0163161_10751429
1222 Ga0197907_10820967
1223 Ga0197907_10990692
1224 Ga0206355_1017096
1225 Ga0206352_10437088
1226 Ga0213876_10166713
1227 Ga0213875_10001626
1228 Ga0207672_1001700
1229 Ga0209674_102700
1230 Ga0209563_100030
1231 Ga0207427_100986
1232 Ga0209026_1000352
1233 Ga0209148_1000011
1234 Ga0209759_1033090
1235 Ga0209233_1000003
1236 Ga0209455_1000006
1237 Ga0209758_1000001
1238 Ga0209050_1021913
1239 Ga0209257_1000577
1240 Ga0209257_1000597
1241 Ga0209257_1006247
1242 Ga0207697_10101229
1243 Ga0207697_10161798
1244 Ga0207697_10172294
1245 Ga0207656_10002150
1246 Ga0207656_10043235
1247 Ga0207682_10073759
1248 Ga0207682_10092570
1249 Ga0207682_10487689
1250 Ga0207680_10000010
1251 Ga0207680_10225072
1252 Ga0207680_10490110
1253 Ga0207645_10026399
1254 Ga0207645_10174952
1255 Ga0207645_10567128
1256 Ga0207645_10728755
1257 Ga0207643_10178103
1258 Ga0207643_10411592
1259 Ga0207705_10000511
1260 Ga0207705_10001825
1261 Ga0207705_10026545
1262 Ga0207705_10207656
1263 Ga0207705_10460666
1264 Ga0207654_11246107
1265 Ga0207707_10362538
1266 Ga0207707_10757610
1267 Ga0207695_10003496
1268 Ga0207695_11296827
1269 Ga0207671_10004021
1270 Ga0207660_10884083
1271 Ga0207662_10431934
1272 Ga0207662_10438171
1273 Ga0207662_10741161
1274 Ga0207662_10813593
1275 Ga0207657_10061226
1276 Ga0207657_10132430
1277 Ga0207657_10231765
1278 Ga0207657_10348096
1279 Ga0207657_10587063
1280 Ga0207657_10671567
1281 Ga0207649_10363671
1282 Ga0207649_10366653
1283 Ga0207649_11415093
1284 Ga0207652_10226817
1285 Ga0207652_10573323
1286 Ga0207681_10000197
1287 Ga0207681_10104132
1288 Ga0207681_10226635
1289 Ga0207681_10446773
1290 Ga0207681_10788222
1291 Ga0207694_10054679
1292 Ga0207694_10417758
1293 Ga0207650_10001567
1294 Ga0207650_10102411
1295 Ga0207650_10181519
1296 Ga0207659_10002689
1297 Ga0207659_10035680
1298 Ga0207659_10521695
1299 Ga0207659_10830814
1300 Ga0207700_10528921
1301 Ga0207664_10356883
1302 Ga0207644_10005181
1303 Ga0207644_10008230
1304 Ga0207644_10261373
1305 Ga0207690_10003585
1306 Ga0207690_10063154
1307 Ga0207690_10596524
1308 Ga0207690_11047541
1309 Ga0207690_11379996
1310 Ga0207706_10041209
1311 Ga0207706_10079122
1312 Ga0207706_10141807
1313 Ga0207706_10178089
1314 Ga0207686_10324797
1315 Ga0207709_10000246
1316 Ga0207670_10087907
1317 Ga0207669_10190199
1318 Ga0207669_10390138
1319 Ga0207704_11679469
1320 Ga0207691_10036228
1321 Ga0207691_10040894
1322 Ga0207691_10201747
1323 Ga0207711_10006762
1324 Ga0207711_10023215
1325 Ga0207711_10258467
1326 Ga0207711_11042046
1327 Ga0207689_10983605
1328 Ga0207661_11104522
1329 Ga0207661_11515151
1330 Ga0207661_11593960
1331 Ga0207679_10001466
1332 Ga0207679_10010673
1333 Ga0207679_10082101
1334 Ga0207679_10408309
1335 Ga0207679_10410191
1336 Ga0207679_10571387
1337 Ga0207679_10978667
1338 Ga0207679_11063512
1339 Ga0207679_11467690
1340 Ga0207667_10000002
1341 Ga0207667_10742685
1342 Ga0207651_10407069
1343 Ga0207651_10764349
1344 Ga0207651_11202960
1345 Ga0207712_10000014
1346 Ga0207668_10000402
1347 Ga0207668_10066198
1348 Ga0207668_10348910
1349 Ga0207668_11637182
1350 Ga0207640_10002027
1351 Ga0207640_10075290
1352 Ga0207640_10461720
1353 Ga0207640_10924496
1354 Ga0207658_10000428
1355 Ga0207658_10364702
1356 Ga0207677_10292498
1357 Ga0207703_10002426
1358 Ga0207703_10101770
1359 Ga0207639_10003616
1360 Ga0207639_10371981
1361 Ga0207639_11075163
1362 Ga0207639_11347168
1363 Ga0207639_12146318
1364 Ga0207639_12242416
1365 Ga0207678_10004876
1366 Ga0207678_10053905
1367 Ga0207678_10224561
1368 Ga0207678_10253198
1369 Ga0207678_11674042
1370 Ga0207702_10050310
1371 Ga0207702_10425095
1372 Ga0207702_11087542
1373 Ga0207641_10000099
1374 Ga0207641_11103809
1375 Ga0207641_11530673
1376 Ga0207648_10339403
1377 Ga0207648_10432267
1378 Ga0207676_10001345
1379 Ga0207676_10214204
1380 Ga0207676_10710927
1381 Ga0207676_11166737
1382 Ga0207676_11852928
1383 Ga0207674_10060601
1384 Ga0207674_10219882
1385 Ga0207674_10295063
1386 Ga0207674_10397602
1387 Ga0207675_100000157
1388 Ga0207675_100006214
1389 Ga0207675_101390482
1390 Ga0207675_102107866
1391 Ga0207683_10054331
1392 Ga0207683_10092626
1393 Ga0207683_10647030
1394 Ga0207683_11075667
1395 Ga0207683_12118535
1396 Ga0207698_10002491
1397 Ga0207698_10177021
1398 Ga0207698_10476228
1399 Ga0207698_10829115
1400 Ga0207698_12055575
1401 Ga0209967_1018450
1402 Ga0209967_1023094
1403 Ga0209984_1015877
1404 Ga0210000_1086907
1405 Ga0209999_1039061
1406 Ga0209998_10071771
1407 Ga0209974_10165900
1408 Ga0268266_10000009
1409 Ga0268266_10022523
1410 Ga0268266_10140961
1411 Ga0268266_10396572
1412 Ga0268265_10000047
1413 Ga0268265_10000074
1414 Ga0268264_10000023
1415 Ga0268264_10000215
1416 Ga0307408_100006443
1417 Ga0307408_100199693
1418 Ga0307408_100206209
1419 Ga0307408_100225187
1420 Ga0307408_100287569
1421 Ga0307408_100342407
1422 Ga0307408_100485545
1423 Ga0307408_100553889
1424 Ga0307408_100790692
1425 Ga0307408_100910882
1426 Ga0307408_102519534
1427 Ga0307405_10019698
1428 Ga0307405_10059852
1429 Ga0307405_10194476
1430 Ga0307405_10207937
1431 Ga0307405_10266437
1432 Ga0307405_10272146
1433 Ga0307405_10295455
1434 Ga0307405_10375159
1435 Ga0307405_10407978
1436 Ga0307405_11027308
1437 Ga0307413_10008194
1438 Ga0307413_10029315
1439 Ga0307413_10070575
1440 Ga0307413_10129469
1441 Ga0307413_10140586
1442 Ga0307413_10154999
1443 Ga0307413_10272832
1444 Ga0307413_10295163
1445 Ga0307413_10297407
1446 Ga0307413_10307518
1447 Ga0307413_10386170
1448 Ga0307413_10532399
1449 Ga0307413_10569105
1450 Ga0307413_10655336
1451 Ga0307413_10851390
1452 Ga0307413_10910711
1453 Ga0307413_11294230
1454 Ga0307413_12093706
1455 Ga0307410_10030817
1456 Ga0307410_10043934
1457 Ga0307410_10049247
1458 Ga0307410_10059688
1459 Ga0307410_10096687
1460 Ga0307410_10112543
1461 Ga0307410_10134883
1462 Ga0307410_10206925
1463 Ga0307410_10401523
1464 Ga0307410_10443534
1465 Ga0307410_10448809
1466 Ga0307410_10462985
1467 Ga0307410_10830753
1468 Ga0307410_12099412
1469 Ga0307406_10020638
1470 Ga0307406_10061019
1471 Ga0307406_10186863
1472 Ga0307406_10251545
1473 Ga0307406_10344780
1474 Ga0307406_10352551
1475 Ga0307406_10557983
1476 Ga0307406_10864871
1477 Ga0307406_10874259
1478 Ga0307406_11863970
1479 Ga0307406_12037098
1480 Ga0307407_10002227
1481 Ga0307407_10060971
1482 Ga0307407_10063358
1483 Ga0307407_10086266
1484 Ga0307407_10127566
1485 Ga0307407_10263189
1486 Ga0307407_10285829
1487 Ga0307407_10328575
1488 Ga0307407_10818762
1489 Ga0307407_11047507
1490 Ga0307407_11057895
1491 Ga0307412_10005349
1492 Ga0307412_10063129
1493 Ga0307412_10096207
1494 Ga0307412_10148277
1495 Ga0307412_10151533
1496 Ga0307412_10192076
1497 Ga0307412_10256539
1498 Ga0307412_10344895
1499 Ga0307412_10668682
1500 Ga0307412_10734973
1501 Ga0307412_10906005
1502 Ga0307412_11710472
1503 Ga0307409_100028799
1504 Ga0307409_100048409
1505 Ga0307409_100050697
1506 Ga0307409_100052112
1507 Ga0307409_100233479
1508 Ga0307409_100277274
1509 Ga0307409_100334980
1510 Ga0307409_100380008
1511 Ga0307409_100574346
1512 Ga0307409_100734720
1513 Ga0307409_100738005
1514 Ga0307409_100805247
1515 Ga0307409_100847781
1516 Ga0307409_101847849
1517 Ga0307416_100007111
1518 Ga0307416_100016950
1519 Ga0307416_100108559
1520 Ga0307416_100171661
1521 Ga0307416_100205947
1522 Ga0307416_100544887
1523 Ga0307416_100761587
1524 Ga0307416_100786304
1525 Ga0307416_100930422
1526 Ga0307416_101967543
1527 Ga0307416_102165424
1528 Ga0307416_102285026
1529 Ga0307416_103150535
1530 Ga0307414_10013980
1531 Ga0307414_10020158
1532 Ga0307414_10024828
1533 Ga0307414_10040497
1534 Ga0307414_10096707
1535 Ga0307414_10101494
1536 Ga0307414_10151662
1537 Ga0307414_10189348
1538 Ga0307414_10568803
1539 Ga0307414_10635994
1540 Ga0307414_10693567
1541 Ga0307414_10821854
1542 Ga0307414_11054577
1543 Ga0307414_11285888
1544 Ga0307414_11355946
1545 Ga0307414_11780676
1546 Ga0307414_11956290
1547 Ga0307411_10004327
1548 Ga0307411_10039443
1549 Ga0307411_10046354
1550 Ga0307411_10207985
1551 Ga0307411_10211902
1552 Ga0307411_10308714
1553 Ga0307411_10311147
1554 Ga0307411_10316985
1555 Ga0307411_10413567
1556 Ga0307411_10602835
1557 Ga0307411_10672801
1558 Ga0307411_10789134
1559 Ga0307411_10805665
1560 Ga0307411_11099298
1561 Ga0307411_11406574
1562 Ga0307411_11474747
1563 Ga0307411_11484809
1564 Ga0307411_11897157
1565 Ga0307411_11981529
1566 Ga0307411_12002180
1567 Ga0307411_12026548
1568 Ga0307411_12135839
1569 Ga0307415_100006247
1570 Ga0307415_100083964
1571 Ga0307415_100084799
1572 Ga0307415_100276281
1573 Ga0307415_100335060
1574 Ga0307415_100357100
1575 Ga0307415_100359095
1576 Ga0307415_100577513
1577 Ga0307415_100647899
1578 Ga0307415_100857668
1579 Ga0307415_100862787
1580 Ga0307415_101190348
1581 Ga0307415_101958698
1582 Ga0307415_102141503
1583 Ga0373941_0300741
1584 Ga0395899_0000406
1585 Ga0395899_0191462
1586 Ga0395899_0220425
1587 Ga0395900_0021924
1588 Ga0395900_0043394
1589 Ga0395900_0120641
1590 Ga0395900_0595623
1591 Ga0395900_0600356
1592 Ga0395900_0747509
1593 Ga0395898_0250288
1594 Ga0395898_0273138
1595 Ga0395898_0358176
1596 Ga0395898_0521882
1597 Ga0395898_0742267
1598 Ga0395905_0001805
1599 Ga0395905_0007986
1600 Ga0395905_0022623
1601 Ga0395905_0821624
1602 Ga0436364_1065372
1603 Ga0436364_1491317
1604 Ga0395901_0012081
1605 Ga0395901_0062202
1606 Ga0395901_0278245
1607 Ga0395901_0431323
1608 Ga0395901_0564338
1609 Ga0395901_1667373
1610 Ga0436365_0298268
1611 Ga0439439_0128420
1612 Ga0439466_0079543
1613 Ga0439465_0015647
1614 Ga0451789_0478013
1615 Ga0451794_37204
1616 Ga0451797_1289161
1617 Ga0451802_0774086
1618 Ga0451806_236297
1619 Ga0451804_0241769
1620 Ga0451807_0895683
1621 Ga0451837_1607676
1622 Ga0451839_0681194
1623 Ga0451845_0925973
1624 Ga0451843_1160977
1625 Ga0439433_0067820
1626 Ga0439445_0225339
1627 Ga0439432_055513
1628 Ga0439449_0067357
1629 Ga0439449_0101276
1630 Ga0439452_044323
1631 Ga0439452_078916
1632 Ga0439455_0005591
1633 Ga0439462_0208767
1634 Ga0450912_010825
1635 Ga0450894_081837
1636 Ga0439458_0212146
1637 Ga0439434_0145500
1638 Ga0451577_0768435
1639 Ga0451577_1420766
1640 Ga0453684_0507510
1641 Ga0466968_0326633
1642 Ga0466970_0066546
1643 Ga0466957_0951414
1644 Ga0451576_2038486
1645 Ga0466958_0538395
1646 Ga0466967_1276514
1647 Ga0495584_0059740
1648 Ga0495584_0642604
1649 Ga0495585_0207909
1650 Ga0495583_0195098
1651 Ga0495620_0214338
1652 Ga0495631_0119026
1653 Ga0495643_0514717
1654 Ga0495663_0007544
1655 Ga0495663_0175157
1656 Ga0495663_0395046
1657 Ga0495642_0044719
1658 Ga0495642_0313201
1659 Ga0495654_0240736
1660 Ga0495598_0001038
1661 Ga0495621_0036568
1662 Ga0495622_0039363
1663 Ga0495633_0001763
1664 Ga0495633_0243849
1665 Ga0495656_0098455
1666 Ga0495668_0270987
1667 Ga0495625_0267913
1668 Ga0495669_0010966
1669 Ga0495669_0034570
1670 Ga0495669_0268506
1671 Ga0495669_0278529
1672 Ga0495670_0000015
1673 Ga0495670_0049768
1674 Ga0495670_0091225
1675 Ga0495670_0147119
1676 Ga0495670_0560598
1677 Ga0495671_0008086
1678 Ga0495672_0431330
1679 Ga0495687_207677
1680 Ga0495677_0014214
1681 Ga0495677_0105204
1682 Ga0495677_0117747
1683 Ga0495686_0000486
1684 Ga0495686_0007665
1685 Ga0495686_0158108
1686 Ga0495686_0386994
1687 Ga0495615_0313283
1688 Ga0496100_0764831
1689 Ga0496102_0022640
1690 Ga0496102_0194172
1691 Ga0496102_1513698
1692 Ga0496103_0001458
1693 Ga0496103_0215571
1694 Ga0496103_0383193
1695 Ga0496104_0695513
1696 Ga0496105_0118457
1697 Ga0496105_0250296
1698 Ga0496105_0550267
1699 Ga0496108_0359849
1700 Ga0496109_0445967
1701 Ga0496109_0907800
1702 Ga0496109_1075906
1703 Ga0496109_1296408
1704 Ga0496109_1526623
1705 Ga0496110_0453040
1706 Ga0496110_0987985
1707 Ga0496111_0129963
1708 Ga0496111_0599572
1709 Ga0496111_0672456
1710 Ga0496114_0966010
1711 Ga0496117_0005438
1712 Ga0496118_0004152
1713 Ga0496118_0027308
1714 Ga0496119_0096043
1715 Ga0496120_0260064
1716 Ga0496122_0001531
1717 Ga0496123_0021568
1718 Ga0496124_0109237
1719 Ga0496124_0231018
1720 Ga0501306_006319
1721 Ga0501306_031216
1722 Ga0501306_041409
1723 Ga0501306_060438
1724 Ga0501308_006500
1725 Ga0501308_036283
1726 Ga0501309_008114
1727 Ga0501309_014992
1728 Ga0501310_001218
1729 Ga0501310_003306
1730 Ga0501310_028079
1731 Ga0501304_016532
1732 Ga0501304_034151
1733 Ga0501305_013093
1734 Ga0501305_028003
1735 Ga0501305_111502
1736 Ga0501305_111658
1737 Ga0501307_009615
1738 Ga0501307_015926
1739 Ga0501307_023755
1740 Ga0501307_026073
1741 Ga0501307_096024
1742 Ga0501292_028292
1743 Ga0501311_021033
1744 Ga0501311_025146
1745 Ga0501312_029704
1746 Ga0501312_066811
1747 Ga0501313_029182
1748 Ga0501315_037732
1749 Ga0501315_049783
1750 Ga0501316_020777
1751 Ga0501316_021899
1752 Ga0501317_014767
1753 Ga0501317_025845
1754 Ga0501320_006472
1755 Ga0501320_048744
1756 Ga0501321_078425
1757 Ga0501322_004865
1758 Ga0501323_025314
1759 Ga0501323_076951
1760 Ga0501324_008845
1761 Ga0501325_025102
1762 Ga0501333_009111
1763 Ga0501334_23126
1764 Ga0501335_044513
1765 Ga0501340_011323
1766 Ga0501032_0502502
1767 Ga0501032_0710334
1768 Ga0501034_0190380
1769 Ga0501036_1168557
1770 Ga0501038_1245342
1771 Ga0501039_0140668
1772 Ga0501071_0586635
1773 Ga0501075_0816081
1774 Ga0501202_126721
1775 Ga0501209_253846
1776 Ga0501214_034943
1777 Ga0501217_044278
1778 Ga0501224_066310
1779 Ga0501235_046846
1780 Ga0501249_178118
1781 Ga0501253_026120
1782 Ga0501259_203007
1783 Ga0501221_086156
1784 Ga0501225_0090544
1785 Ga0501245_037372
1786 Ga0501079_1508672
1787 Ga0501266_010321
1788 Ga0501268_004965
1789 Ga0501270_154734
1790 Ga0501271_013331
1791 Ga0501271_058606
1792 Ga0501272_048841
1793 Ga0501279_104482
1794 Ga0501035_0767010
1795 Ga0501044_0227503
1796 Ga0501045_0695140
1797 nmdc:mga0k408_324758_c1
1798 Ga0500643_077119
1799 Ga0500646_0059765
1800 Ga0500647_0181633
1801 Ga0500641_0003980
1802 Ga0500594_0005507
1803 Ga0500658_0113824
1804 Ga0500559_0049464
1805 Ga0500559_0100471
1806 Ga0500577_0253966
1807 Ga0500636_0039359
1808 Ga0500596_003226
1809 Ga0587084_000368
1810 Ga0587093_018465
1811 Ga0587066_001465
1812 Ga0587070_042355
1813 Ga0587077_001167
1814 Ga0587077_069562
1815 Ga0587080_014969
1816 Ga0587080_031497
1817 Ga0587080_081322
1818 Ga0587082_008501
1819 Ga0587083_0037171
1820 Ga0587085_007179
1821 Ga0587086_006030
1822 Ga0587088_007942
1823 Ga0587088_048881
1824 Ga0587088_211511
1825 Ga0587089_006060
1826 Ga0587090_001175
1827 Ga0587090_028878
1828 Ga0587090_118078
1829 Ga0587091_000254
1830 Ga0587092_007157
1831 Ga0587092_012652
1832 Ga0587094_000504
1833 Ga0587098_006412
1834 Ga0587106_011511
1835 Ga0587121_04918
1836 Ga0587129_003262
1837 Ga0587099_003045
1838 Ga0587101_000706
1839 Ga0587117_010629
1840 Ga0587128_000194
1841 Ga0587062_138535
1842 Ga0587068_000363
1843 Ga0587069_009859
1844 Ga0587072_158655
1845 Ga0587075_079900
1846 Ga0587076_014253
1847 Ga0587076_023390
1848 Ga0587076_060180
1849 Ga0587078_000705
1850 Ga0587078_013100
1851 Ga0587079_008963
1852 Ga0587100_000732
1853 Ga0587102_000570
1854 Ga0587104_003534
1855 Ga0587105_000848
1856 Ga0587107_000546
1857 Ga0587110_050021
1858 Ga0587114_008517
1859 Ga0587118_01767
1860 Ga0587119_000105
1861 Ga0587120_005626
1862 Ga0587124_007519
1863 Ga0587124_037851
1864 Ga0587096_00847
1865 Ga0587071_000753
1866 Ga0587111_0032114
1867 Ga0587111_0112702
1868 Ga0587111_0153669
1869 2885431646
1870 8057102137

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

15

101

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9182 13 100
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9167 12 97
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9161 12 93
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.904 13 99
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9025 11 99
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8924 13 99 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.865 10 98 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8624 15 99 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8609 12 98 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8552 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A6A5L882-F1-model_v4 deleted 0.9454 9 104
AF-A0A522CJT9-F1-model_v4 Large ribosomal subunit protein uL23 0.9441 11 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E4WGS7-F1-model_v4 Large ribosomal subunit protein uL23 0.9426 11 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C9KLD3-F1-model_v4 Large ribosomal subunit protein uL23 0.9424 9 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6YI82-F1-model_v4 Large ribosomal subunit protein uL23 0.9416 10 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map