F486191

General Info

Members Datasets Scaffolds Average Seq Length
936 590 1872 139

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1016155|Ga0055540_10161552
Length 152
Sequence MKKITIGEASRKSGVKVPTIRYYESIGLLAEPNRSEGNQRSYEPADLRRLAFIRHARELGFEVEAIRTLLTLQDDPHQSCASADAIAKARLIEVEQRIRSLMALKAELELMVEGCGHGRVDQCRVIEVLADHGQCSHAHHSRWNEIGRLQGA

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
80 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
81 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
180 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
181 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
182 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
183 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
184 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
185 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
186 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
187 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
302 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
321 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
322 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
331 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
336 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 2508501050 Microvirga lupini Lut6 Isolate Nodule
341 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
342 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
343 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
344 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
345 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
346 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
347 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
348 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
349 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
350 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
351 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
352 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
353 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
354 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
355 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
356 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
357 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
358 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
359 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
360 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
361 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
362 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
363 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
364 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
365 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
366 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
367 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
368 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
369 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
370 2519899620 Rhizobium sp. Pop5 Isolate Nodule
371 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
372 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
373 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
374 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
375 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
376 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
377 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
378 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
379 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
380 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
381 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
382 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
383 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
384 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
385 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
386 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
387 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
388 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
389 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
390 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
391 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
392 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
393 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
394 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
395 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
396 2643221582 Rhizobium sp. Root651 Isolate Unclassified
397 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
398 2643221599 Rhizobium sp. Root708 Isolate Unclassified
399 2643221607 Rhizobium sp. Root73 Isolate Unclassified
400 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
401 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
402 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
403 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
404 2643221688 Rhizobium sp. Root482 Isolate Unclassified
405 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
406 2718217882 Rhizobium sp. N741 Isolate Nodule
407 2718217927 Rhizobium sp. N324 Isolate Nodule
408 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
409 2718218009 Rhizobium sp. N561 Isolate Nodule
410 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
411 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
412 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
413 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
414 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
415 2718218363 Rhizobium sp. N113 Isolate Nodule
416 2718218365 Rhizobium sp. N731 Isolate Nodule
417 2718218366 Rhizobium sp. N621 Isolate Nodule
418 2718218423 Rhizobium sp. N941 Isolate Nodule
419 2721755514 Rhizobium sp. N6212 Isolate Nodule
420 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
421 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
422 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
423 2721755809 Rhizobium sp. N541 Isolate Nodule
424 2721755810 Rhizobium sp. N871 Isolate Nodule
425 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
426 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
427 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
428 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
429 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
430 2728369365 Rhizobium sp. N1341 Isolate Nodule
431 2728369397 Rhizobium sp. N1314 Isolate Nodule
432 2738541293 Rhizobium sp. GV031 Isolate Unclassified
433 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
434 2751185800 Brucella pituitosa AA2 Isolate Unclassified
435 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
436 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
437 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
438 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
439 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
440 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
441 2791355256 Rhizobium sp. M10 Isolate Nodule
442 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
443 2791355260 Rhizobium sp. L9 Isolate Nodule
444 2791355261 Rhizobium sp. J15 Isolate Nodule
445 2791355262 Rhizobium sp. M1 Isolate Nodule
446 2791355263 Rhizobium chutanense C5 Isolate Nodule
447 2791355264 Rhizobium sp. S9 Isolate Nodule
448 2791355265 Rhizobium sp. H4 Isolate Nodule
449 2791355266 Rhizobium sp. L43 Isolate Nodule
450 2791355267 Rhizobium sp. L18 Isolate Nodule
451 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
452 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
453 2802429633 Rhizobium anhuiense J3 Isolate Nodule
454 2802429634 Rhizobium anhuiense S10 Isolate Nodule
455 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
456 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
457 2802429637 Rhizobium anhuiense C15 Isolate Nodule
458 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
459 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
460 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
461 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
462 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
463 2838048938 Rhizobium pisi 27/80 Isolate Nodule
464 2838061910 Rhizobium phaseoli L15 Isolate Nodule
465 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
466 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
467 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
468 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
469 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
470 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
471 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
472 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
473 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
474 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
475 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
476 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
477 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
478 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
479 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
480 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
481 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
482 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
483 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
484 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
485 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
486 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
487 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
488 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
489 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
490 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
491 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
492 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
493 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
494 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
495 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
496 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
497 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
498 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
499 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
500 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
501 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
502 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
503 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
504 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
505 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
506 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
507 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
508 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
509 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
510 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
511 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
512 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
513 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
514 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
515 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
516 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
517 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
518 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
519 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
520 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
521 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
522 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
523 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
524 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
525 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
526 2854911287 Brucella lupini LUP21 Isolate Unclassified
527 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
528 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
529 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
530 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
531 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
532 2902330777 Methylobacterium sp. 2A Isolate Unclassified
533 2909042592 Labrys sp. LIt4 Isolate Nodule
534 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
535 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
536 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
537 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
538 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
539 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
540 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
541 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
542 2933599457 Rhizobium phaseoli M3 Isolate Nodule
543 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
544 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
545 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
546 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
547 2936381700 Rhizobium chutanense C16 Isolate Unclassified
548 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
549 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
550 2996887358 Rhizobium sp. R711 Isolate Nodule
551 2996893221 Rhizobium sp. R635 Isolate Nodule
552 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
553 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
554 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
555 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
556 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
557 8005258706 Rhizobium sp. R693 Isolate Nodule
558 8005275841 Rhizobium sp. N4311 Isolate Nodule
559 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
560 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
561 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
562 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
563 8005321885 Rhizobium sp. R72 Isolate Nodule
564 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
565 8005382845 Rhizobium sp. R634 Isolate Nodule
566 8005395548 Rhizobium sp. R339 Isolate Nodule
567 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
568 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
569 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
570 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
571 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
572 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
573 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
574 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
575 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
576 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
577 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
578 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
579 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
580 8018176218 Rhizobium sp. N122 Isolate Nodule
581 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
582 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
583 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
584 8024501048 Rhizobium sp. H4 Isolate Nodule
585 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
586 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
587 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
588 8056382006 Rhizobium croatiense 13T Isolate Nodule
589 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
590 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.65
Metatranscriptomes 0.53
Isolates 26.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.9
Nodule 20.09
Rhizoplane 3.31
Rhizosphere 40.38
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1016155 3300003792 Bacteria 2137
2 JGI24739J22299_10169441 3300001989 Bacteria 643
3 JGI25158J39367_1000156 3300002739 Bacteria 16077
4 JGI25158J39367_1023945 3300002739 Bacteria 726
5 JGI25152J39213_1002447 3300002773 Bacteria 7061
6 JGI25152J39213_1003416 3300002773 Bacteria 5434
7 JGI25152J39213_1005458 3300002773 Bacteria 3701
8 JGI25152J39213_1012115 3300002773 Bacteria 1868
9 JGI25152J39213_1019373 3300002773 Bacteria 1239
10 JGI25152J39213_1038722 3300002773 Bacteria 683
11 JGI25150J39212_1000376 3300002774 Bacteria 21519
12 JGI25150J39212_1007713 3300002774 Bacteria 2146
13 JGI25159J45721_1000289 3300002987 Bacteria 23616
14 JGI25159J45721_1012926 3300002987 Bacteria 1961
15 JGI25151J46595_10000656 3300003187 Bacteria 29464
16 JGI25151J46595_10000704 3300003187 Bacteria 28016
17 JGI25151J46595_10001635 3300003187 Bacteria 14771
18 JGI25151J46595_10054088 3300003187 Bacteria 1335
19 JGI25165J46597_1000093 3300003214 Bacteria 164901
20 JGI25153J46596_10000834 3300003215 Bacteria 18821
21 JGI25153J46596_10001010 3300003215 Bacteria 17125
22 JGI25153J46596_10001574 3300003215 Bacteria 13519
23 JGI25153J46596_10003737 3300003215 Bacteria 8404
24 JGI25153J46596_10100036 3300003215 Bacteria 683
25 rootH2_10160607 3300003320 Bacteria 1436
26 rootL2_10068419 3300003322 Bacteria 1174
27 JGI25160J50197_1000004 3300003354 Bacteria 419797
28 JGI25160J50197_1000922 3300003354 Bacteria 15451
29 JGI25160J50197_1012902 3300003354 Bacteria 2875
30 JGI25160J50197_1027755 3300003354 Bacteria 1533
31 JGI25161J50226_1000003 3300003374 Bacteria 413345
32 JGI25161J50226_1000126 3300003374 Bacteria 54396
33 JGI25161J50226_1000129 3300003374 Bacteria 53598
34 Ga0006562J51391_1006656 3300003578 Bacteria 2329
35 Ga0055526_1001177 3300003771 Bacteria 18950
36 Ga0055526_1005899 3300003771 Bacteria 6855
37 Ga0055526_1008782 3300003771 Bacteria 4977
38 Ga0055526_1011242 3300003771 Bacteria 4058
39 Ga0055526_1053697 3300003771 Bacteria 900
40 Ga0055524_1000937 3300003775 Bacteria 18722
41 Ga0055524_1007462 3300003775 Bacteria 4638
42 Ga0055524_1009071 3300003775 Bacteria 4079
43 Ga0055524_1010954 3300003775 Bacteria 3574
44 Ga0055536_1000107 3300003781 Bacteria 73194
45 Ga0055528_1000176 3300003790 Bacteria 54005
46 Ga0055528_1000538 3300003790 Bacteria 28947
47 Ga0055528_1003961 3300003790 Bacteria 7255
48 Ga0055528_1022068 3300003790 Bacteria 1994
49 Ga0055528_1050624 3300003790 Bacteria 843
50 Ga0055530_10000101 3300003791 Bacteria 73195
51 Ga0055540_1000895 3300003792 Bacteria 19643
52 Ga0055540_1014064 3300003792 Bacteria 2408
53 Ga0055540_1034534 3300003792 Bacteria 1137
54 Ga0055531_10030946 3300003794 Bacteria 1784
55 Ga0055543_1000001 3300004625 Bacteria 419949
56 Ga0055543_1000029 3300004625 Bacteria 131452
57 Ga0055543_1001118 3300004625 Bacteria 11531
58 Ga0065165_1000736 3300005262 Bacteria 45533
59 Ga0065165_1005982 3300005262 Bacteria 6566
60 Ga0065165_1018789 3300005262 Bacteria 2489
61 Ga0065165_1039670 3300005262 Bacteria 1408
62 Ga0070670_100402750 3300005331 Bacteria 1208
63 Ga0070680_100034990 3300005336 Bacteria 4053
64 Ga0070660_100014153 3300005339 Bacteria 5743
65 Ga0070660_100425894 3300005339 Bacteria 1099
66 Ga0070668_100094514 3300005347 Bacteria 2360
67 Ga0070668_100941239 3300005347 Bacteria 774
68 Ga0070669_100011959 3300005353 Bacteria 6160
69 Ga0070669_100541490 3300005353 Bacteria 970
70 Ga0070669_100676537 3300005353 Bacteria 870
71 Ga0070671_100180837 3300005355 Bacteria 1785
72 Ga0070673_101948046 3300005364 Bacteria 557
73 Ga0070659_100010845 3300005366 Bacteria 6718
74 Ga0070667_100129235 3300005367 Bacteria 2204
75 Ga0070667_100690354 3300005367 Bacteria 944
76 Ga0070705_100009646 3300005440 Bacteria 4806
77 Ga0070663_100006289 3300005455 Bacteria 7123
78 Ga0070663_101337152 3300005455 Bacteria 633
79 Ga0070662_100931936 3300005457 Bacteria 742
80 Ga0070681_10019675 3300005458 Bacteria 6761
81 Ga0070707_100343122 3300005468 Bacteria 1451
82 Ga0070698_100057412 3300005471 Bacteria 3939
83 Ga0070699_100354192 3300005518 Bacteria 1323
84 Ga0070684_100827026 3300005535 Bacteria 866
85 Ga0070697_101909112 3300005536 Bacteria 531
86 Ga0068853_100003919 3300005539 Bacteria 11420
87 Ga0068853_100024100 3300005539 Bacteria 5100
88 Ga0070672_101378820 3300005543 Bacteria 630
89 Ga0070696_100004480 3300005546 Bacteria 9328
90 Ga0070693_100026580 3300005547 Bacteria 3126
91 Ga0070665_100454246 3300005548 Bacteria 1291
92 Ga0070665_101631223 3300005548 Unclassified 653
93 Ga0068855_100739446 3300005563 Bacteria 1050
94 Ga0070664_100033307 3300005564 Bacteria 4315
95 Ga0068857_100030450 3300005577 Bacteria 4765
96 Ga0068854_100606227 3300005578 Bacteria 935
97 Ga0068854_102262030 3300005578 Unclassified 503
98 Ga0068856_100664807 3300005614 Bacteria 1062
99 Ga0068852_100414281 3300005616 Bacteria 1328
100 Ga0068859_100457434 3300005617 Bacteria 1372
101 Ga0068859_101587054 3300005617 Unclassified 723
102 Ga0068864_100115608 3300005618 Bacteria 2393
103 Ga0068866_10290424 3300005718 Bacteria 1017
104 Ga0068858_100211401 3300005842 Bacteria 1836
105 Ga0068858_100292680 3300005842 Bacteria 1552
106 Ga0068860_100066480 3300005843 Bacteria 3424
107 Ga0068860_101199930 3300005843 Unclassified 779
108 Ga0081455_10141592 3300005937 Bacteria 1867
109 Ga0075365_10000344 3300006038 Bacteria 16625
110 Ga0075365_10046809 3300006038 Bacteria 2842
111 Ga0075365_10640457 3300006038 Unclassified 751
112 Ga0075363_100086412 3300006048 Bacteria 1722
113 Ga0075363_100134671 3300006048 Bacteria 1388
114 Ga0075364_10519371 3300006051 Bacteria 814
115 Ga0075362_10027133 3300006177 Bacteria 2450
116 Ga0075362_10121052 3300006177 Bacteria 1239
117 Ga0075362_10378224 3300006177 Bacteria 712
118 Ga0075367_10007667 3300006178 Bacteria 5546
119 Ga0075367_10028827 3300006178 Bacteria 3170
120 Ga0075369_10014468 3300006186 Bacteria 3151
121 Ga0075369_10058840 3300006186 Bacteria 1673
122 Ga0075369_10069533 3300006186 Bacteria 1548
123 Ga0075366_10013787 3300006195 Bacteria 4607
124 Ga0075366_10267202 3300006195 Bacteria 1044
125 Ga0075366_10485222 3300006195 Bacteria 764
126 Ga0075370_10013808 3300006353 Bacteria 4297
127 Ga0075370_10055596 3300006353 Bacteria 2249
128 Ga0075370_10108331 3300006353 Bacteria 1612
129 Ga0075370_10573464 3300006353 Bacteria 683
130 Ga0075370_10578356 3300006353 Bacteria 680
131 Ga0075370_10724730 3300006353 Bacteria 605
132 Ga0068865_100662895 3300006881 Bacteria 888
133 Ga0097620_100457445 3300006931 Bacteria 1372
134 Ga0097620_101587104 3300006931 Unclassified 723
135 Ga0075435_101350772 3300007076 Bacteria 624
136 Ga0105251_10021731 3300009011 Bacteria 3344
137 Ga0105244_10282590 3300009036 Bacteria 770
138 Ga0105250_10023603 3300009092 Bacteria 2478
139 Ga0105245_10261033 3300009098 Bacteria 1686
140 Ga0105243_10491095 3300009148 Bacteria 1161
141 Ga0105243_10881800 3300009148 Bacteria 888
142 Ga0105241_10057509 3300009174 Bacteria 2984
143 Ga0105242_11760297 3300009176 Unclassified 657
144 Ga0105237_10016439 3300009545 Bacteria 7686
145 Ga0105238_10017333 3300009551 Bacteria 7319
146 Ga0105238_10053574 3300009551 Bacteria 4053
147 Ga0105238_11621022 3300009551 Bacteria 677
148 Ga0105249_11979504 3300009553 Bacteria 655
149 Ga0123340_1043851 3300009763 Bacteria 1931
150 Ga0123341_1000053 3300009765 Bacteria 49025
151 Ga0123341_1058903 3300009765 Bacteria 1939
152 Ga0123342_1017765 3300009766 Bacteria 5841
153 Ga0123342_1018522 3300009766 Bacteria 5518
154 Ga0105239_10335229 3300010375 Bacteria 1707
155 Ga0105239_11151252 3300010375 Bacteria 893
156 Ga0105239_11436931 3300010375 Bacteria 796
157 Ga0105239_12312677 3300010375 Bacteria 626
158 Ga0105246_10002913 3300011119 Bacteria 10354
159 Ga0105246_10892687 3300011119 Bacteria 796
160 Ga0157325_1005947 3300012485 Bacteria 770
161 Ga0157370_10625609 3300013104 Bacteria 985
162 Ga0157369_10165601 3300013105 Bacteria 2332
163 Ga0157369_10528477 3300013105 Bacteria 1220
164 Ga0157372_10517152 3300013307 Bacteria 1392
165 Ga0157372_11544230 3300013307 Bacteria 765
166 Ga0157375_10387814 3300013308 Bacteria 1564
167 Ga0163163_10553382 3300014325 Bacteria 1213
168 Ga0157380_11343825 3300014326 Bacteria 763
169 Ga0157376_10383854 3300014969 Bacteria 1354
170 Ga0182005_1003645 3300015265 Bacteria 5171
171 Ga0163161_10318647 3300017792 Bacteria 1229
172 Ga0209436_100026 3300025208 Bacteria 90859
173 Ga0209436_118314 3300025208 Bacteria 999
174 Ga0207425_1000058 3300025245 Bacteria 149214
175 Ga0207425_1002251 3300025245 Bacteria 6982
176 Ga0207425_1005931 3300025245 Bacteria 3411
177 Ga0207425_1015674 3300025245 Bacteria 1696
178 Ga0209129_1000107 3300025258 Bacteria 154705
179 Ga0209129_1000242 3300025258 Bacteria 58534
180 Ga0209129_1000641 3300025258 Bacteria 23426
181 Ga0209129_1000978 3300025258 Bacteria 17127
182 Ga0209129_1002513 3300025258 Bacteria 8943
183 Ga0209129_1015162 3300025258 Bacteria 1600
184 Ga0209233_1000053 3300025261 Bacteria 444909
185 Ga0209673_1001128 3300025273 Bacteria 29524
186 Ga0209673_1001602 3300025273 Bacteria 19869
187 Ga0209673_1001972 3300025273 Bacteria 16031
188 Ga0209673_1002378 3300025273 Bacteria 13215
189 Ga0209673_1004897 3300025273 Bacteria 6976
190 Ga0209673_1008063 3300025273 Bacteria 4740
191 Ga0209673_1008142 3300025273 Bacteria 4711
192 Ga0209673_1028138 3300025273 Bacteria 1816
193 Ga0209130_1000012 3300025284 Bacteria 421329
194 Ga0209130_1000030 3300025284 Bacteria 323323
195 Ga0209130_1007072 3300025284 Bacteria 3523
196 Ga0209130_1010551 3300025284 Bacteria 2536
197 Ga0209130_1024111 3300025284 Bacteria 1333
198 Ga0209675_1101295 3300025291 Bacteria 508
199 Ga0209676_1000207 3300025292 Bacteria 130882
200 Ga0209676_1027870 3300025292 Bacteria 1770
201 Ga0209025_1000083 3300025294 Bacteria 265556
202 Ga0209025_1001249 3300025294 Bacteria 35273
203 Ga0209025_1001681 3300025294 Bacteria 27032
204 Ga0209025_1016147 3300025294 Bacteria 4436
205 Ga0209025_1016421 3300025294 Bacteria 4370
206 Ga0209025_1017804 3300025294 Bacteria 4074
207 Ga0209025_1045572 3300025294 Bacteria 1816
208 Ga0209564_1000207 3300025295 Bacteria 135313
209 Ga0209564_1001203 3300025295 Bacteria 29524
210 Ga0209564_1001863 3300025295 Bacteria 19108
211 Ga0209564_1005848 3300025295 Bacteria 6842
212 Ga0209564_1017548 3300025295 Bacteria 2782
213 Ga0209564_1024690 3300025295 Bacteria 2047
214 Ga0209758_1000090 3300025297 Bacteria 246564
215 Ga0209758_1000586 3300025297 Bacteria 56819
216 Ga0209758_1000906 3300025297 Bacteria 40219
217 Ga0209758_1001057 3300025297 Bacteria 35976
218 Ga0209758_1001508 3300025297 Bacteria 27032
219 Ga0209758_1003633 3300025297 Bacteria 13779
220 Ga0209758_1022975 3300025297 Bacteria 2837
221 Ga0209758_1027633 3300025297 Bacteria 2419
222 Ga0209758_1036477 3300025297 Bacteria 1918
223 Ga0209758_1109847 3300025297 Bacteria 765
224 Ga0209050_1000056 3300025298 Bacteria 338703
225 Ga0209050_1011914 3300025298 Bacteria 4056
226 Ga0209256_1001204 3300025299 Bacteria 28959
227 Ga0209256_1001765 3300025299 Bacteria 20571
228 Ga0209256_1002582 3300025299 Bacteria 14431
229 Ga0209256_1011967 3300025299 Bacteria 3393
230 Ga0209256_1013491 3300025299 Bacteria 3026
231 Ga0209256_1028310 3300025299 Bacteria 1582
232 Ga0209256_1065658 3300025299 Bacteria 831
233 Ga0207426_1000010 3300025302 Bacteria 796003
234 Ga0207426_1000047 3300025302 Bacteria 417011
235 Ga0207426_1000863 3300025302 Bacteria 31669
236 Ga0207426_1001722 3300025302 Bacteria 16752
237 Ga0209051_1000848 3300025303 Bacteria 31351
238 Ga0209051_1006355 3300025303 Bacteria 6685
239 Ga0209051_1009119 3300025303 Bacteria 5150
240 Ga0209051_1020322 3300025303 Bacteria 2863
241 Ga0209051_1021835 3300025303 Bacteria 2711
242 Ga0209051_1027828 3300025303 Bacteria 2244
243 Ga0209051_1033690 3300025303 Bacteria 1932
244 Ga0209257_1017108 3300025304 Bacteria 2880
245 Ga0209257_1021673 3300025304 Bacteria 2324
246 Ga0207713_1187939 3300025735 Bacteria 641
247 Ga0207647_10045737 3300025904 Bacteria 2730
248 Ga0207647_10476116 3300025904 Bacteria 698
249 Ga0207645_10310279 3300025907 Bacteria 1051
250 Ga0207707_10294368 3300025912 Bacteria 1404
251 Ga0207695_10350716 3300025913 Bacteria 1363
252 Ga0207671_10068640 3300025914 Bacteria 2642
253 Ga0207660_10025282 3300025917 Bacteria 4029
254 Ga0207657_10927915 3300025919 Bacteria 670
255 Ga0207646_11178818 3300025922 Bacteria 672
256 Ga0207681_10941769 3300025923 Bacteria 724
257 Ga0207694_10025999 3300025924 Bacteria 4451
258 Ga0207694_11330699 3300025924 Bacteria 607
259 Ga0207687_10568366 3300025927 Bacteria 953
260 Ga0207644_10694239 3300025931 Bacteria 848
261 Ga0207690_10147912 3300025932 Bacteria 1738
262 Ga0207706_10860041 3300025933 Bacteria 768
263 Ga0207709_10616986 3300025935 Bacteria 860
264 Ga0207704_10096185 3300025938 Bacteria 1960
265 Ga0207689_10155075 3300025942 Bacteria 1888
266 Ga0207651_11862056 3300025960 Bacteria 541
267 Ga0207712_10092003 3300025961 Bacteria 2235
268 Ga0207668_10075839 3300025972 Bacteria 2419
269 Ga0207668_10410212 3300025972 Bacteria 1147
270 Ga0207668_10632043 3300025972 Bacteria 935
271 Ga0207640_11523438 3300025981 Bacteria 601
272 Ga0207658_10033358 3300025986 Bacteria 3673
273 Ga0207658_10566046 3300025986 Bacteria 1018
274 Ga0207658_10642574 3300025986 Bacteria 956
275 Ga0207703_10042785 3300026035 Bacteria 3634
276 Ga0207639_10053431 3300026041 Bacteria 3082
277 Ga0207639_10661115 3300026041 Bacteria 967
278 Ga0207678_10000157 3300026067 Bacteria 56289
279 Ga0207678_10138811 3300026067 Bacteria 2074
280 Ga0207708_10944052 3300026075 Bacteria 748
281 Ga0207648_10034603 3300026089 Bacteria 4453
282 Ga0207676_11192462 3300026095 Bacteria 754
283 Ga0207674_10088890 3300026116 Bacteria 3082
284 Ga0207698_10777722 3300026142 Bacteria 958
285 Ga0209813_10179140 3300027866 Bacteria 774
286 Ga0268266_10716503 3300028379 Unclassified 965
287 Ga0268265_11811028 3300028380 Bacteria 617
288 Ga0268264_10542923 3300028381 Bacteria 1139
289 Ga0307515_10004490 3300028794 Bacteria 28866
290 Ga0307515_10009918 3300028794 Bacteria 18339
291 Ga0307515_10588462 3300028794 Bacteria 723
292 Ga0265339_10109627 3300031249 Bacteria 1429
293 Ga0307513_10009932 3300031456 Bacteria 12005
294 Ga0307509_10662743 3300031507 Bacteria 712
295 Ga0307408_100069508 3300031548 Bacteria 2597
296 Ga0307408_101158461 3300031548 Bacteria 719
297 Ga0307408_101670181 3300031548 Bacteria 606
298 Ga0307408_102414519 3300031548 Bacteria 510
299 Ga0265314_10072733 3300031711 Bacteria 2295
300 Ga0307516_10536275 3300031730 Bacteria 824
301 Ga0307405_10000748 3300031731 Bacteria 12651
302 Ga0307413_10329688 3300031824 Bacteria 1170
303 Ga0307413_11047500 3300031824 Bacteria 702
304 Ga0307410_10126140 3300031852 Bacteria 1874
305 Ga0307412_10011024 3300031911 Bacteria 5222
306 Ga0307412_10087225 3300031911 Bacteria 2174
307 Ga0307412_10881421 3300031911 Bacteria 783
308 Ga0307412_11149789 3300031911 Bacteria 693
309 Ga0307409_102582860 3300031995 Bacteria 536
310 Ga0307416_100117362 3300032002 Bacteria 2362
311 Ga0307416_101037079 3300032002 Bacteria 924
312 Ga0307414_10564007 3300032004 Unclassified 1016
313 Ga0307414_11109775 3300032004 Bacteria 730
314 Ga0307414_11120445 3300032004 Bacteria 727
315 Ga0307510_10086142 3300033180 Bacteria 3015
316 Ga0373927_0003649 3300035695 Bacteria 10970
317 Ga0373925_0009133 3300037068 Bacteria 7214
318 Ga0395899_0170275 3300037312 Bacteria 1534
319 Ga0395900_0072319 3300037418 Bacteria 3546
320 Ga0395898_0275500 3300037466 Bacteria 1605
321 Ga0395905_0554580 3300037471 Bacteria 1050
322 Ga0395901_0562970 3300038443 Bacteria 1154
323 Ga0395901_0900437 3300038443 Bacteria 867
324 Ga0439436_0000963 3300041404 Bacteria 7952
325 Ga0439436_0140660 3300041404 Bacteria 679
326 Ga0439438_031564 3300041405 Bacteria 1407
327 Ga0439439_0035850 3300041406 Bacteria 1275
328 Ga0439439_0086811 3300041406 Bacteria 851
329 Ga0439447_036102 3300041407 Bacteria 1222
330 Ga0439466_0087093 3300041411 Bacteria 981
331 Ga0439465_0005577 3300041413 Bacteria 4010
332 Ga0439465_0005721 3300041413 Bacteria 3956
333 Ga0439465_0007365 3300041413 Bacteria 3496
334 Ga0439465_0170821 3300041413 Bacteria 783
335 Ga0451787_113315 3300041441 Bacteria 1938
336 Ga0451791_1153726 3300041451 Bacteria 1136
337 Ga0451793_1088729 3300041452 Bacteria 628
338 Ga0451795_1473170 3300041456 Bacteria 718
339 Ga0451798_0975016 3300041458 Bacteria 936
340 Ga0451802_1584020 3300041460 Bacteria 1274
341 Ga0451802_2164276 3300041460 Bacteria 900
342 Ga0451833_0053958 3300041491 Bacteria 1969
343 Ga0451835_0713625 3300041492 Bacteria 2714
344 Ga0451837_0645113 3300041494 Bacteria 2791
345 Ga0451839_0651082 3300041496 Bacteria 3304
346 Ga0451840_04203 3300041497 Bacteria 738
347 Ga0451841_0987990 3300041498 Bacteria 2235
348 Ga0451841_1203610 3300041498 Bacteria 1741
349 Ga0451845_0001320 3300041501 Bacteria 2936
350 Ga0451846_46275 3300041502 Bacteria 863
351 Ga0451847_0236951 3300041503 Bacteria 2782
352 Ga0451847_0330292 3300041503 Bacteria 2676
353 Ga0451849_0485431 3300041505 Bacteria 1026
354 Ga0451849_1333050 3300041505 Bacteria 1519
355 Ga0451851_1283676 3300041507 Bacteria 2119
356 Ga0451854_21428 3300041510 Bacteria 523
357 Ga0451855_0899849 3300041511 Bacteria 2135
358 Ga0451855_0961775 3300041511 Bacteria 2238
359 Ga0451855_1273012 3300041511 Bacteria 1058
360 Ga0451853_0147227 3300041512 Bacteria 6003
361 Ga0439433_0116224 3300041999 Bacteria 672
362 Ga0439441_005659 3300042001 Bacteria 1954
363 Ga0439445_0029619 3300042004 Bacteria 1416
364 Ga0439432_041592 3300042006 Bacteria 1455
365 Ga0439449_0046476 3300042007 Bacteria 1608
366 Ga0439462_0009503 3300042015 Bacteria 2459
367 Ga0439462_0098227 3300042015 Bacteria 806
368 Ga0450919_035500 3300042121 Bacteria 575
369 Ga0450910_038664 3300042147 Bacteria 766
370 Ga0450910_070239 3300042147 Bacteria 601
371 Ga0439434_0008546 3300042435 Bacteria 3005
372 Ga0450918_011784 3300042531 Bacteria 1522
373 Ga0466972_0102584 3300044658 Bacteria 1353
374 Ga0451576_0018064 3300045051 Bacteria 7740
375 Ga0495617_033696 3300046452 Bacteria 1719
376 Ga0495617_068391 3300046452 Bacteria 1169
377 Ga0495617_096149 3300046452 Bacteria 964
378 Ga0495592_0351335 3300046454 Bacteria 945
379 Ga0495603_0237138 3300046455 Bacteria 1051
380 Ga0495629_0012399 3300046459 Bacteria 6172
381 Ga0495638_0000296 3300046460 Bacteria 64130
382 Ga0495638_0214805 3300046460 Bacteria 1078
383 Ga0495651_0019542 3300046462 Bacteria 5254
384 Ga0495605_0006821 3300046474 Bacteria 6526
385 Ga0495662_0056000 3300046476 Bacteria 1905
386 Ga0495664_0275424 3300046477 Bacteria 1017
387 Ga0495584_0250841 3300046491 Bacteria 900
388 Ga0495585_0009624 3300046492 Bacteria 5786
389 Ga0495585_0040500 3300046492 Bacteria 2616
390 Ga0495585_0063961 3300046492 Bacteria 2018
391 Ga0495585_0190789 3300046492 Bacteria 1048
392 Ga0495607_0035199 3300046501 Bacteria 3031
393 Ga0495607_0126435 3300046501 Bacteria 1336
394 Ga0495607_0180190 3300046501 Bacteria 1060
395 Ga0495607_0372813 3300046501 Bacteria 654
396 Ga0495607_0516994 3300046501 Bacteria 528
397 Ga0495583_0001838 3300046506 Bacteria 19801
398 Ga0495583_0008756 3300046506 Bacteria 6140
399 Ga0495583_0073237 3300046506 Bacteria 1502
400 Ga0495606_0002584 3300046507 Bacteria 20713
401 Ga0495606_0123000 3300046507 Bacteria 1551
402 Ga0495606_0167603 3300046507 Bacteria 1277
403 Ga0495606_0184915 3300046507 Bacteria 1199
404 Ga0495610_0004612 3300046512 Bacteria 10093
405 Ga0495610_0035409 3300046512 Bacteria 2563
406 Ga0495610_0226803 3300046512 Bacteria 751
407 Ga0495610_0375809 3300046512 Bacteria 529
408 Ga0495616_0022028 3300046513 Bacteria 3444
409 Ga0495616_0026363 3300046513 Bacteria 3095
410 Ga0495618_0386631 3300046514 Bacteria 858
411 Ga0495620_0008509 3300046515 Bacteria 5504
412 Ga0495620_0016318 3300046515 Bacteria 3728
413 Ga0495620_0026408 3300046515 Bacteria 2731
414 Ga0495620_0045442 3300046515 Bacteria 1901
415 Ga0495620_0048910 3300046515 Bacteria 1812
416 Ga0495631_0002209 3300046518 Bacteria 11191
417 Ga0495631_0124812 3300046518 Bacteria 1107
418 Ga0495632_0001452 3300046519 Bacteria 19707
419 Ga0495632_0069859 3300046519 Bacteria 1690
420 Ga0495632_0111823 3300046519 Bacteria 1282
421 Ga0495637_0023542 3300046520 Bacteria 2797
422 Ga0495643_0039506 3300046522 Bacteria 2580
423 Ga0495643_0064722 3300046522 Bacteria 1931
424 Ga0495643_0071758 3300046522 Bacteria 1817
425 Ga0495643_0089983 3300046522 Bacteria 1584
426 Ga0495648_0017276 3300046524 Bacteria 5166
427 Ga0495648_0277934 3300046524 Bacteria 795
428 Ga0495652_0230892 3300046529 Bacteria 1384
429 Ga0495654_0326899 3300046530 Bacteria 621
430 Ga0495587_0154611 3300046536 Bacteria 1307
431 Ga0495609_0063876 3300046538 Bacteria 1625
432 Ga0495609_0104735 3300046538 Bacteria 1224
433 Ga0495597_0008304 3300046542 Bacteria 5206
434 Ga0495622_0043305 3300046557 Bacteria 2093
435 Ga0495633_0006906 3300046558 Bacteria 6643
436 Ga0495633_0095948 3300046558 Bacteria 1378
437 Ga0495633_0280861 3300046558 Bacteria 757
438 Ga0495656_0027533 3300046615 Bacteria 2271
439 Ga0495656_0708123 3300046615 Bacteria 542
440 Ga0495668_0008081 3300046616 Bacteria 6626
441 Ga0495668_0058525 3300046616 Bacteria 2126
442 Ga0495668_0234525 3300046616 Bacteria 1005
443 Ga0495668_0616677 3300046616 Bacteria 599
444 Ga0495611_0124374 3300046648 Bacteria 1203
445 Ga0495625_0013685 3300046660 Bacteria 6506
446 Ga0495625_0015027 3300046660 Bacteria 6150
447 Ga0495625_0046890 3300046660 Bacteria 3117
448 Ga0495625_0241793 3300046660 Bacteria 1175
449 Ga0495625_0250820 3300046660 Bacteria 1149
450 Ga0495625_0280704 3300046660 Bacteria 1072
451 Ga0495625_0540232 3300046660 Bacteria 707
452 Ga0495625_0575349 3300046660 Bacteria 679
453 Ga0495635_0053157 3300046663 Bacteria 2791
454 Ga0495661_0056604 3300046665 Bacteria 2345
455 Ga0495588_0039727 3300046674 Bacteria 2398
456 Ga0495588_0094691 3300046674 Bacteria 1566
457 Ga0495588_0365945 3300046674 Bacteria 757
458 Ga0495657_0110275 3300046675 Bacteria 1744
459 Ga0495658_0129639 3300046683 Bacteria 1534
460 Ga0495624_0165558 3300046690 Bacteria 1350
461 Ga0495670_0095390 3300046691 Bacteria 1526
462 Ga0495670_0518636 3300046691 Bacteria 648
463 Ga0495649_0000562 3300046694 Bacteria 31412
464 Ga0495649_0014939 3300046694 Bacteria 4437
465 Ga0495649_0114673 3300046694 Bacteria 1427
466 Ga0495589_0048925 3300046794 Bacteria 2092
467 Ga0495660_0009569 3300046810 Bacteria 5650
468 Ga0495660_0025021 3300046810 Bacteria 3393
469 Ga0495660_0456852 3300046810 Bacteria 551
470 Ga0495604_0002800 3300047317 Bacteria 13994
471 Ga0495604_0528637 3300047317 Bacteria 762
472 Ga0495636_0062996 3300047318 Bacteria 1570
473 Ga0495636_0509806 3300047318 Bacteria 582
474 Ga0495672_0020030 3300047320 Bacteria 4395
475 Ga0495672_0186384 3300047320 Bacteria 1047
476 Ga0495683_0025277 3300047323 Bacteria 3046
477 Ga0495687_005051 3300047443 Bacteria 8591
478 Ga0495687_043913 3300047443 Bacteria 1945
479 Ga0495687_080463 3300047443 Bacteria 1278
480 Ga0495673_0035415 3300047469 Bacteria 2300
481 Ga0495673_0226246 3300047469 Bacteria 690
482 Ga0495681_0055046 3300047470 Bacteria 1857
483 Ga0495686_0000499 3300047472 Bacteria 57475
484 Ga0495686_0010060 3300047472 Bacteria 6757
485 Ga0495686_0033913 3300047472 Bacteria 3291
486 Ga0495686_0055432 3300047472 Bacteria 2479
487 Ga0495686_0167038 3300047472 Bacteria 1282
488 Ga0495602_0819890 3300048088 Bacteria 624
489 Ga0495615_0065031 3300048090 Bacteria 971
490 Ga0495615_0224585 3300048090 Bacteria 587
491 Ga0495626_0078697 3300048091 Bacteria 1468
492 Ga0496100_0029234 3300048903 Bacteria 3407
493 Ga0496100_0207318 3300048903 Bacteria 1432
494 Ga0496100_1490540 3300048903 Bacteria 534
495 Ga0496101_0046656 3300048904 Bacteria 3108
496 Ga0496101_0312311 3300048904 Bacteria 1232
497 Ga0496102_0163146 3300048905 Bacteria 2096
498 Ga0496102_0481414 3300048905 Bacteria 1162
499 Ga0496103_0412124 3300048906 Bacteria 868
500 Ga0496104_0013543 3300048907 Bacteria 7349
501 Ga0496104_0057309 3300048907 Bacteria 3686
502 Ga0496105_0272863 3300048908 Bacteria 1365
503 Ga0496106_0000244 3300048909 Bacteria 37887
504 Ga0496106_0123280 3300048909 Bacteria 2027
505 Ga0496106_0324637 3300048909 Bacteria 1236
506 Ga0496106_0985211 3300048909 Bacteria 663
507 Ga0496107_0035615 3300048910 Bacteria 3568
508 Ga0496108_0596006 3300048911 Bacteria 963
509 Ga0496109_0810118 3300048912 Bacteria 874
510 Ga0496110_0508351 3300048913 Bacteria 1096
511 Ga0496111_0053967 3300048914 Bacteria 2904
512 Ga0496112_0987679 3300048915 Bacteria 762
513 Ga0496114_0115746 3300048917 Bacteria 2301
514 Ga0496115_0042861 3300048918 Bacteria 3607
515 Ga0496116_0010318 3300048919 Bacteria 7844
516 Ga0496116_0013345 3300048919 Bacteria 6631
517 Ga0496116_0036203 3300048919 Bacteria 3457
518 Ga0496116_0039798 3300048919 Bacteria 3244
519 Ga0496116_0331981 3300048919 Bacteria 706
520 Ga0496116_0441259 3300048919 Bacteria 561
521 Ga0496117_0006246 3300048920 Bacteria 12146
522 Ga0496117_0013341 3300048920 Bacteria 7174
523 Ga0496117_0017114 3300048920 Bacteria 6068
524 Ga0496117_0088462 3300048920 Bacteria 2004
525 Ga0496117_0245431 3300048920 Bacteria 980
526 Ga0496117_0285329 3300048920 Bacteria 882
527 Ga0496117_0307114 3300048920 Bacteria 837
528 Ga0496118_0009587 3300048921 Bacteria 9746
529 Ga0496118_0019719 3300048921 Bacteria 6014
530 Ga0496118_0024359 3300048921 Bacteria 5226
531 Ga0496118_0068104 3300048921 Bacteria 2587
532 Ga0496118_0414189 3300048921 Bacteria 695
533 Ga0496118_0437962 3300048921 Bacteria 667
534 Ga0496118_0584909 3300048921 Bacteria 537
535 Ga0496119_0000147 3300048922 Bacteria 98899
536 Ga0496119_0014534 3300048922 Bacteria 6150
537 Ga0496119_0014869 3300048922 Bacteria 6051
538 Ga0496119_0281749 3300048922 Bacteria 826
539 Ga0496119_0320440 3300048922 Bacteria 759
540 Ga0496120_0070224 3300048923 Bacteria 1927
541 Ga0496120_0110843 3300048923 Bacteria 1434
542 Ga0496121_0016950 3300048924 Bacteria 7484
543 Ga0496121_0018337 3300048924 Bacteria 7063
544 Ga0496121_0022263 3300048924 Bacteria 6163
545 Ga0496121_0038040 3300048924 Bacteria 4267
546 Ga0496121_0059801 3300048924 Bacteria 3139
547 Ga0496121_0077744 3300048924 Bacteria 2641
548 Ga0496121_0162444 3300048924 Bacteria 1632
549 Ga0496121_0335525 3300048924 Bacteria 1012
550 Ga0496121_0452044 3300048924 Bacteria 827
551 Ga0496122_0005563 3300048925 Bacteria 14926
552 Ga0496122_0007952 3300048925 Bacteria 11595
553 Ga0496122_0014820 3300048925 Bacteria 7510
554 Ga0496122_0023196 3300048925 Bacteria 5482
555 Ga0496122_0041782 3300048925 Bacteria 3618
556 Ga0496122_0042878 3300048925 Bacteria 3553
557 Ga0496122_0047123 3300048925 Bacteria 3330
558 Ga0496122_0074733 3300048925 Bacteria 2395
559 Ga0496122_0299973 3300048925 Bacteria 867
560 Ga0496123_0002327 3300048926 Bacteria 23843
561 Ga0496123_0008901 3300048926 Bacteria 9131
562 Ga0496123_0025366 3300048926 Bacteria 4471
563 Ga0496123_0039235 3300048926 Bacteria 3315
564 Ga0496123_0102767 3300048926 Bacteria 1657
565 Ga0496123_0175901 3300048926 Bacteria 1123
566 Ga0496123_0293981 3300048926 Bacteria 778
567 Ga0496124_0001919 3300048927 Bacteria 28475
568 Ga0496124_0030484 3300048927 Bacteria 4786
569 Ga0496124_0093011 3300048927 Bacteria 2455
570 Ga0496124_0167132 3300048927 Bacteria 1708
571 Ga0496124_0266096 3300048927 Bacteria 1258
572 Ga0496124_0298813 3300048927 Bacteria 1164
573 Ga0496124_0382599 3300048927 Bacteria 983
574 Ga0496124_0723896 3300048927 Bacteria 627
575 Ga0496125_0039991 3300048928 Bacteria 4029
576 Ga0496125_0063847 3300048928 Bacteria 2932
577 Ga0496125_0169663 3300048928 Bacteria 1469
578 Ga0496125_0178776 3300048928 Bacteria 1416
579 Ga0496125_0226468 3300048928 Bacteria 1200
580 Ga0496125_0611919 3300048928 Bacteria 593
581 Ga0496125_0627089 3300048928 Bacteria 583
582 Ga0496126_0090632 3300048929 Bacteria 2690
583 Ga0496126_0336622 3300048929 Bacteria 1237
584 Ga0496126_0408972 3300048929 Bacteria 1099
585 Ga0496126_0610200 3300048929 Bacteria 858
586 Ga0496126_0766014 3300048929 Bacteria 744
587 Ga0495678_018075 3300049459 Bacteria 3178
588 Ga0495678_019492 3300049459 Bacteria 3025
589 Ga0495682_0297072 3300049460 Bacteria 570
590 Ga0501302_033182 3300049525 Bacteria 500
591 Ga0501032_0011350 3300049569 Bacteria 6399
592 Ga0501032_0175431 3300049569 Bacteria 1404
593 Ga0501033_0286954 3300049570 Bacteria 1161
594 Ga0501034_0000658 3300049571 Bacteria 53079
595 Ga0501034_0003308 3300049571 Bacteria 18397
596 Ga0501034_0110708 3300049571 Bacteria 2737
597 Ga0501034_0128893 3300049571 Bacteria 2514
598 Ga0501034_0186205 3300049571 Bacteria 2039
599 Ga0501034_0506798 3300049571 Bacteria 1120
600 Ga0501036_0067881 3300049572 Bacteria 3017
601 Ga0501036_0411460 3300049572 Bacteria 1128
602 Ga0501037_0321965 3300049573 Bacteria 1070
603 Ga0501038_0014869 3300049574 Bacteria 7088
604 Ga0501038_0807611 3300049574 Bacteria 697
605 Ga0501043_0067798 3300049579 Bacteria 2802
606 Ga0501043_0098115 3300049579 Bacteria 2303
607 Ga0501043_0433736 3300049579 Bacteria 989
608 Ga0501046_0199215 3300049580 Bacteria 1490
609 Ga0501047_0057610 3300049581 Bacteria 3757
610 Ga0501047_0105306 3300049581 Bacteria 2701
611 Ga0501047_1148692 3300049581 Unclassified 590
612 Ga0501068_0159306 3300049584 Bacteria 1422
613 Ga0501072_0016707 3300049588 Bacteria 5638
614 Ga0501074_1122437 3300049590 Bacteria 552
615 Ga0501238_018554 3300049671 Bacteria 974
616 Ga0501252_005395 3300049682 Bacteria 1389
617 Ga0501080_0142547 3300049742 Bacteria 2215
618 Ga0501080_1344338 3300049742 Bacteria 611
619 Ga0501083_0016474 3300049744 Bacteria 5173
620 Ga0501083_0143290 3300049744 Bacteria 1564
621 Ga0501083_0145859 3300049744 Bacteria 1549
622 Ga0501083_0287906 3300049744 Bacteria 1068
623 Ga0501035_0169023 3300049822 Bacteria 1890
624 Ga0501035_0280731 3300049822 Bacteria 1408
625 Ga0501035_1332923 3300049822 Bacteria 552
626 Ga0501044_0043037 3300049823 Bacteria 4693
627 Ga0501044_0061924 3300049823 Plasmid 3827
628 Ga0501044_0564741 3300049823 Bacteria 1034
629 Ga0501044_0845699 3300049823 Bacteria 792
630 nmdc:mga03683_30333_c1 3300050489 Bacteria 2163
631 nmdc:mga03n38_41578_c1 3300050490 Bacteria 2004
632 nmdc:mga03n38_86289_c1 3300050490 Bacteria 1485
633 nmdc:mga00v17_411043_c1 3300050491 Bacteria 879
634 nmdc:mga0yw44_220864_c1 3300050492 Bacteria 1256
635 nmdc:mga0yw44_359708_c1 3300050492 Bacteria 981
636 nmdc:mga0yw44_453148_c1 3300050492 Bacteria 869
637 nmdc:mga0yw44_820724_c1 3300050492 Bacteria 631
638 nmdc:mga0k408_469413_c1 3300050493 Bacteria 747
639 nmdc:mga0k408_736010_c1 3300050493 Bacteria 576
640 nmdc:mga04h51_206423_c1 3300050495 Bacteria 774
641 nmdc:mga07m45_23901_c2 3300050496 Bacteria 1785
642 nmdc:mga07m45_24786_c1 3300050496 Bacteria 3288
643 nmdc:mga07m45_254516_c1 3300050496 Bacteria 648
644 nmdc:mga07m45_370585_c1 3300050496 Bacteria 832
645 nmdc:mga08y16_1184410_c1 3300050511 Bacteria 735
646 nmdc:mga0sz30_23018_c1 3300050516 Bacteria 2532
647 nmdc:mga0sz30_241737_c1 3300050516 Bacteria 803
648 nmdc:mga0sz30_79546_c1 3300050516 Bacteria 1418
649 Ga0500610_0120842 3300053079 Bacteria 1339
650 Ga0495619_0085558 3300053085 Bacteria 2130
651 Ga0495619_0423889 3300053085 Bacteria 918
652 Ga0500578_0082610 3300053086 Bacteria 2042
653 Ga0500651_0065253 3300053093 Bacteria 2269
654 Ga0500556_0000142 3300053104 Bacteria 59905
655 Ga0500557_000489 3300053105 Bacteria 5267
656 Ga0500569_008129 3300053109 Bacteria 2388
657 Ga0500569_295334 3300053109 Bacteria 545
658 Ga0500594_0005197 3300053118 Bacteria 2883
659 Ga0500594_0046685 3300053118 Bacteria 1205
660 Ga0500595_116204 3300053119 Unclassified 758
661 Ga0500608_147272 3300053122 Bacteria 1036
662 Ga0500614_017567 3300053123 Bacteria 1618
663 Ga0500618_000136 3300053125 Bacteria 61719
664 Ga0500618_000178 3300053125 Bacteria 52653
665 Ga0500618_016810 3300053125 Bacteria 1825
666 Ga0500658_0004136 3300053134 Bacteria 5451
667 Ga0500568_0000244 3300053139 Bacteria 46399
668 Ga0500568_0002063 3300053139 Bacteria 12179
669 Ga0500588_0411062 3300053146 Bacteria 515
670 Ga0500590_000016 3300053148 Bacteria 47232
671 Ga0500604_0064480 3300053151 Bacteria 1157
672 Ga0500616_0000670 3300053153 Bacteria 40298
673 Ga0500616_0027752 3300053153 Bacteria 3124
674 Ga0500616_0114400 3300053153 Bacteria 1298
675 Ga0500616_0204628 3300053153 Bacteria 872
676 Ga0500622_0000951 3300053156 Bacteria 24641
677 Ga0500622_0291399 3300053156 Bacteria 699
678 Ga0500627_0087985 3300053158 Bacteria 1389
679 Ga0500627_0142627 3300053158 Bacteria 1082
680 Ga0500627_0392918 3300053158 Bacteria 592
681 Ga0500636_0377714 3300053177 Bacteria 666
682 Ga0500645_039688 3300053730 Bacteria 1394
683 Ga0587072_125768 3300059643 Bacteria 599
684 Ga0501082_0171637 3300060353 Bacteria 1885
685 Ga0501082_0172631 3300060353 Bacteria 1880
686 2508725168 2508501050 Bacteria 9633614
687 2509074956 2508501114 Bacteria 7082538
688 2509389682 2509276021 Bacteria 7634384
689 2509445886 2509276033 Bacteria 7180565
690 2510134983 2510065019 Bacteria 6903379
691 2510896407 2510461076 Bacteria 8618824
692 2511132428 2510917022 Bacteria 6504556
693 2511187216 2510917028 Bacteria 6185411
694 2511197299 2510917030 Bacteria 7460662
695 2511389360 2511231027 Bacteria 5013807
696 2513574200 2513237084 Bacteria 7231967
697 2513581163 2513237085 Bacteria 7695351
698 2513589803 2513237087 Bacteria 5817514
699 2513598870 2513237088 Bacteria 6927906
700 2513636451 2513237093 Bacteria 7545552
701 2513714070 2513237103 Bacteria 7647401
702 2513867603 2513237138 Bacteria 7368160
703 2513908346 2513237144 Bacteria 7530820
704 2513926794 2513237146 Bacteria 7166346
705 2513996303 2513237159 Bacteria 6810126
706 2514024574 2513237162 Bacteria 7468464
707 2515114069 2515075009 Bacteria 7288508
708 2515638733 2515154113 Bacteria 7807172
709 2515646110 2515154114 Bacteria 7848616
710 2515661733 2515154116 Bacteria 7552979
711 2515744289 2515154134 Bacteria 7220242
712 2517037706 2516653077 Bacteria 7555578
713 2517077994 2516653085 Bacteria 7346596
714 2517096788 2517093000 Bacteria 7412387
715 2517410495 2517287029 Bacteria 6905599
716 2520378071 2519899620 Bacteria 6499161
717 2524457338 2524023209 Bacteria 6679728
718 2530647104 2529292951 Bacteria 6916614
719 2535519603 2534681796 Bacteria 7146037
720 2585164473 2582581283 Bacteria 6030556
721 2585204849 2582581294 Bacteria 6626667
722 2585224636 2582581298 Bacteria 7315509
723 2585227621 2582581299 Bacteria 6518058
724 2585257632 2582581304 Bacteria 5831370
725 2585264776 2582581306 Bacteria 6450535
726 2585272959 2582581307 Bacteria 6597605
727 2585386155 2582581865 Bacteria 6644329
728 2585394770 2582581866 Bacteria 6859583
729 2585403407 2582581867 Bacteria 7184437
730 2585530044 2585427526 Bacteria 7258840
731 2585543794 2585427528 Bacteria 6842387
732 2585547192 2585427529 Bacteria 7395659
733 2585558082 2585427531 Bacteria 6992870
734 2585823703 2585427590 Bacteria 6824633
735 2585842164 2585427593 Bacteria 7141551
736 2585845150 2585427594 Bacteria 6180594
737 2585897529 2585427608 Bacteria 6544331
738 2585904880 2585427609 Bacteria 6667127
739 2587980004 2585428125 Bacteria 6662905
740 2599420713 2599185170 Bacteria 7295545
741 2616298288 2615840624 Bacteria 6557588
742 2643919775 2643221582 Bacteria 5804683
743 2644000194 2643221598 Bacteria 4578346
744 2644006238 2643221599 Bacteria 6292121
745 2644051569 2643221607 Bacteria 6314006
746 2644191560 2643221634 Bacteria 6705461
747 2644200067 2643221636 Bacteria 6583769
748 2644241684 2643221643 Bacteria 5749658
749 2644480438 2643221686 Bacteria 6310811
750 2644495463 2643221688 Bacteria 5260751
751 2644498832 2643221689 Bacteria 6042950
752 2719182732 2718217882 Bacteria 6556348
753 2719387398 2718217927 Bacteria 6972593
754 2719667057 2718217997 Bacteria 6740740
755 2719733449 2718218009 Bacteria 6478651
756 2720493477 2718218199 Bacteria 6740745
757 2720614934 2718218232 Bacteria 6720332
758 2720621705 2718218233 Bacteria 6662049
759 2720633033 2718218235 Bacteria 6630699
760 2720776757 2718218269 Bacteria 6906114
761 2721148844 2718218363 Bacteria 6524337
762 2721160228 2718218365 Bacteria 6274507
763 2721165657 2718218366 Bacteria 6425255
764 2721401033 2718218423 Bacteria 6438183
765 2722841827 2721755514 Bacteria 6424414
766 2723028348 2721755556 Bacteria 6745503
767 2723561975 2721755684 Bacteria 6859907
768 2723568605 2721755685 Bacteria 6704835
769 2724039846 2721755809 Bacteria 6438790
770 2724046205 2721755810 Bacteria 6479005
771 2724091364 2721755819 Bacteria 6906405
772 2724105870 2721755822 Bacteria 6726041
773 2724111698 2721755823 Bacteria 6752556
774 2725952186 2724679232 Bacteria 7646494
775 2730109284 2728369352 Bacteria 6745171
776 2730165967 2728369365 Bacteria 6555560
777 2730299860 2728369397 Bacteria 6274511
778 2738800632 2738541293 Bacteria 7065685
779 2739038995 2738541333 Bacteria 7106503
780 2753360446 2751185800 Bacteria 5467370
781 2757570377 2757320392 Bacteria 3737298
782 2758642884 2758568016 Bacteria 5645291
783 2766065175 2765235942 Bacteria 7445910
784 2770199263 2767802442 Bacteria 5747986
785 2792462251 2791355048 Bacteria 5832535
786 2792580574 2791355082 Bacteria 5973319
787 2793299729 2791355256 Bacteria 6798008
788 2793318356 2791355259 Bacteria 7254731
789 2793325382 2791355260 Bacteria 6598818
790 2793331595 2791355261 Bacteria 6661293
791 2793338184 2791355262 Bacteria 6774204
792 2793344354 2791355263 Bacteria 6872478
793 2793351172 2791355264 Bacteria 6429314
794 2793356436 2791355265 Bacteria 6539969
795 2793364284 2791355266 Bacteria 7116587
796 2793371141 2791355267 Bacteria 7222458
797 2805931946 2802429605 Bacteria 6875453
798 2805938190 2802429606 Bacteria 6346811
799 2806049471 2802429633 Bacteria 7341974
800 2806056531 2802429634 Bacteria 7083200
801 2806063618 2802429635 Bacteria 7650140
802 2806071117 2802429636 Bacteria 7597525
803 2806077921 2802429637 Bacteria 7067217
804 2835315818 2835312727 Bacteria 7413381
805 2838022433 2838016132 Bacteria 6577831
806 2838024166 2838022645 Bacteria 6494267
807 2838040613 2838035591 Bacteria 7166484
808 2838048504 2838042994 Bacteria 6046894
809 2838054551 2838048938 Bacteria 6044578
810 2838068299 2838061910 Bacteria 6794874
811 2838074663 2838068647 Bacteria 6208656
812 2838664999 2838661181 Bacteria 7385261
813 2838675139 2838668709 Bacteria 6671819
814 2838686465 2838680041 Bacteria 6545511
815 2838693767 2838686498 Bacteria 7807632
816 2838700986 2838694306 Bacteria 6853137
817 2838707476 2838701080 Bacteria 6669771
818 2838714176 2838707686 Bacteria 6619912
819 2838736443 2838729681 Bacteria 7400765
820 2838749235 2838742623 Bacteria 7396178
821 2841858988 2841851746 Bacteria 7532261
822 2841868016 2841864319 Bacteria 6742987
823 2842083768 2842077413 Bacteria 6508645
824 2842117784 2842110456 Bacteria 7656360
825 2842124804 2842118031 Bacteria 7033875
826 2842152048 2842146304 Bacteria 5957337
827 2842163376 2842156927 Bacteria 6894975
828 2842170289 2842163707 Bacteria 6916235
829 2842187004 2842180545 Bacteria 6888678
830 2842198756 2842192696 Bacteria 6147454
831 2842205293 2842198810 Bacteria 6608673
832 2842211442 2842205361 Bacteria 6340321
833 2842223671 2842217011 Bacteria 7497767
834 2842236436 2842229732 Bacteria 7475766
835 2842243588 2842237096 Bacteria 6620661
836 2842250134 2842243621 Bacteria 7421798
837 2842257284 2842250916 Bacteria 6579627
838 2842264144 2842257432 Bacteria 7401195
839 2842269961 2842264693 Bacteria 6472963
840 2842278277 2842271015 Bacteria 7807131
841 2842284890 2842278818 Bacteria 6340002
842 2842290957 2842285085 Bacteria 6011953
843 2842297916 2842291075 Bacteria 7076806
844 2842299106 2842298080 Bacteria 6123127
845 2842310405 2842304105 Bacteria 7023636
846 2842317370 2842311132 Bacteria 6616990
847 2842324266 2842317721 Bacteria 6793725
848 2842348600 2842341865 Bacteria 7003929
849 2842358572 2842357229 Bacteria 6485165
850 2842370349 2842363717 Bacteria 6844742
851 2842377294 2842370503 Bacteria 7038661
852 2842384388 2842377471 Bacteria 7140707
853 2842391407 2842384541 Bacteria 7057858
854 2842402032 2842395702 Bacteria 6780583
855 2842408864 2842402390 Bacteria 6681310
856 2842415545 2842409023 Bacteria 6687331
857 2842422113 2842415677 Bacteria 6596907
858 2842428269 2842422224 Bacteria 6239196
859 2842433794 2842428310 Bacteria 6767288
860 2842440174 2842434925 Bacteria 6502746
861 2842446815 2842441272 Bacteria 6769273
862 2842453590 2842447887 Bacteria 6754142
863 2842468257 2842462802 Bacteria 6588055
864 2842474783 2842469257 Bacteria 6752936
865 2842495724 2842489311 Bacteria 6620893
866 2842502490 2842495871 Bacteria 6820686
867 2842511965 2842509118 Bacteria 6850950
868 2842521261 2842521101 Bacteria 6569494
869 2842873031 2842871566 Bacteria 4827117
870 2844457343 2844454524 Bacteria 7952546
871 2852389408 2852387548 Bacteria 8025568
872 2854913659 2854911287 Bacteria 5582813
873 2857524405 2857516855 Bacteria 7787325
874 2861696896 2861691609 Bacteria 5628931
875 2884298106 2884298095 Bacteria 3823049
876 2888349929 2888343758 Bacteria 6611049
877 2894235045 2894232714 Bacteria 8834183
878 2902331501 2902330777 Bacteria 6395352
879 2909043162 2909042592 Bacteria 6499737
880 2915650541 2915650412 Bacteria 4288180
881 2917556960 2917554339 Bacteria 4987857
882 2919104714 2919100787 Bacteria 7710546
883 2919452622 2919450847 Bacteria 5631160
884 2923558948 2923556063 Bacteria 6793593
885 2933017517 2933016740 Bacteria 6355406
886 2933576845 2933570622 Bacteria 7023390
887 2933593830 2933586486 Bacteria 7667493
888 2933605118 2933599457 Bacteria 5858799
889 2935901305 2935894831 Bacteria 6620579
890 2935908013 2935901341 Bacteria 7341747
891 2936370906 2936367885 Bacteria 7324495
892 2936379968 2936375103 Bacteria 6652732
893 2936387766 2936381700 Bacteria 7006523
894 2937822795 2937822353 Bacteria 7290551
895 2939669926 2939669807 Bacteria 5028511
896 2996890084 2996887358 Bacteria 5795980
897 2996897155 2996893221 Bacteria 5823108
898 3002146267 3002141150 Bacteria 5254435
899 3005415663 3005409236 Bacteria 7188837
900 3005449419 3005445848 Bacteria 6906074
901 639650142 639633055 Bacteria 7751309
902 8001847009 8001845381 Bacteria 5804942
903 8005262195 8005258706 Bacteria 6184835
904 8005282146 8005275841 Bacteria 6929066
905 8005286991 8005282627 Bacteria 6675747
906 8005293103 8005289223 Bacteria 6634003
907 8005303810 8005301065 Bacteria 6614431
908 8005311385 8005307578 Bacteria 7395396
909 8005324611 8005321885 Bacteria 5795980
910 8005378482 8005376324 Bacteria 6590079
911 8005386404 8005382845 Bacteria 6732062
912 8005399394 8005395548 Bacteria 6806915
913 8005435436 8005430974 Bacteria 6689030
914 8005464758 8005460587 Bacteria 7157962
915 8005501796 8005497431 Bacteria 6477605
916 8005547302 8005542996 Bacteria 7077758
917 8005560813 8005556819 Bacteria 6908598
918 8005566944 8005563573 Bacteria 7153261
919 8005571017 8005570704 Bacteria 6957481
920 8005623152 8005619151 Bacteria 7030230
921 8005628983 8005626139 Bacteria 6534237
922 8005673220 8005668836 Bacteria 6953162
923 8005699117 8005695170 Bacteria 6912330
924 8018131683 8018127388 Bacteria 7351159
925 8018169484 8018163183 Bacteria 7277977
926 8018181057 8018176218 Bacteria 6896178
927 8023683699 8023680758 Bacteria 7729763
928 8024482568 8024479707 Bacteria 6954785
929 8024486842 8024486573 Bacteria 6540512
930 8024504902 8024501048 Bacteria 6427847
931 8046768529 8046767195 Bacteria 7547379
932 8049297323 8049293176 Bacteria 6128433
933 8056379716 8056375014 Bacteria 7006639
934 8056385730 8056382006 Bacteria 6408074
935 8057578018 8057575449 Bacteria 7367519
936 8057880426 8057874678 Bacteria 7494653
937 Ga0055540_1016155
938 JGI24739J22299_10169441
939 JGI25158J39367_1000156
940 JGI25158J39367_1023945
941 JGI25152J39213_1002447
942 JGI25152J39213_1003416
943 JGI25152J39213_1005458
944 JGI25152J39213_1012115
945 JGI25152J39213_1019373
946 JGI25152J39213_1038722
947 JGI25150J39212_1000376
948 JGI25150J39212_1007713
949 JGI25159J45721_1000289
950 JGI25159J45721_1012926
951 JGI25151J46595_10000656
952 JGI25151J46595_10000704
953 JGI25151J46595_10001635
954 JGI25151J46595_10054088
955 JGI25165J46597_1000093
956 JGI25153J46596_10000834
957 JGI25153J46596_10001010
958 JGI25153J46596_10001574
959 JGI25153J46596_10003737
960 JGI25153J46596_10100036
961 rootH2_10160607
962 rootL2_10068419
963 JGI25160J50197_1000004
964 JGI25160J50197_1000922
965 JGI25160J50197_1012902
966 JGI25160J50197_1027755
967 JGI25161J50226_1000003
968 JGI25161J50226_1000126
969 JGI25161J50226_1000129
970 Ga0006562J51391_1006656
971 Ga0055526_1001177
972 Ga0055526_1005899
973 Ga0055526_1008782
974 Ga0055526_1011242
975 Ga0055526_1053697
976 Ga0055524_1000937
977 Ga0055524_1007462
978 Ga0055524_1009071
979 Ga0055524_1010954
980 Ga0055536_1000107
981 Ga0055528_1000176
982 Ga0055528_1000538
983 Ga0055528_1003961
984 Ga0055528_1022068
985 Ga0055528_1050624
986 Ga0055530_10000101
987 Ga0055540_1000895
988 Ga0055540_1014064
989 Ga0055540_1034534
990 Ga0055531_10030946
991 Ga0055543_1000001
992 Ga0055543_1000029
993 Ga0055543_1001118
994 Ga0065165_1000736
995 Ga0065165_1005982
996 Ga0065165_1018789
997 Ga0065165_1039670
998 Ga0070670_100402750
999 Ga0070680_100034990
1000 Ga0070660_100014153
1001 Ga0070660_100425894
1002 Ga0070668_100094514
1003 Ga0070668_100941239
1004 Ga0070669_100011959
1005 Ga0070669_100541490
1006 Ga0070669_100676537
1007 Ga0070671_100180837
1008 Ga0070673_101948046
1009 Ga0070659_100010845
1010 Ga0070667_100129235
1011 Ga0070667_100690354
1012 Ga0070705_100009646
1013 Ga0070663_100006289
1014 Ga0070663_101337152
1015 Ga0070662_100931936
1016 Ga0070681_10019675
1017 Ga0070707_100343122
1018 Ga0070698_100057412
1019 Ga0070699_100354192
1020 Ga0070684_100827026
1021 Ga0070697_101909112
1022 Ga0068853_100003919
1023 Ga0068853_100024100
1024 Ga0070672_101378820
1025 Ga0070696_100004480
1026 Ga0070693_100026580
1027 Ga0070665_100454246
1028 Ga0070665_101631223
1029 Ga0068855_100739446
1030 Ga0070664_100033307
1031 Ga0068857_100030450
1032 Ga0068854_100606227
1033 Ga0068854_102262030
1034 Ga0068856_100664807
1035 Ga0068852_100414281
1036 Ga0068859_100457434
1037 Ga0068859_101587054
1038 Ga0068864_100115608
1039 Ga0068866_10290424
1040 Ga0068858_100211401
1041 Ga0068858_100292680
1042 Ga0068860_100066480
1043 Ga0068860_101199930
1044 Ga0081455_10141592
1045 Ga0075365_10000344
1046 Ga0075365_10046809
1047 Ga0075365_10640457
1048 Ga0075363_100086412
1049 Ga0075363_100134671
1050 Ga0075364_10519371
1051 Ga0075362_10027133
1052 Ga0075362_10121052
1053 Ga0075362_10378224
1054 Ga0075367_10007667
1055 Ga0075367_10028827
1056 Ga0075369_10014468
1057 Ga0075369_10058840
1058 Ga0075369_10069533
1059 Ga0075366_10013787
1060 Ga0075366_10267202
1061 Ga0075366_10485222
1062 Ga0075370_10013808
1063 Ga0075370_10055596
1064 Ga0075370_10108331
1065 Ga0075370_10573464
1066 Ga0075370_10578356
1067 Ga0075370_10724730
1068 Ga0068865_100662895
1069 Ga0097620_100457445
1070 Ga0097620_101587104
1071 Ga0075435_101350772
1072 Ga0105251_10021731
1073 Ga0105244_10282590
1074 Ga0105250_10023603
1075 Ga0105245_10261033
1076 Ga0105243_10491095
1077 Ga0105243_10881800
1078 Ga0105241_10057509
1079 Ga0105242_11760297
1080 Ga0105237_10016439
1081 Ga0105238_10017333
1082 Ga0105238_10053574
1083 Ga0105238_11621022
1084 Ga0105249_11979504
1085 Ga0123340_1043851
1086 Ga0123341_1000053
1087 Ga0123341_1058903
1088 Ga0123342_1017765
1089 Ga0123342_1018522
1090 Ga0105239_10335229
1091 Ga0105239_11151252
1092 Ga0105239_11436931
1093 Ga0105239_12312677
1094 Ga0105246_10002913
1095 Ga0105246_10892687
1096 Ga0157325_1005947
1097 Ga0157370_10625609
1098 Ga0157369_10165601
1099 Ga0157369_10528477
1100 Ga0157372_10517152
1101 Ga0157372_11544230
1102 Ga0157375_10387814
1103 Ga0163163_10553382
1104 Ga0157380_11343825
1105 Ga0157376_10383854
1106 Ga0182005_1003645
1107 Ga0163161_10318647
1108 Ga0209436_100026
1109 Ga0209436_118314
1110 Ga0207425_1000058
1111 Ga0207425_1002251
1112 Ga0207425_1005931
1113 Ga0207425_1015674
1114 Ga0209129_1000107
1115 Ga0209129_1000242
1116 Ga0209129_1000641
1117 Ga0209129_1000978
1118 Ga0209129_1002513
1119 Ga0209129_1015162
1120 Ga0209233_1000053
1121 Ga0209673_1001128
1122 Ga0209673_1001602
1123 Ga0209673_1001972
1124 Ga0209673_1002378
1125 Ga0209673_1004897
1126 Ga0209673_1008063
1127 Ga0209673_1008142
1128 Ga0209673_1028138
1129 Ga0209130_1000012
1130 Ga0209130_1000030
1131 Ga0209130_1007072
1132 Ga0209130_1010551
1133 Ga0209130_1024111
1134 Ga0209675_1101295
1135 Ga0209676_1000207
1136 Ga0209676_1027870
1137 Ga0209025_1000083
1138 Ga0209025_1001249
1139 Ga0209025_1001681
1140 Ga0209025_1016147
1141 Ga0209025_1016421
1142 Ga0209025_1017804
1143 Ga0209025_1045572
1144 Ga0209564_1000207
1145 Ga0209564_1001203
1146 Ga0209564_1001863
1147 Ga0209564_1005848
1148 Ga0209564_1017548
1149 Ga0209564_1024690
1150 Ga0209758_1000090
1151 Ga0209758_1000586
1152 Ga0209758_1000906
1153 Ga0209758_1001057
1154 Ga0209758_1001508
1155 Ga0209758_1003633
1156 Ga0209758_1022975
1157 Ga0209758_1027633
1158 Ga0209758_1036477
1159 Ga0209758_1109847
1160 Ga0209050_1000056
1161 Ga0209050_1011914
1162 Ga0209256_1001204
1163 Ga0209256_1001765
1164 Ga0209256_1002582
1165 Ga0209256_1011967
1166 Ga0209256_1013491
1167 Ga0209256_1028310
1168 Ga0209256_1065658
1169 Ga0207426_1000010
1170 Ga0207426_1000047
1171 Ga0207426_1000863
1172 Ga0207426_1001722
1173 Ga0209051_1000848
1174 Ga0209051_1006355
1175 Ga0209051_1009119
1176 Ga0209051_1020322
1177 Ga0209051_1021835
1178 Ga0209051_1027828
1179 Ga0209051_1033690
1180 Ga0209257_1017108
1181 Ga0209257_1021673
1182 Ga0207713_1187939
1183 Ga0207647_10045737
1184 Ga0207647_10476116
1185 Ga0207645_10310279
1186 Ga0207707_10294368
1187 Ga0207695_10350716
1188 Ga0207671_10068640
1189 Ga0207660_10025282
1190 Ga0207657_10927915
1191 Ga0207646_11178818
1192 Ga0207681_10941769
1193 Ga0207694_10025999
1194 Ga0207694_11330699
1195 Ga0207687_10568366
1196 Ga0207644_10694239
1197 Ga0207690_10147912
1198 Ga0207706_10860041
1199 Ga0207709_10616986
1200 Ga0207704_10096185
1201 Ga0207689_10155075
1202 Ga0207651_11862056
1203 Ga0207712_10092003
1204 Ga0207668_10075839
1205 Ga0207668_10410212
1206 Ga0207668_10632043
1207 Ga0207640_11523438
1208 Ga0207658_10033358
1209 Ga0207658_10566046
1210 Ga0207658_10642574
1211 Ga0207703_10042785
1212 Ga0207639_10053431
1213 Ga0207639_10661115
1214 Ga0207678_10000157
1215 Ga0207678_10138811
1216 Ga0207708_10944052
1217 Ga0207648_10034603
1218 Ga0207676_11192462
1219 Ga0207674_10088890
1220 Ga0207698_10777722
1221 Ga0209813_10179140
1222 Ga0268266_10716503
1223 Ga0268265_11811028
1224 Ga0268264_10542923
1225 Ga0307515_10004490
1226 Ga0307515_10009918
1227 Ga0307515_10588462
1228 Ga0265339_10109627
1229 Ga0307513_10009932
1230 Ga0307509_10662743
1231 Ga0307408_100069508
1232 Ga0307408_101158461
1233 Ga0307408_101670181
1234 Ga0307408_102414519
1235 Ga0265314_10072733
1236 Ga0307516_10536275
1237 Ga0307405_10000748
1238 Ga0307413_10329688
1239 Ga0307413_11047500
1240 Ga0307410_10126140
1241 Ga0307412_10011024
1242 Ga0307412_10087225
1243 Ga0307412_10881421
1244 Ga0307412_11149789
1245 Ga0307409_102582860
1246 Ga0307416_100117362
1247 Ga0307416_101037079
1248 Ga0307414_10564007
1249 Ga0307414_11109775
1250 Ga0307414_11120445
1251 Ga0307510_10086142
1252 Ga0373927_0003649
1253 Ga0373925_0009133
1254 Ga0395899_0170275
1255 Ga0395900_0072319
1256 Ga0395898_0275500
1257 Ga0395905_0554580
1258 Ga0395901_0562970
1259 Ga0395901_0900437
1260 Ga0439436_0000963
1261 Ga0439436_0140660
1262 Ga0439438_031564
1263 Ga0439439_0035850
1264 Ga0439439_0086811
1265 Ga0439447_036102
1266 Ga0439466_0087093
1267 Ga0439465_0005577
1268 Ga0439465_0005721
1269 Ga0439465_0007365
1270 Ga0439465_0170821
1271 Ga0451787_113315
1272 Ga0451791_1153726
1273 Ga0451793_1088729
1274 Ga0451795_1473170
1275 Ga0451798_0975016
1276 Ga0451802_1584020
1277 Ga0451802_2164276
1278 Ga0451833_0053958
1279 Ga0451835_0713625
1280 Ga0451837_0645113
1281 Ga0451839_0651082
1282 Ga0451840_04203
1283 Ga0451841_0987990
1284 Ga0451841_1203610
1285 Ga0451845_0001320
1286 Ga0451846_46275
1287 Ga0451847_0236951
1288 Ga0451847_0330292
1289 Ga0451849_0485431
1290 Ga0451849_1333050
1291 Ga0451851_1283676
1292 Ga0451854_21428
1293 Ga0451855_0899849
1294 Ga0451855_0961775
1295 Ga0451855_1273012
1296 Ga0451853_0147227
1297 Ga0439433_0116224
1298 Ga0439441_005659
1299 Ga0439445_0029619
1300 Ga0439432_041592
1301 Ga0439449_0046476
1302 Ga0439462_0009503
1303 Ga0439462_0098227
1304 Ga0450919_035500
1305 Ga0450910_038664
1306 Ga0450910_070239
1307 Ga0439434_0008546
1308 Ga0450918_011784
1309 Ga0466972_0102584
1310 Ga0451576_0018064
1311 Ga0495617_033696
1312 Ga0495617_068391
1313 Ga0495617_096149
1314 Ga0495592_0351335
1315 Ga0495603_0237138
1316 Ga0495629_0012399
1317 Ga0495638_0000296
1318 Ga0495638_0214805
1319 Ga0495651_0019542
1320 Ga0495605_0006821
1321 Ga0495662_0056000
1322 Ga0495664_0275424
1323 Ga0495584_0250841
1324 Ga0495585_0009624
1325 Ga0495585_0040500
1326 Ga0495585_0063961
1327 Ga0495585_0190789
1328 Ga0495607_0035199
1329 Ga0495607_0126435
1330 Ga0495607_0180190
1331 Ga0495607_0372813
1332 Ga0495607_0516994
1333 Ga0495583_0001838
1334 Ga0495583_0008756
1335 Ga0495583_0073237
1336 Ga0495606_0002584
1337 Ga0495606_0123000
1338 Ga0495606_0167603
1339 Ga0495606_0184915
1340 Ga0495610_0004612
1341 Ga0495610_0035409
1342 Ga0495610_0226803
1343 Ga0495610_0375809
1344 Ga0495616_0022028
1345 Ga0495616_0026363
1346 Ga0495618_0386631
1347 Ga0495620_0008509
1348 Ga0495620_0016318
1349 Ga0495620_0026408
1350 Ga0495620_0045442
1351 Ga0495620_0048910
1352 Ga0495631_0002209
1353 Ga0495631_0124812
1354 Ga0495632_0001452
1355 Ga0495632_0069859
1356 Ga0495632_0111823
1357 Ga0495637_0023542
1358 Ga0495643_0039506
1359 Ga0495643_0064722
1360 Ga0495643_0071758
1361 Ga0495643_0089983
1362 Ga0495648_0017276
1363 Ga0495648_0277934
1364 Ga0495652_0230892
1365 Ga0495654_0326899
1366 Ga0495587_0154611
1367 Ga0495609_0063876
1368 Ga0495609_0104735
1369 Ga0495597_0008304
1370 Ga0495622_0043305
1371 Ga0495633_0006906
1372 Ga0495633_0095948
1373 Ga0495633_0280861
1374 Ga0495656_0027533
1375 Ga0495656_0708123
1376 Ga0495668_0008081
1377 Ga0495668_0058525
1378 Ga0495668_0234525
1379 Ga0495668_0616677
1380 Ga0495611_0124374
1381 Ga0495625_0013685
1382 Ga0495625_0015027
1383 Ga0495625_0046890
1384 Ga0495625_0241793
1385 Ga0495625_0250820
1386 Ga0495625_0280704
1387 Ga0495625_0540232
1388 Ga0495625_0575349
1389 Ga0495635_0053157
1390 Ga0495661_0056604
1391 Ga0495588_0039727
1392 Ga0495588_0094691
1393 Ga0495588_0365945
1394 Ga0495657_0110275
1395 Ga0495658_0129639
1396 Ga0495624_0165558
1397 Ga0495670_0095390
1398 Ga0495670_0518636
1399 Ga0495649_0000562
1400 Ga0495649_0014939
1401 Ga0495649_0114673
1402 Ga0495589_0048925
1403 Ga0495660_0009569
1404 Ga0495660_0025021
1405 Ga0495660_0456852
1406 Ga0495604_0002800
1407 Ga0495604_0528637
1408 Ga0495636_0062996
1409 Ga0495636_0509806
1410 Ga0495672_0020030
1411 Ga0495672_0186384
1412 Ga0495683_0025277
1413 Ga0495687_005051
1414 Ga0495687_043913
1415 Ga0495687_080463
1416 Ga0495673_0035415
1417 Ga0495673_0226246
1418 Ga0495681_0055046
1419 Ga0495686_0000499
1420 Ga0495686_0010060
1421 Ga0495686_0033913
1422 Ga0495686_0055432
1423 Ga0495686_0167038
1424 Ga0495602_0819890
1425 Ga0495615_0065031
1426 Ga0495615_0224585
1427 Ga0495626_0078697
1428 Ga0496100_0029234
1429 Ga0496100_0207318
1430 Ga0496100_1490540
1431 Ga0496101_0046656
1432 Ga0496101_0312311
1433 Ga0496102_0163146
1434 Ga0496102_0481414
1435 Ga0496103_0412124
1436 Ga0496104_0013543
1437 Ga0496104_0057309
1438 Ga0496105_0272863
1439 Ga0496106_0000244
1440 Ga0496106_0123280
1441 Ga0496106_0324637
1442 Ga0496106_0985211
1443 Ga0496107_0035615
1444 Ga0496108_0596006
1445 Ga0496109_0810118
1446 Ga0496110_0508351
1447 Ga0496111_0053967
1448 Ga0496112_0987679
1449 Ga0496114_0115746
1450 Ga0496115_0042861
1451 Ga0496116_0010318
1452 Ga0496116_0013345
1453 Ga0496116_0036203
1454 Ga0496116_0039798
1455 Ga0496116_0331981
1456 Ga0496116_0441259
1457 Ga0496117_0006246
1458 Ga0496117_0013341
1459 Ga0496117_0017114
1460 Ga0496117_0088462
1461 Ga0496117_0245431
1462 Ga0496117_0285329
1463 Ga0496117_0307114
1464 Ga0496118_0009587
1465 Ga0496118_0019719
1466 Ga0496118_0024359
1467 Ga0496118_0068104
1468 Ga0496118_0414189
1469 Ga0496118_0437962
1470 Ga0496118_0584909
1471 Ga0496119_0000147
1472 Ga0496119_0014534
1473 Ga0496119_0014869
1474 Ga0496119_0281749
1475 Ga0496119_0320440
1476 Ga0496120_0070224
1477 Ga0496120_0110843
1478 Ga0496121_0016950
1479 Ga0496121_0018337
1480 Ga0496121_0022263
1481 Ga0496121_0038040
1482 Ga0496121_0059801
1483 Ga0496121_0077744
1484 Ga0496121_0162444
1485 Ga0496121_0335525
1486 Ga0496121_0452044
1487 Ga0496122_0005563
1488 Ga0496122_0007952
1489 Ga0496122_0014820
1490 Ga0496122_0023196
1491 Ga0496122_0041782
1492 Ga0496122_0042878
1493 Ga0496122_0047123
1494 Ga0496122_0074733
1495 Ga0496122_0299973
1496 Ga0496123_0002327
1497 Ga0496123_0008901
1498 Ga0496123_0025366
1499 Ga0496123_0039235
1500 Ga0496123_0102767
1501 Ga0496123_0175901
1502 Ga0496123_0293981
1503 Ga0496124_0001919
1504 Ga0496124_0030484
1505 Ga0496124_0093011
1506 Ga0496124_0167132
1507 Ga0496124_0266096
1508 Ga0496124_0298813
1509 Ga0496124_0382599
1510 Ga0496124_0723896
1511 Ga0496125_0039991
1512 Ga0496125_0063847
1513 Ga0496125_0169663
1514 Ga0496125_0178776
1515 Ga0496125_0226468
1516 Ga0496125_0611919
1517 Ga0496125_0627089
1518 Ga0496126_0090632
1519 Ga0496126_0336622
1520 Ga0496126_0408972
1521 Ga0496126_0610200
1522 Ga0496126_0766014
1523 Ga0495678_018075
1524 Ga0495678_019492
1525 Ga0495682_0297072
1526 Ga0501302_033182
1527 Ga0501032_0011350
1528 Ga0501032_0175431
1529 Ga0501033_0286954
1530 Ga0501034_0000658
1531 Ga0501034_0003308
1532 Ga0501034_0110708
1533 Ga0501034_0128893
1534 Ga0501034_0186205
1535 Ga0501034_0506798
1536 Ga0501036_0067881
1537 Ga0501036_0411460
1538 Ga0501037_0321965
1539 Ga0501038_0014869
1540 Ga0501038_0807611
1541 Ga0501043_0067798
1542 Ga0501043_0098115
1543 Ga0501043_0433736
1544 Ga0501046_0199215
1545 Ga0501047_0057610
1546 Ga0501047_0105306
1547 Ga0501047_1148692
1548 Ga0501068_0159306
1549 Ga0501072_0016707
1550 Ga0501074_1122437
1551 Ga0501238_018554
1552 Ga0501252_005395
1553 Ga0501080_0142547
1554 Ga0501080_1344338
1555 Ga0501083_0016474
1556 Ga0501083_0143290
1557 Ga0501083_0145859
1558 Ga0501083_0287906
1559 Ga0501035_0169023
1560 Ga0501035_0280731
1561 Ga0501035_1332923
1562 Ga0501044_0043037
1563 Ga0501044_0061924
1564 Ga0501044_0564741
1565 Ga0501044_0845699
1566 nmdc:mga03683_30333_c1
1567 nmdc:mga03n38_41578_c1
1568 nmdc:mga03n38_86289_c1
1569 nmdc:mga00v17_411043_c1
1570 nmdc:mga0yw44_220864_c1
1571 nmdc:mga0yw44_359708_c1
1572 nmdc:mga0yw44_453148_c1
1573 nmdc:mga0yw44_820724_c1
1574 nmdc:mga0k408_469413_c1
1575 nmdc:mga0k408_736010_c1
1576 nmdc:mga04h51_206423_c1
1577 nmdc:mga07m45_23901_c2
1578 nmdc:mga07m45_24786_c1
1579 nmdc:mga07m45_254516_c1
1580 nmdc:mga07m45_370585_c1
1581 nmdc:mga08y16_1184410_c1
1582 nmdc:mga0sz30_23018_c1
1583 nmdc:mga0sz30_241737_c1
1584 nmdc:mga0sz30_79546_c1
1585 Ga0500610_0120842
1586 Ga0495619_0085558
1587 Ga0495619_0423889
1588 Ga0500578_0082610
1589 Ga0500651_0065253
1590 Ga0500556_0000142
1591 Ga0500557_000489
1592 Ga0500569_008129
1593 Ga0500569_295334
1594 Ga0500594_0005197
1595 Ga0500594_0046685
1596 Ga0500595_116204
1597 Ga0500608_147272
1598 Ga0500614_017567
1599 Ga0500618_000136
1600 Ga0500618_000178
1601 Ga0500618_016810
1602 Ga0500658_0004136
1603 Ga0500568_0000244
1604 Ga0500568_0002063
1605 Ga0500588_0411062
1606 Ga0500590_000016
1607 Ga0500604_0064480
1608 Ga0500616_0000670
1609 Ga0500616_0027752
1610 Ga0500616_0114400
1611 Ga0500616_0204628
1612 Ga0500622_0000951
1613 Ga0500622_0291399
1614 Ga0500627_0087985
1615 Ga0500627_0142627
1616 Ga0500627_0392918
1617 Ga0500636_0377714
1618 Ga0500645_039688
1619 Ga0587072_125768
1620 Ga0501082_0171637
1621 Ga0501082_0172631
1622 2508725168
1623 2509074956
1624 2509389682
1625 2509445886
1626 2510134983
1627 2510896407
1628 2511132428
1629 2511187216
1630 2511197299
1631 2511389360
1632 2513574200
1633 2513581163
1634 2513589803
1635 2513598870
1636 2513636451
1637 2513714070
1638 2513867603
1639 2513908346
1640 2513926794
1641 2513996303
1642 2514024574
1643 2515114069
1644 2515638733
1645 2515646110
1646 2515661733
1647 2515744289
1648 2517037706
1649 2517077994
1650 2517096788
1651 2517410495
1652 2520378071
1653 2524457338
1654 2530647104
1655 2535519603
1656 2585164473
1657 2585204849
1658 2585224636
1659 2585227621
1660 2585257632
1661 2585264776
1662 2585272959
1663 2585386155
1664 2585394770
1665 2585403407
1666 2585530044
1667 2585543794
1668 2585547192
1669 2585558082
1670 2585823703
1671 2585842164
1672 2585845150
1673 2585897529
1674 2585904880
1675 2587980004
1676 2599420713
1677 2616298288
1678 2643919775
1679 2644000194
1680 2644006238
1681 2644051569
1682 2644191560
1683 2644200067
1684 2644241684
1685 2644480438
1686 2644495463
1687 2644498832
1688 2719182732
1689 2719387398
1690 2719667057
1691 2719733449
1692 2720493477
1693 2720614934
1694 2720621705
1695 2720633033
1696 2720776757
1697 2721148844
1698 2721160228
1699 2721165657
1700 2721401033
1701 2722841827
1702 2723028348
1703 2723561975
1704 2723568605
1705 2724039846
1706 2724046205
1707 2724091364
1708 2724105870
1709 2724111698
1710 2725952186
1711 2730109284
1712 2730165967
1713 2730299860
1714 2738800632
1715 2739038995
1716 2753360446
1717 2757570377
1718 2758642884
1719 2766065175
1720 2770199263
1721 2792462251
1722 2792580574
1723 2793299729
1724 2793318356
1725 2793325382
1726 2793331595
1727 2793338184
1728 2793344354
1729 2793351172
1730 2793356436
1731 2793364284
1732 2793371141
1733 2805931946
1734 2805938190
1735 2806049471
1736 2806056531
1737 2806063618
1738 2806071117
1739 2806077921
1740 2835315818
1741 2838022433
1742 2838024166
1743 2838040613
1744 2838048504
1745 2838054551
1746 2838068299
1747 2838074663
1748 2838664999
1749 2838675139
1750 2838686465
1751 2838693767
1752 2838700986
1753 2838707476
1754 2838714176
1755 2838736443
1756 2838749235
1757 2841858988
1758 2841868016
1759 2842083768
1760 2842117784
1761 2842124804
1762 2842152048
1763 2842163376
1764 2842170289
1765 2842187004
1766 2842198756
1767 2842205293
1768 2842211442
1769 2842223671
1770 2842236436
1771 2842243588
1772 2842250134
1773 2842257284
1774 2842264144
1775 2842269961
1776 2842278277
1777 2842284890
1778 2842290957
1779 2842297916
1780 2842299106
1781 2842310405
1782 2842317370
1783 2842324266
1784 2842348600
1785 2842358572
1786 2842370349
1787 2842377294
1788 2842384388
1789 2842391407
1790 2842402032
1791 2842408864
1792 2842415545
1793 2842422113
1794 2842428269
1795 2842433794
1796 2842440174
1797 2842446815
1798 2842453590
1799 2842468257
1800 2842474783
1801 2842495724
1802 2842502490
1803 2842511965
1804 2842521261
1805 2842873031
1806 2844457343
1807 2852389408
1808 2854913659
1809 2857524405
1810 2861696896
1811 2884298106
1812 2888349929
1813 2894235045
1814 2902331501
1815 2909043162
1816 2915650541
1817 2917556960
1818 2919104714
1819 2919452622
1820 2923558948
1821 2933017517
1822 2933576845
1823 2933593830
1824 2933605118
1825 2935901305
1826 2935908013
1827 2936370906
1828 2936379968
1829 2936387766
1830 2937822795
1831 2939669926
1832 2996890084
1833 2996897155
1834 3002146267
1835 3005415663
1836 3005449419
1837 639650142
1838 8001847009
1839 8005262195
1840 8005282146
1841 8005286991
1842 8005293103
1843 8005303810
1844 8005311385
1845 8005324611
1846 8005378482
1847 8005386404
1848 8005399394
1849 8005435436
1850 8005464758
1851 8005501796
1852 8005547302
1853 8005560813
1854 8005566944
1855 8005571017
1856 8005623152
1857 8005628983
1858 8005673220
1859 8005699117
1860 8018131683
1861 8018169484
1862 8018181057
1863 8023683699
1864 8024482568
1865 8024486842
1866 8024504902
1867 8046768529
1868 8049297323
1869 8056379716
1870 8056385730
1871 8057578018
1872 8057880426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

5

42

0.99

PF09278

MerR-DNA-bind

MerR, DNA binding

47

111

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

4

73

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jni-assembly4.cif.gz_H crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9373 5 129
1q07-assembly1.cif.gz_A crystal structure of the au(i) form of e. coli cuer, a copper efflux regulator 0.9372 5 129
6jni-assembly2.cif.gz_D crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9354 5 130
6jni-assembly4.cif.gz_G crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9342 5 113
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.9194 1 74
ID Description Score Start End Superfamily
af_P0ACS5_1_128_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9487 5 120 1.10.1660.10
1q07A00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9372 5 129 1.10.1660.10
1q08A00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9206 46 130 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9194 1 74 1.10.1660.10
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9155 2 64 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A395D1R2-F1-model_v4 MerR family transcriptional regulator 0.9929 3 113 GO:0003677
GO:0003700
AF-A0A069ISI1-F1-model_v4 Transcriptional regulator 0.9924 5 130 GO:0003677
GO:0003700
AF-A0A2G1MBV0-F1-model_v4 MerR family transcriptional regulator 0.9914 5 94 GO:0003677
GO:0003700
AF-A0A259MBP8-F1-model_v4 Transcriptional regulator 0.9907 5 130 GO:0003677
GO:0003700
AF-A0A1L3JDB2-F1-model_v4 Transcriptional regulator 0.9871 5 130 GO:0003677
GO:0003700

Map