F486221

General Info

Members Datasets Scaffolds Average Seq Length
937 321 1874 711

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10000423|Ga0207681_1000042315
Length 797
Sequence MFIDKSCCLDLLSPFMGDRNFAPPELRVLSSFVTINISPLCGGVAPVIMSDTKVLKLVPKSAVKSADAPAPAAEKQADISSLGAQTGAAVAVKPSRVPEQRGQRLSREEMLAMYRTMYLSRRIDDKEIQLKNQNRIFFQISGAGHEAVLVAAGMVLRPGYDWFYPYYRDRALCLQLGMTPLEQFLSAVGASDDPNSHGRQMPSHWGHQKLNIVSQSSPTGTQLLQAVGCAEAGYRFKLIRELRKRSSNFHKDEVVYVSLGDGTSSEGEFWEALNTACNLKLPVLFLVEDNGYAISVPVEVQTAGGDVSRLVKNFPNLFLQRCDGTDVLESLAVMKRAAQYCREHRGPALVHAKVIRPYSHSLSDDEKLYRPDEERTADAERDPVKRFGAVLIDEKVTDQDGLQKIKDEVDALVNEAADQALASPQPEPETIEQFVYSPDVDPTSSAFDNEASAELTGNAGTMVDLINRCLHVEMARDARIVVFGEDVADCSREEFLEKVKGKGGVFKVTANLQRKFGSARVFNSPLAEANIVGRAIGMATRGLKPVVEIQFFDYIWPAMHQIRNELALMRWRSGGDWKAPVVMRVPVGGYLKGGAVYHSQSGVSTFTQIPGLRVIYPSNALDANGLLRTAIRCDDPVLFLEHKHLYRQAYNKSQYPPDEFMIPFGKAKVVREGTDLSIITYGALVQRSLVAAKQAEQQGISVEVVDLRSLQPYDWAAITATVQKTNRVIVAHEDSLSFGYGAEIAARISDQLFEHLDAPVRRVAATDTFVAYAPRLEDAILPQVADVLGAITDLQRY

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
291 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
292 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
293 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
294 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
295 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 4.38
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10000423 3300025923 Bacteria 29441
2 LJQas_1000868 3300000549 Bacteria 4713
3 JGI24748J21848_1000010 3300002074 Bacteria 166979
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI24751J29686_10000056 3300002459 Bacteria 63361
6 JGI25406J46586_10007606 3300003203 Bacteria 4933
7 Ga0065714_10002185 3300005288 Bacteria 199213
8 Ga0065704_10001059 3300005289 Bacteria 22956
9 Ga0065712_10067734 3300005290 Bacteria 110577
10 Ga0065712_10068249 3300005290 Bacteria 12460
11 Ga0065712_10072647 3300005290 Bacteria 4668
12 Ga0065712_10084771 3300005290 Bacteria 2742
13 Ga0065715_10000261 3300005293 Bacteria 18488
14 Ga0065715_10018769 3300005293 Bacteria 3526
15 Ga0065715_10105872 3300005293 Bacteria 2866
16 Ga0065707_10002155 3300005295 Bacteria 4941
17 Ga0070658_10000960 3300005327 Bacteria 24674
18 Ga0070683_100002254 3300005329 Bacteria 15305
19 Ga0070690_100012354 3300005330 Bacteria 5025
20 Ga0070670_100000457 3300005331 Bacteria 33031
21 Ga0070670_100000889 3300005331 Bacteria 23564
22 Ga0070670_100020612 3300005331 Bacteria 5670
23 Ga0070670_100043760 3300005331 Bacteria 3849
24 Ga0068869_100010708 3300005334 Bacteria 5988
25 Ga0068869_100025839 3300005334 Bacteria 4081
26 Ga0068869_100032564 3300005334 Bacteria 3674
27 Ga0070666_10002771 3300005335 Bacteria 10582
28 Ga0070666_10004126 3300005335 Bacteria 8819
29 Ga0070666_10009042 3300005335 Bacteria 6207
30 Ga0070666_10009415 3300005335 Bacteria 6089
31 Ga0070666_10037182 3300005335 Bacteria 3236
32 Ga0070666_10056601 3300005335 Bacteria 2648
33 Ga0070680_100000437 3300005336 Bacteria 28394
34 Ga0070680_100036985 3300005336 Bacteria 3945
35 Ga0070680_100049124 3300005336 Bacteria 3439
36 Ga0070682_100000096 3300005337 Bacteria 79913
37 Ga0070682_100004613 3300005337 Bacteria 7656
38 Ga0068868_100003184 3300005338 Bacteria 11415
39 Ga0068868_100010905 3300005338 Bacteria 6597
40 Ga0068868_100022494 3300005338 Bacteria 4758
41 Ga0068868_100025263 3300005338 Bacteria 4516
42 Ga0068868_100040491 3300005338 Bacteria 3627
43 Ga0068868_100086623 3300005338 Bacteria 2518
44 Ga0070660_100027218 3300005339 Bacteria 4265
45 Ga0070660_100029346 3300005339 Bacteria 4122
46 Ga0070689_100000127 3300005340 Bacteria 43833
47 Ga0070689_100000856 3300005340 Bacteria 18891
48 Ga0070689_100010005 3300005340 Bacteria 6750
49 Ga0070689_100010218 3300005340 Bacteria 6687
50 Ga0070691_10027098 3300005341 Bacteria 2674
51 Ga0070687_100014397 3300005343 Bacteria 3552
52 Ga0070687_100022143 3300005343 Bacteria 3000
53 Ga0070661_100069346 3300005344 Bacteria 2592
54 Ga0070669_100003717 3300005353 Bacteria 11009
55 Ga0070669_100015027 3300005353 Bacteria 5520
56 Ga0070669_100044455 3300005353 Bacteria 3236
57 Ga0070675_100018259 3300005354 Bacteria 5583
58 Ga0070675_100065694 3300005354 Bacteria 3000
59 Ga0070671_100003022 3300005355 Bacteria 13097
60 Ga0070671_100026919 3300005355 Bacteria 4730
61 Ga0070671_100071814 3300005355 Bacteria 2889
62 Ga0070674_100019892 3300005356 Bacteria 4276
63 Ga0070674_100026204 3300005356 Bacteria 3805
64 Ga0070673_100010550 3300005364 Bacteria 6257
65 Ga0070673_100018306 3300005364 Bacteria 5000
66 Ga0070673_100030427 3300005364 Bacteria 4040
67 Ga0070673_100033114 3300005364 Bacteria 3897
68 Ga0070688_100000229 3300005365 Bacteria 29530
69 Ga0070688_100001221 3300005365 Bacteria 12806
70 Ga0070688_100009560 3300005365 Bacteria 5310
71 Ga0070688_100009866 3300005365 Bacteria 5248
72 Ga0070688_100011187 3300005365 Bacteria 4982
73 Ga0070688_100025751 3300005365 Bacteria 3487
74 Ga0070659_100025513 3300005366 Unclassified 4540
75 Ga0070659_100084858 3300005366 Bacteria 2532
76 Ga0070667_100000301 3300005367 Bacteria 55288
77 Ga0070667_100027792 3300005367 Unclassified 4707
78 Ga0070667_100054234 3300005367 Bacteria 3385
79 Ga0070703_10000139 3300005406 Bacteria 37466
80 Ga0070703_10000156 3300005406 Bacteria 34533
81 Ga0070709_10000043 3300005434 Bacteria 101915
82 Ga0070714_100011368 3300005435 Bacteria 7062
83 Ga0070713_100000816 3300005436 Bacteria 20007
84 Ga0070701_10007325 3300005438 Bacteria 4704
85 Ga0070711_100000004 3300005439 Bacteria 188789
86 Ga0070711_100000654 3300005439 Bacteria 18086
87 Ga0070711_100010243 3300005439 Bacteria 5797
88 Ga0070705_100011265 3300005440 Bacteria 4505
89 Ga0070700_100009192 3300005441 Bacteria 5418
90 Ga0070700_100019804 3300005441 Bacteria 3888
91 Ga0070694_100002037 3300005444 Bacteria 11993
92 Ga0070694_100004087 3300005444 Bacteria 8758
93 Ga0070694_100012106 3300005444 Bacteria 5357
94 Ga0070694_100016515 3300005444 Bacteria 4646
95 Ga0070694_100027450 3300005444 Bacteria 3697
96 Ga0070708_100002466 3300005445 Bacteria 14292
97 Ga0070708_100004764 3300005445 Bacteria 10690
98 Ga0070708_100052600 3300005445 Unclassified 3612
99 Ga0070708_100063018 3300005445 Bacteria 3318
100 Ga0070663_100012872 3300005455 Bacteria 5311
101 Ga0070678_100018940 3300005456 Bacteria 4472
102 Ga0070678_100021908 3300005456 Bacteria 4223
103 Ga0070662_100065996 3300005457 Bacteria 2654
104 Ga0070681_10000384 3300005458 Bacteria 35781
105 Ga0070681_10006589 3300005458 Bacteria 11311
106 Ga0070681_10006752 3300005458 Bacteria 11171
107 Ga0070681_10006817 3300005458 Bacteria 11118
108 Ga0070681_10008029 3300005458 Bacteria 10335
109 Ga0070681_10034890 3300005458 Bacteria 5052
110 Ga0070681_10051104 3300005458 Bacteria 4123
111 Ga0068867_100001381 3300005459 Bacteria 16786
112 Ga0068867_100013050 3300005459 Bacteria 5879
113 Ga0068867_100037132 3300005459 Bacteria 3540
114 Ga0068867_100043858 3300005459 Bacteria 3275
115 Ga0070685_10024187 3300005466 Bacteria 3334
116 Ga0070706_100000166 3300005467 Bacteria 83921
117 Ga0070706_100000398 3300005467 Bacteria 52374
118 Ga0070706_100000860 3300005467 Bacteria 33427
119 Ga0070706_100001446 3300005467 Bacteria 24984
120 Ga0070706_100003791 3300005467 Bacteria 14761
121 Ga0070706_100008453 3300005467 Bacteria 9589
122 Ga0070706_100020610 3300005467 Bacteria 6075
123 Ga0070706_100033837 3300005467 Bacteria 4717
124 Ga0070706_100036183 3300005467 Bacteria 4559
125 Ga0070707_100003640 3300005468 Bacteria 14537
126 Ga0070707_100019807 3300005468 Bacteria 6343
127 Ga0070707_100021219 3300005468 Bacteria 6139
128 Ga0070707_100026544 3300005468 Bacteria 5500
129 Ga0070707_100042070 3300005468 Bacteria 4373
130 Ga0070698_100000029 3300005471 Bacteria 96110
131 Ga0070698_100000709 3300005471 Bacteria 35662
132 Ga0070698_100004914 3300005471 Bacteria 14661
133 Ga0070698_100007013 3300005471 Bacteria 12206
134 Ga0070698_100018785 3300005471 Bacteria 7275
135 Ga0070698_100022176 3300005471 Bacteria 6648
136 Ga0070698_100030073 3300005471 Bacteria 5635
137 Ga0070698_100117539 3300005471 Bacteria 2621
138 Ga0070699_100000122 3300005518 Bacteria 71533
139 Ga0070699_100000218 3300005518 Bacteria 57007
140 Ga0070699_100001384 3300005518 Bacteria 22280
141 Ga0070699_100003321 3300005518 Bacteria 14230
142 Ga0070699_100052225 3300005518 Bacteria 3538
143 Ga0070699_100052290 3300005518 Bacteria 3536
144 Ga0070699_100057369 3300005518 Bacteria 3373
145 Ga0070699_100074140 3300005518 Bacteria 2961
146 Ga0070699_100078069 3300005518 Bacteria 2883
147 Ga0070679_100000891 3300005530 Bacteria 25931
148 Ga0070679_100010479 3300005530 Bacteria 8794
149 Ga0070679_100037526 3300005530 Bacteria 4814
150 Ga0070684_100004578 3300005535 Bacteria 10544
151 Ga0070684_100010795 3300005535 Bacteria 7253
152 Ga0070684_100014293 3300005535 Bacteria 6426
153 Ga0070697_100000027 3300005536 Bacteria 126031
154 Ga0070697_100000740 3300005536 Bacteria 24384
155 Ga0070697_100001290 3300005536 Bacteria 18875
156 Ga0070697_100001537 3300005536 Bacteria 17579
157 Ga0070697_100005751 3300005536 Bacteria 9561
158 Ga0070697_100027086 3300005536 Bacteria 4584
159 Ga0070697_100038821 3300005536 Bacteria 3848
160 Ga0070697_100104419 3300005536 Bacteria 2356
161 Ga0068853_100002129 3300005539 Bacteria 14734
162 Ga0070672_100003849 3300005543 Bacteria 9767
163 Ga0070672_100022555 3300005543 Bacteria 4626
164 Ga0070672_100054683 3300005543 Bacteria 3126
165 Ga0070686_100001910 3300005544 Bacteria 11598
166 Ga0070695_100025625 3300005545 Bacteria 3642
167 Ga0070695_100041321 3300005545 Bacteria 2922
168 Ga0070696_100000006 3300005546 Bacteria 109170
169 Ga0070696_100004340 3300005546 Bacteria 9453
170 Ga0070696_100007208 3300005546 Bacteria 7427
171 Ga0070696_100034950 3300005546 Bacteria 3459
172 Ga0070696_100040727 3300005546 Bacteria 3208
173 Ga0070693_100000344 3300005547 Bacteria 21170
174 Ga0070693_100007936 3300005547 Bacteria 5209
175 Ga0070665_100022213 3300005548 Bacteria 6382
176 Ga0070665_100024826 3300005548 Bacteria 6039
177 Ga0070665_100041869 3300005548 Bacteria 4604
178 Ga0070665_100087574 3300005548 Unclassified 3120
179 Ga0070665_100092494 3300005548 Bacteria 3029
180 Ga0070704_100006593 3300005549 Bacteria 6850
181 Ga0068855_100000624 3300005563 Bacteria 43497
182 Ga0068855_100010646 3300005563 Bacteria 11092
183 Ga0068855_100044406 3300005563 Bacteria 5259
184 Ga0070664_100001414 3300005564 Bacteria 19194
185 Ga0070664_100005502 3300005564 Bacteria 10172
186 Ga0070664_100075792 3300005564 Bacteria 2889
187 Ga0068857_100002246 3300005577 Bacteria 15713
188 Ga0068857_100009215 3300005577 Bacteria 8562
189 Ga0068857_100009576 3300005577 Bacteria 8415
190 Ga0068857_100010553 3300005577 Bacteria 8031
191 Ga0068857_100012447 3300005577 Bacteria 7407
192 Ga0068857_100028931 3300005577 Bacteria 4890
193 Ga0068857_100042967 3300005577 Bacteria 4010
194 Ga0068857_100056564 3300005577 Bacteria 3481
195 Ga0068857_100064634 3300005577 Bacteria 3253
196 Ga0068856_100008237 3300005614 Bacteria 10163
197 Ga0068856_100014444 3300005614 Bacteria 7628
198 Ga0068856_100015202 3300005614 Bacteria 7436
199 Ga0068856_100056462 3300005614 Bacteria 3874
200 Ga0068856_100091075 3300005614 Bacteria 3034
201 Ga0070702_100004086 3300005615 Bacteria 6618
202 Ga0070702_100016386 3300005615 Bacteria 3801
203 Ga0070702_100033467 3300005615 Bacteria 2826
204 Ga0068859_100000577 3300005617 Bacteria 36570
205 Ga0068859_100000827 3300005617 Bacteria 31484
206 Ga0068859_100010153 3300005617 Bacteria 9483
207 Ga0068859_100014348 3300005617 Bacteria 7947
208 Ga0068859_100020137 3300005617 Bacteria 6698
209 Ga0068859_100025665 3300005617 Bacteria 5910
210 Ga0068859_100034802 3300005617 Bacteria 5054
211 Ga0068859_100044304 3300005617 Unclassified 4470
212 Ga0068859_100057598 3300005617 Bacteria 3914
213 Ga0068859_100061782 3300005617 Bacteria 3775
214 Ga0068859_100066099 3300005617 Bacteria 3651
215 Ga0068859_100066823 3300005617 Bacteria 3630
216 Ga0068859_100077152 3300005617 Bacteria 3373
217 Ga0068864_100004057 3300005618 Bacteria 12038
218 Ga0068864_100011572 3300005618 Bacteria 7285
219 Ga0068864_100083660 3300005618 Bacteria 2803
220 Ga0068864_100107357 3300005618 Bacteria 2483
221 Ga0068864_100111041 3300005618 Bacteria 2442
222 Ga0068864_100111325 3300005618 Bacteria 2439
223 Ga0068861_100000185 3300005719 Bacteria 33242
224 Ga0068861_100010513 3300005719 Bacteria 6423
225 Ga0068861_100049058 3300005719 Bacteria 3195
226 Ga0068870_10016793 3300005840 Bacteria 3506
227 Ga0068863_100020996 3300005841 Bacteria 6237
228 Ga0068863_100045265 3300005841 Bacteria 4176
229 Ga0068863_100063298 3300005841 Bacteria 3498
230 Ga0068858_100000005 3300005842 Bacteria 305830
231 Ga0068858_100001131 3300005842 Bacteria 27598
232 Ga0068858_100002010 3300005842 Bacteria 20824
233 Ga0068860_100000203 3300005843 Bacteria 94032
234 Ga0068860_100019485 3300005843 Bacteria 6577
235 Ga0068860_100022824 3300005843 Bacteria 6051
236 Ga0068860_100061113 3300005843 Bacteria 3579
237 Ga0068860_100089412 3300005843 Bacteria 2932
238 Ga0081455_10009458 3300005937 Bacteria 10026
239 Ga0081455_10010073 3300005937 Bacteria 9645
240 Ga0081539_10000307 3300005985 Bacteria 109928
241 Ga0081539_10000725 3300005985 Bacteria 66076
242 Ga0081539_10000894 3300005985 Bacteria 56997
243 Ga0081539_10001567 3300005985 Bacteria 37931
244 Ga0081539_10010720 3300005985 Bacteria 7387
245 Ga0070717_10035884 3300006028 Bacteria 4018
246 Ga0070717_10036060 3300006028 Bacteria 4008
247 Ga0070717_10039465 3300006028 Bacteria 3842
248 Ga0075365_10009625 3300006038 Bacteria 5573
249 Ga0070715_10000010 3300006163 Bacteria 184687
250 Ga0070715_10001953 3300006163 Bacteria 6209
251 Ga0070716_100020876 3300006173 Bacteria 3444
252 Ga0070712_100000276 3300006175 Bacteria 28822
253 Ga0075367_10008771 3300006178 Bacteria 5255
254 Ga0075367_10013061 3300006178 Bacteria 4451
255 Ga0075367_10050528 3300006178 Bacteria 2455
256 Ga0075366_10000966 3300006195 Bacteria 14033
257 Ga0075366_10044095 3300006195 Bacteria 2643
258 Ga0097621_100009142 3300006237 Bacteria 7182
259 Ga0097621_100009750 3300006237 Bacteria 6990
260 Ga0097621_100053216 3300006237 Bacteria 3299
261 Ga0075370_10014599 3300006353 Bacteria 4193
262 Ga0068871_100005767 3300006358 Bacteria 8697
263 Ga0068871_100014588 3300006358 Bacteria 5861
264 Ga0068871_100055036 3300006358 Bacteria 3229
265 Ga0075428_100000093 3300006844 Bacteria 73908
266 Ga0075428_100000792 3300006844 Bacteria 32965
267 Ga0075428_100001532 3300006844 Bacteria 24719
268 Ga0075428_100036561 3300006844 Bacteria 5408
269 Ga0075428_100043279 3300006844 Bacteria 4950
270 Ga0075428_100087429 3300006844 Bacteria 3400
271 Ga0075430_100002132 3300006846 Bacteria 16372
272 Ga0075430_100012483 3300006846 Bacteria 7230
273 Ga0075430_100018772 3300006846 Bacteria 5885
274 Ga0075430_100058754 3300006846 Bacteria 3233
275 Ga0075431_100000342 3300006847 Bacteria 36687
276 Ga0075431_100001335 3300006847 Bacteria 22541
277 Ga0075431_100002969 3300006847 Bacteria 16411
278 Ga0075431_100014551 3300006847 Bacteria 7960
279 Ga0075431_100048359 3300006847 Bacteria 4387
280 Ga0075433_10000793 3300006852 Bacteria 21889
281 Ga0075433_10005566 3300006852 Bacteria 9894
282 Ga0075433_10017277 3300006852 Bacteria 5971
283 Ga0075433_10047304 3300006852 Bacteria 3742
284 Ga0075433_10053734 3300006852 Unclassified 3513
285 Ga0075433_10056234 3300006852 Bacteria 3436
286 Ga0075433_10110948 3300006852 Bacteria 2433
287 Ga0075434_100000465 3300006871 Bacteria 30350
288 Ga0075434_100040858 3300006871 Bacteria 4593
289 Ga0075434_100073881 3300006871 Bacteria 3403
290 Ga0075429_100000002 3300006880 Bacteria 131527
291 Ga0075429_100014714 3300006880 Bacteria 6782
292 Ga0075429_100018185 3300006880 Bacteria 6083
293 Ga0068865_100003168 3300006881 Bacteria 9854
294 Ga0068865_100004487 3300006881 Bacteria 8423
295 Ga0068865_100041325 3300006881 Bacteria 3136
296 Ga0075436_100000227 3300006914 Bacteria 34999
297 Ga0075436_100022002 3300006914 Bacteria 4378
298 Ga0075436_100052624 3300006914 Unclassified 2811
299 Ga0097620_100000577 3300006931 Bacteria 36570
300 Ga0097620_100000827 3300006931 Bacteria 31484
301 Ga0097620_100010152 3300006931 Bacteria 9483
302 Ga0097620_100014348 3300006931 Bacteria 7947
303 Ga0097620_100020137 3300006931 Bacteria 6698
304 Ga0097620_100025665 3300006931 Bacteria 5910
305 Ga0097620_100034802 3300006931 Bacteria 5054
306 Ga0097620_100044303 3300006931 Unclassified 4470
307 Ga0097620_100057605 3300006931 Bacteria 3914
308 Ga0097620_100061781 3300006931 Bacteria 3775
309 Ga0097620_100066097 3300006931 Bacteria 3651
310 Ga0097620_100066826 3300006931 Bacteria 3630
311 Ga0097620_100077151 3300006931 Bacteria 3373
312 Ga0097620_100116788 3300006931 Bacteria 2733
313 Ga0075435_100000836 3300007076 Bacteria 19197
314 Ga0075435_100007079 3300007076 Bacteria 7964
315 Ga0075435_100025891 3300007076 Bacteria 4571
316 Ga0105240_10001385 3300009093 Bacteria 41682
317 Ga0105240_10001428 3300009093 Bacteria 40901
318 Ga0105240_10001456 3300009093 Bacteria 40471
319 Ga0105240_10003229 3300009093 Bacteria 25527
320 Ga0105240_10019588 3300009093 Bacteria 9038
321 Ga0105240_10024286 3300009093 Bacteria 7996
322 Ga0105240_10024362 3300009093 Bacteria 7978
323 Ga0105240_10039009 3300009093 Bacteria 6087
324 Ga0111539_10000270 3300009094 Bacteria 62014
325 Ga0111539_10000359 3300009094 Bacteria 56038
326 Ga0111539_10000639 3300009094 Bacteria 45247
327 Ga0111539_10003639 3300009094 Bacteria 20303
328 Ga0111539_10018244 3300009094 Bacteria 8690
329 Ga0111539_10019999 3300009094 Bacteria 8247
330 Ga0111539_10030975 3300009094 Bacteria 6499
331 Ga0111539_10102483 3300009094 Bacteria 3360
332 Ga0111539_10112293 3300009094 Bacteria 3197
333 Ga0105245_10003883 3300009098 Bacteria 13297
334 Ga0105245_10007874 3300009098 Bacteria 9320
335 Ga0105245_10012172 3300009098 Bacteria 7483
336 Ga0105245_10048621 3300009098 Bacteria 3794
337 Ga0105247_10000002 3300009101 Bacteria 724587
338 Ga0105247_10006032 3300009101 Bacteria 7538
339 Ga0114129_10000371 3300009147 Bacteria 52193
340 Ga0114129_10002547 3300009147 Bacteria 25313
341 Ga0114129_10003318 3300009147 Bacteria 22609
342 Ga0114129_10013218 3300009147 Bacteria 11758
343 Ga0114129_10022143 3300009147 Bacteria 9020
344 Ga0114129_10024316 3300009147 Bacteria 8583
345 Ga0114129_10052384 3300009147 Bacteria 5727
346 Ga0114129_10072837 3300009147 Bacteria 4788
347 Ga0114129_10084649 3300009147 Bacteria 4402
348 Ga0114129_10148116 3300009147 Bacteria 3214
349 Ga0105243_10000029 3300009148 Bacteria 190577
350 Ga0105243_10001062 3300009148 Bacteria 25128
351 Ga0105243_10003523 3300009148 Bacteria 12650
352 Ga0105243_10017445 3300009148 Bacteria 5428
353 Ga0105243_10028211 3300009148 Bacteria 4308
354 Ga0105243_10083543 3300009148 Bacteria 2613
355 Ga0105241_10060899 3300009174 Bacteria 2905
356 Ga0105242_10000009 3300009176 Bacteria 162286
357 Ga0105242_10002213 3300009176 Bacteria 15342
358 Ga0105242_10003729 3300009176 Bacteria 11845
359 Ga0105242_10004837 3300009176 Bacteria 10430
360 Ga0105242_10005256 3300009176 Bacteria 9994
361 Ga0105242_10010760 3300009176 Bacteria 7022
362 Ga0105242_10035316 3300009176 Bacteria 4009
363 Ga0105242_10046208 3300009176 Bacteria 3532
364 Ga0105248_10003227 3300009177 Bacteria 18083
365 Ga0105248_10005952 3300009177 Bacteria 13398
366 Ga0105248_10007406 3300009177 Bacteria 12042
367 Ga0105248_10010936 3300009177 Bacteria 10013
368 Ga0105248_10013938 3300009177 Bacteria 8846
369 Ga0105248_10022647 3300009177 Bacteria 6972
370 Ga0105248_10045095 3300009177 Bacteria 4944
371 Ga0105248_10050983 3300009177 Bacteria 4644
372 Ga0105248_10057412 3300009177 Bacteria 4369
373 Ga0105248_10072095 3300009177 Bacteria 3882
374 Ga0105237_10001157 3300009545 Bacteria 35321
375 Ga0105237_10008964 3300009545 Bacteria 10769
376 Ga0105237_10028333 3300009545 Bacteria 5706
377 Ga0105237_10045079 3300009545 Bacteria 4439
378 Ga0105237_10084134 3300009545 Bacteria 3172
379 Ga0105238_10001077 3300009551 Bacteria 27578
380 Ga0105238_10003867 3300009551 Bacteria 14874
381 Ga0105238_10069054 3300009551 Bacteria 3534
382 Ga0105238_10079354 3300009551 Unclassified 3272
383 Ga0105249_10000018 3300009553 Bacteria 275907
384 Ga0105249_10007173 3300009553 Bacteria 9734
385 Ga0105249_10034297 3300009553 Bacteria 4599
386 Ga0105239_10010491 3300010375 Bacteria 10357
387 Ga0105239_10014002 3300010375 Bacteria 8907
388 Ga0105239_10049718 3300010375 Unclassified 4597
389 Ga0157373_10001239 3300013100 Bacteria 19501
390 Ga0157373_10018234 3300013100 Bacteria 5112
391 Ga0157370_10013680 3300013104 Bacteria 8341
392 Ga0157370_10017916 3300013104 Bacteria 7133
393 Ga0157370_10031960 3300013104 Bacteria 5143
394 Ga0157370_10042459 3300013104 Bacteria 4382
395 Ga0157370_10066216 3300013104 Bacteria 3417
396 Ga0157369_10003469 3300013105 Bacteria 18709
397 Ga0157369_10008875 3300013105 Bacteria 11516
398 Ga0157369_10026007 3300013105 Bacteria 6494
399 Ga0157369_10059828 3300013105 Bacteria 4109
400 Ga0157369_10066772 3300013105 Bacteria 3869
401 Ga0157374_10010706 3300013296 Bacteria 7899
402 Ga0157374_10013441 3300013296 Bacteria 7145
403 Ga0157374_10014638 3300013296 Bacteria 6865
404 Ga0157374_10095576 3300013296 Bacteria 2841
405 Ga0157378_10000003 3300013297 Bacteria 203725
406 Ga0157378_10004092 3300013297 Bacteria 12882
407 Ga0157378_10008228 3300013297 Bacteria 9093
408 Ga0157378_10013737 3300013297 Bacteria 7083
409 Ga0157378_10041114 3300013297 Bacteria 4100
410 Ga0157378_10061072 3300013297 Bacteria 3362
411 Ga0157378_10072976 3300013297 Bacteria 3084
412 Ga0157378_10073895 3300013297 Bacteria 3066
413 Ga0163162_10000001 3300013306 Bacteria 751833
414 Ga0163162_10003865 3300013306 Bacteria 14371
415 Ga0163162_10004846 3300013306 Bacteria 12990
416 Ga0163162_10006709 3300013306 Bacteria 11160
417 Ga0163162_10008625 3300013306 Bacteria 9932
418 Ga0163162_10016838 3300013306 Bacteria 7146
419 Ga0163162_10024886 3300013306 Bacteria 5913
420 Ga0163162_10040212 3300013306 Bacteria 4676
421 Ga0163162_10083433 3300013306 Bacteria 3269
422 Ga0157372_10011760 3300013307 Bacteria 9321
423 Ga0157372_10020033 3300013307 Bacteria 7212
424 Ga0157372_10021438 3300013307 Bacteria 6981
425 Ga0157372_10039176 3300013307 Bacteria 5232
426 Ga0157372_10153046 3300013307 Bacteria 2663
427 Ga0157375_10003026 3300013308 Bacteria 14585
428 Ga0157375_10008684 3300013308 Bacteria 8905
429 Ga0157375_10023102 3300013308 Bacteria 5733
430 Ga0157375_10101631 3300013308 Bacteria 2958
431 Ga0157375_10122058 3300013308 Bacteria 2716
432 Ga0163163_10002690 3300014325 Bacteria 15024
433 Ga0163163_10003111 3300014325 Bacteria 14066
434 Ga0163163_10022262 3300014325 Bacteria 5997
435 Ga0163163_10036179 3300014325 Bacteria 4795
436 Ga0163163_10050224 3300014325 Bacteria 4107
437 Ga0163163_10055248 3300014325 Unclassified 3925
438 Ga0163163_10061388 3300014325 Bacteria 3724
439 Ga0163163_10096189 3300014325 Bacteria 2982
440 Ga0163163_10109360 3300014325 Bacteria 2791
441 Ga0157380_10000235 3300014326 Bacteria 33292
442 Ga0157380_10002344 3300014326 Bacteria 12728
443 Ga0157380_10003105 3300014326 Bacteria 11334
444 Ga0157377_10012932 3300014745 Bacteria 4210
445 Ga0157379_10016412 3300014968 Bacteria 6515
446 Ga0157379_10020178 3300014968 Bacteria 5890
447 Ga0157379_10035617 3300014968 Bacteria 4438
448 Ga0157379_10038614 3300014968 Bacteria 4259
449 Ga0157379_10040575 3300014968 Bacteria 4155
450 Ga0157376_10004399 3300014969 Bacteria 9809
451 Ga0157376_10010654 3300014969 Bacteria 6737
452 Ga0157376_10011777 3300014969 Bacteria 6461
453 Ga0157376_10031286 3300014969 Bacteria 4259
454 Ga0163161_10002914 3300017792 Bacteria 12113
455 Ga0163161_10005427 3300017792 Bacteria 8851
456 Ga0213876_10000060 3300021384 Bacteria 131803
457 Ga0213876_10000672 3300021384 Bacteria 24372
458 Ga0213876_10043221 3300021384 Bacteria 2382
459 Ga0213875_10000004 3300021388 Bacteria 703388
460 Ga0224570_100785 3300022730 Bacteria 2533
461 Ga0224572_1000011 3300024225 Bacteria 9359
462 Ga0228598_1001211 3300024227 Bacteria 5692
463 Ga0228598_1002189 3300024227 Bacteria 4279
464 Ga0207697_10016557 3300025315 Bacteria 3036
465 Ga0207653_10000281 3300025885 Bacteria 29947
466 Ga0207653_10001154 3300025885 Bacteria 8645
467 Ga0207710_10000002 3300025900 Bacteria 1251998
468 Ga0207710_10002344 3300025900 Bacteria 8850
469 Ga0207680_10000775 3300025903 Bacteria 15090
470 Ga0207647_10001588 3300025904 Bacteria 17435
471 Ga0207647_10016946 3300025904 Bacteria 4961
472 Ga0207647_10036953 3300025904 Bacteria 3100
473 Ga0207685_10000006 3300025905 Bacteria 284255
474 Ga0207699_10000013 3300025906 Bacteria 261480
475 Ga0207699_10044197 3300025906 Unclassified 2592
476 Ga0207645_10008986 3300025907 Bacteria 6938
477 Ga0207643_10001116 3300025908 Bacteria 15940
478 Ga0207643_10003111 3300025908 Bacteria 8922
479 Ga0207643_10006159 3300025908 Bacteria 6420
480 Ga0207643_10026293 3300025908 Bacteria 3221
481 Ga0207705_10012447 3300025909 Bacteria 6145
482 Ga0207684_10000073 3300025910 Bacteria 185361
483 Ga0207684_10000358 3300025910 Bacteria 62368
484 Ga0207684_10000484 3300025910 Bacteria 51244
485 Ga0207684_10002122 3300025910 Bacteria 20334
486 Ga0207684_10004142 3300025910 Bacteria 13797
487 Ga0207684_10005339 3300025910 Bacteria 11877
488 Ga0207684_10014840 3300025910 Bacteria 6704
489 Ga0207684_10016528 3300025910 Bacteria 6334
490 Ga0207684_10021390 3300025910 Bacteria 5522
491 Ga0207684_10032586 3300025910 Bacteria 4430
492 Ga0207684_10090334 3300025910 Bacteria 2610
493 Ga0207707_10000072 3300025912 Bacteria 102454
494 Ga0207707_10002540 3300025912 Bacteria 16376
495 Ga0207707_10003681 3300025912 Bacteria 13593
496 Ga0207707_10005324 3300025912 Bacteria 11242
497 Ga0207707_10055899 3300025912 Bacteria 3433
498 Ga0207695_10000770 3300025913 Bacteria 60994
499 Ga0207695_10009550 3300025913 Bacteria 11995
500 Ga0207695_10009742 3300025913 Bacteria 11827
501 Ga0207695_10013269 3300025913 Bacteria 9831
502 Ga0207695_10018088 3300025913 Bacteria 8158
503 Ga0207695_10018870 3300025913 Bacteria 7957
504 Ga0207695_10044282 3300025913 Bacteria 4735
505 Ga0207695_10104307 3300025913 Bacteria 2825
506 Ga0207671_10005189 3300025914 Bacteria 12108
507 Ga0207671_10009114 3300025914 Bacteria 8335
508 Ga0207693_10000098 3300025915 Bacteria 77389
509 Ga0207693_10064925 3300025915 Unclassified 2859
510 Ga0207663_10000007 3300025916 Bacteria 208566
511 Ga0207660_10004578 3300025917 Bacteria 9009
512 Ga0207660_10017258 3300025917 Unclassified 4792
513 Ga0207662_10001235 3300025918 Bacteria 12263
514 Ga0207662_10005860 3300025918 Bacteria 6590
515 Ga0207657_10002229 3300025919 Bacteria 21012
516 Ga0207657_10044481 3300025919 Bacteria 3903
517 Ga0207657_10055694 3300025919 Bacteria 3415
518 Ga0207649_10030885 3300025920 Bacteria 3178
519 Ga0207652_10000083 3300025921 Bacteria 101957
520 Ga0207646_10000077 3300025922 Bacteria 134395
521 Ga0207646_10001197 3300025922 Bacteria 32667
522 Ga0207646_10002745 3300025922 Bacteria 20578
523 Ga0207646_10003355 3300025922 Bacteria 18161
524 Ga0207646_10011752 3300025922 Bacteria 8459
525 Ga0207646_10033411 3300025922 Bacteria 4654
526 Ga0207646_10047884 3300025922 Bacteria 3833
527 Ga0207646_10051578 3300025922 Bacteria 3681
528 Ga0207681_10008623 3300025923 Bacteria 6226
529 Ga0207681_10008802 3300025923 Bacteria 6167
530 Ga0207681_10068003 3300025923 Bacteria 2472
531 Ga0207694_10000399 3300025924 Bacteria 40379
532 Ga0207694_10000484 3300025924 Bacteria 36222
533 Ga0207694_10005539 3300025924 Bacteria 9680
534 Ga0207694_10008467 3300025924 Bacteria 7764
535 Ga0207650_10000001 3300025925 Bacteria 1545726
536 Ga0207650_10000975 3300025925 Bacteria 21528
537 Ga0207650_10005521 3300025925 Bacteria 8628
538 Ga0207650_10011168 3300025925 Bacteria 6176
539 Ga0207650_10014884 3300025925 Bacteria 5412
540 Ga0207650_10043071 3300025925 Bacteria 3312
541 Ga0207687_10014145 3300025927 Bacteria 5220
542 Ga0207687_10023586 3300025927 Bacteria 4103
543 Ga0207687_10024053 3300025927 Bacteria 4065
544 Ga0207700_10001351 3300025928 Bacteria 13904
545 Ga0207700_10019546 3300025928 Bacteria 4577
546 Ga0207664_10026699 3300025929 Unclassified 4367
547 Ga0207644_10050611 3300025931 Bacteria 2979
548 Ga0207706_10003118 3300025933 Bacteria 15939
549 Ga0207706_10009857 3300025933 Bacteria 8764
550 Ga0207706_10026585 3300025933 Bacteria 5179
551 Ga0207686_10000010 3300025934 Bacteria 227471
552 Ga0207686_10000360 3300025934 Bacteria 32130
553 Ga0207686_10004290 3300025934 Bacteria 7647
554 Ga0207686_10009067 3300025934 Bacteria 5389
555 Ga0207686_10018488 3300025934 Bacteria 3947
556 Ga0207686_10018566 3300025934 Bacteria 3940
557 Ga0207709_10000052 3300025935 Bacteria 227471
558 Ga0207709_10001851 3300025935 Bacteria 14089
559 Ga0207709_10010398 3300025935 Bacteria 5123
560 Ga0207709_10023872 3300025935 Bacteria 3486
561 Ga0207670_10000021 3300025936 Bacteria 155646
562 Ga0207670_10000357 3300025936 Bacteria 26785
563 Ga0207670_10006501 3300025936 Bacteria 6486
564 Ga0207665_10000131 3300025939 Bacteria 49773
565 Ga0207665_10054042 3300025939 Unclassified 2708
566 Ga0207691_10003188 3300025940 Bacteria 16029
567 Ga0207691_10008810 3300025940 Bacteria 9677
568 Ga0207691_10009824 3300025940 Bacteria 9187
569 Ga0207691_10011274 3300025940 Bacteria 8576
570 Ga0207691_10027930 3300025940 Bacteria 5286
571 Ga0207711_10000701 3300025941 Bacteria 33020
572 Ga0207711_10003858 3300025941 Bacteria 12904
573 Ga0207711_10003901 3300025941 Bacteria 12832
574 Ga0207711_10010374 3300025941 Bacteria 7734
575 Ga0207711_10010593 3300025941 Bacteria 7665
576 Ga0207711_10026917 3300025941 Bacteria 4828
577 Ga0207711_10036761 3300025941 Bacteria 4156
578 Ga0207711_10046503 3300025941 Bacteria 3709
579 Ga0207711_10059096 3300025941 Bacteria 3301
580 Ga0207711_10071949 3300025941 Bacteria 3002
581 Ga0207711_10072763 3300025941 Bacteria 2986
582 Ga0207689_10003403 3300025942 Bacteria 14528
583 Ga0207689_10005347 3300025942 Bacteria 11498
584 Ga0207689_10010417 3300025942 Bacteria 8003
585 Ga0207689_10015475 3300025942 Bacteria 6459
586 Ga0207689_10038116 3300025942 Bacteria 3982
587 Ga0207667_10000776 3300025949 Bacteria 41369
588 Ga0207667_10004773 3300025949 Bacteria 16569
589 Ga0207667_10027335 3300025949 Bacteria 6211
590 Ga0207667_10029550 3300025949 Bacteria 5943
591 Ga0207667_10108979 3300025949 Bacteria 2856
592 Ga0207651_10018083 3300025960 Bacteria 4185
593 Ga0207712_10000022 3300025961 Bacteria 284365
594 Ga0207712_10003603 3300025961 Bacteria 9769
595 Ga0207712_10005702 3300025961 Bacteria 7848
596 Ga0207712_10011661 3300025961 Bacteria 5602
597 Ga0207658_10001561 3300025986 Bacteria 17752
598 Ga0207658_10057956 3300025986 Bacteria 2880
599 Ga0207677_10008941 3300026023 Bacteria 5618
600 Ga0207677_10060924 3300026023 Unclassified 2611
601 Ga0207703_10000150 3300026035 Bacteria 80047
602 Ga0207703_10005172 3300026035 Bacteria 10545
603 Ga0207703_10009246 3300026035 Bacteria 7749
604 Ga0207703_10030945 3300026035 Bacteria 4231
605 Ga0207703_10031126 3300026035 Bacteria 4217
606 Ga0207639_10001238 3300026041 Bacteria 17290
607 Ga0207639_10002185 3300026041 Bacteria 13163
608 Ga0207678_10001610 3300026067 Bacteria 20764
609 Ga0207708_10000108 3300026075 Bacteria 63624
610 Ga0207708_10004583 3300026075 Bacteria 10175
611 Ga0207708_10007856 3300026075 Bacteria 7901
612 Ga0207708_10008373 3300026075 Bacteria 7654
613 Ga0207708_10008875 3300026075 Bacteria 7440
614 Ga0207708_10019797 3300026075 Bacteria 5075
615 Ga0207708_10020224 3300026075 Bacteria 5021
616 Ga0207702_10008490 3300026078 Bacteria 8662
617 Ga0207702_10019455 3300026078 Bacteria 5618
618 Ga0207702_10031462 3300026078 Bacteria 4422
619 Ga0207641_10002868 3300026088 Bacteria 15637
620 Ga0207641_10004650 3300026088 Bacteria 11846
621 Ga0207641_10013955 3300026088 Bacteria 6587
622 Ga0207641_10019450 3300026088 Bacteria 5575
623 Ga0207641_10039085 3300026088 Bacteria 3967
624 Ga0207648_10000817 3300026089 Bacteria 35192
625 Ga0207648_10000889 3300026089 Bacteria 33700
626 Ga0207648_10009035 3300026089 Bacteria 9586
627 Ga0207648_10016996 3300026089 Bacteria 6630
628 Ga0207648_10022944 3300026089 Bacteria 5596
629 Ga0207648_10029182 3300026089 Bacteria 4892
630 Ga0207648_10032063 3300026089 Bacteria 4643
631 Ga0207676_10000852 3300026095 Bacteria 23666
632 Ga0207676_10002434 3300026095 Bacteria 13260
633 Ga0207676_10011182 3300026095 Bacteria 6408
634 Ga0207676_10017369 3300026095 Bacteria 5214
635 Ga0207676_10064210 3300026095 Bacteria 2919
636 Ga0207674_10001937 3300026116 Bacteria 26286
637 Ga0207674_10003646 3300026116 Bacteria 18774
638 Ga0207674_10005082 3300026116 Bacteria 15705
639 Ga0207674_10013398 3300026116 Bacteria 9102
640 Ga0207674_10020265 3300026116 Bacteria 7188
641 Ga0207674_10022367 3300026116 Bacteria 6789
642 Ga0207674_10031078 3300026116 Bacteria 5611
643 Ga0207674_10078171 3300026116 Bacteria 3314
644 Ga0207675_100014932 3300026118 Bacteria 7250
645 Ga0207675_100016144 3300026118 Bacteria 6973
646 Ga0207683_10007261 3300026121 Bacteria 9498
647 Ga0207683_10039798 3300026121 Bacteria 4101
648 Ga0207428_10000614 3300027907 Bacteria 42141
649 Ga0207428_10000773 3300027907 Bacteria 36367
650 Ga0207428_10031741 3300027907 Bacteria 4353
651 Ga0207428_10034624 3300027907 Bacteria 4135
652 Ga0268266_10003065 3300028379 Bacteria 17080
653 Ga0268266_10009330 3300028379 Bacteria 8650
654 Ga0268266_10083407 3300028379 Bacteria 2790
655 Ga0268265_10014278 3300028380 Bacteria 5410
656 Ga0268265_10024548 3300028380 Unclassified 4266
657 Ga0268265_10046235 3300028380 Bacteria 3253
658 Ga0268264_10002013 3300028381 Bacteria 18250
659 Ga0268264_10005556 3300028381 Bacteria 10685
660 Ga0268264_10028324 3300028381 Bacteria 4581
661 Ga0268264_10080842 3300028381 Bacteria 2776
662 Ga0268264_10091034 3300028381 Unclassified 2630
663 Ga0265323_10000130 3300028653 Bacteria 42837
664 Ga0265762_1000081 3300030760 Bacteria 12712
665 Ga0265762_1005107 3300030760 Bacteria 2349
666 Ga0265760_10000009 3300031090 Bacteria 108179
667 Ga0265760_10000098 3300031090 Bacteria 22849
668 Ga0265330_10019986 3300031235 Bacteria 3063
669 Ga0265325_10033521 3300031241 Bacteria 2738
670 Ga0265339_10000007 3300031249 Bacteria 241067
671 Ga0265331_10027474 3300031250 Bacteria 2852
672 Ga0265316_10014362 3300031344 Bacteria 6975
673 Ga0265316_10042130 3300031344 Bacteria 3650
674 Ga0265316_10062833 3300031344 Bacteria 2882
675 Ga0307408_100007180 3300031548 Bacteria 7375
676 Ga0307408_100058670 3300031548 Bacteria 2799
677 Ga0265313_10002310 3300031595 Bacteria 16709
678 Ga0265314_10001577 3300031711 Bacteria 25037
679 Ga0265314_10013999 3300031711 Bacteria 6449
680 Ga0265342_10007066 3300031712 Bacteria 8275
681 Ga0265342_10017289 3300031712 Bacteria 4695
682 Ga0316576_10003605 3300031727 Bacteria 9127
683 Ga0316576_10005304 3300031727 Bacteria 7853
684 Ga0316578_10061767 3300031728 Bacteria 2208
685 Ga0307405_10003081 3300031731 Bacteria 7561
686 Ga0307405_10005843 3300031731 Bacteria 5990
687 Ga0307405_10010329 3300031731 Bacteria 4830
688 Ga0307405_10013967 3300031731 Bacteria 4303
689 Ga0316577_10004385 3300031733 Bacteria 7278
690 Ga0307413_10000419 3300031824 Bacteria 13717
691 Ga0307413_10001511 3300031824 Bacteria 8905
692 Ga0307413_10009262 3300031824 Bacteria 4704
693 Ga0307410_10005053 3300031852 Bacteria 6932
694 Ga0307410_10011796 3300031852 Bacteria 5017
695 Ga0307406_10009094 3300031901 Bacteria 5559
696 Ga0307407_10003711 3300031903 Bacteria 6332
697 Ga0307412_10011010 3300031911 Bacteria 5225
698 Ga0307409_100010838 3300031995 Bacteria 5702
699 Ga0307409_100013398 3300031995 Bacteria 5276
700 Ga0307409_100044171 3300031995 Bacteria 3354
701 Ga0307409_100053454 3300031995 Bacteria 3103
702 Ga0307416_100008383 3300032002 Bacteria 6663
703 Ga0307416_100018467 3300032002 Bacteria 4912
704 Ga0307416_100020229 3300032002 Bacteria 4743
705 Ga0307416_100049460 3300032002 Unclassified 3343
706 Ga0307416_100084321 3300032002 Bacteria 2700
707 Ga0307414_10001198 3300032004 Bacteria 13342
708 Ga0307414_10004222 3300032004 Bacteria 7783
709 Ga0307411_10002441 3300032005 Bacteria 8218
710 Ga0307411_10029383 3300032005 Bacteria 3355
711 Ga0307411_10036054 3300032005 Bacteria 3095
712 Ga0307415_100014621 3300032126 Unclassified 4621
713 Ga0307415_100020145 3300032126 Bacteria 4066
714 Ga0307415_100058605 3300032126 Bacteria 2651
715 Ga0373934_0000737 3300035086 Bacteria 11684
716 Ga0373954_0003390 3300035118 Bacteria 6750
717 Ga0373957_0008556 3300035120 Bacteria 3320
718 Ga0373943_0008519 3300035170 Bacteria 4599
719 Ga0316574_0010997 3300035398 Bacteria 5132
720 Ga0373935_0015007 3300035692 Bacteria 4678
721 Ga0373935_0031021 3300035692 Bacteria 3314
722 Ga0373927_0000650 3300035695 Bacteria 26321
723 Ga0373927_0023863 3300035695 Unclassified 4001
724 Ga0373933_0033474 3300035724 Bacteria 2990
725 Ga0373947_0000881 3300035725 Bacteria 18151
726 Ga0373947_0007101 3300035725 Bacteria 6494
727 Ga0373937_0000177 3300036401 Bacteria 62417
728 Ga0373937_0151650 3300036401 Bacteria 2171
729 Ga0373937_0183489 3300036401 Bacteria 1965
730 Ga0316584_0047451 3300036712 Bacteria 3209
731 Ga0373925_0000106 3300037068 Bacteria 89944
732 Ga0373925_0019844 3300037068 Bacteria 4890
733 Ga0373925_0042695 3300037068 Unclassified 3364
734 Ga0395898_0137215 3300037466 Bacteria 2342
735 Ga0395905_0009429 3300037471 Bacteria 9538
736 Ga0395905_0013089 3300037471 Bacteria 7964
737 Ga0395905_0038282 3300037471 Bacteria 4500
738 Ga0436364_0940056 3300037853 Bacteria 2382
739 Ga0395901_0024217 3300038443 Bacteria 6229
740 Ga0400490_21032 3300038726 Bacteria 3837
741 Ga0436365_0073541 3300039437 Bacteria 9857
742 Ga0436365_0706054 3300039437 Bacteria 124498
743 Ga0436365_0712936 3300039437 Bacteria 7550
744 Ga0436365_1344587 3300039437 Bacteria 210334
745 Ga0436365_1844718 3300039437 Bacteria 39390
746 Ga0436363_0316808 3300039450 Bacteria 2900
747 Ga0436362_0840442 3300039453 Bacteria 7985
748 Ga0439458_0000581 3300042157 Bacteria 9410
749 Ga0451577_0000277 3300042876 Bacteria 99434
750 Ga0451577_0007367 3300042876 Bacteria 10802
751 Ga0451577_0032615 3300042876 Bacteria 4692
752 Ga0451577_0058943 3300042876 Bacteria 3423
753 Ga0451577_0102679 3300042876 Bacteria 2555
754 Ga0453683_0007108 3300044673 Bacteria 7625
755 Ga0453683_0010614 3300044673 Bacteria 6098
756 Ga0466961_0037306 3300044693 Bacteria 3118
757 Ga0453684_0000480 3300044712 Bacteria 158630
758 Ga0453684_0000579 3300044712 Bacteria 136239
759 Ga0453684_0032388 3300044712 Bacteria 7317
760 Ga0453684_0073205 3300044712 Bacteria 4321
761 Ga0451576_0003285 3300045051 Bacteria 22449
762 Ga0451576_0012217 3300045051 Bacteria 9674
763 Ga0451576_0029030 3300045051 Bacteria 5921
764 Ga0451576_0076609 3300045051 Bacteria 3480
765 Ga0451576_0195420 3300045051 Bacteria 2113
766 Ga0495580_0000043 3300046472 Bacteria 70433
767 Ga0495580_0006379 3300046472 Bacteria 9622
768 Ga0495580_0011775 3300046472 Bacteria 6752
769 Ga0495580_0021333 3300046472 Bacteria 4779
770 Ga0495580_0026354 3300046472 Bacteria 4239
771 Ga0495664_0005344 3300046477 Bacteria 7049
772 Ga0495608_0030493 3300046511 Bacteria 3650
773 Ga0495618_0000195 3300046514 Bacteria 43675
774 Ga0495628_0000254 3300046516 Bacteria 47207
775 Ga0495663_0000219 3300046525 Bacteria 22762
776 Ga0495652_0045172 3300046529 Unclassified 3790
777 Ga0495587_0009310 3300046536 Bacteria 6299
778 Ga0495587_0020919 3300046536 Bacteria 4036
779 Ga0495598_0000387 3300046537 Bacteria 7910
780 Ga0495621_0000861 3300046539 Bacteria 7716
781 Ga0495621_0005738 3300046539 Bacteria 3586
782 Ga0495636_0010853 3300047318 Unclassified 3603
783 Ga0495674_0042026 3300047319 Bacteria 4081
784 Ga0495672_0000838 3300047320 Bacteria 32748
785 Ga0495675_0007191 3300047444 Bacteria 6854
786 Ga0495684_0022118 3300047471 Bacteria 4896
787 Ga0495602_0001165 3300048088 Bacteria 25733
788 Ga0496101_0002844 3300048904 Bacteria 10639
789 Ga0496102_0003497 3300048905 Bacteria 13322
790 Ga0496102_0031287 3300048905 Bacteria 4772
791 Ga0496103_0007042 3300048906 Bacteria 6713
792 Ga0496103_0030695 3300048906 Bacteria 3272
793 Ga0496104_0001246 3300048907 Bacteria 21916
794 Ga0496104_0006828 3300048907 Bacteria 10056
795 Ga0496104_0158199 3300048907 Bacteria 2174
796 Ga0496105_0000444 3300048908 Bacteria 27268
797 Ga0496105_0048241 3300048908 Bacteria 3515
798 Ga0496106_0000917 3300048909 Bacteria 21420
799 Ga0496106_0003208 3300048909 Bacteria 12246
800 Ga0496106_0018360 3300048909 Bacteria 5168
801 Ga0496106_0043872 3300048909 Bacteria 3357
802 Ga0496107_0000595 3300048910 Bacteria 20167
803 Ga0496108_0006367 3300048911 Bacteria 9569
804 Ga0496108_0012332 3300048911 Bacteria 6954
805 Ga0496108_0030135 3300048911 Bacteria 4497
806 Ga0496108_0042209 3300048911 Bacteria 3808
807 Ga0496109_0000092 3300048912 Bacteria 93568
808 Ga0496109_0022565 3300048912 Bacteria 5576
809 Ga0496109_0050032 3300048912 Bacteria 3806
810 Ga0496109_0099946 3300048912 Bacteria 2691
811 Ga0496110_0000903 3300048913 Bacteria 20877
812 Ga0496110_0016015 3300048913 Bacteria 6253
813 Ga0496111_0000905 3300048914 Bacteria 16163
814 Ga0496111_0002217 3300048914 Bacteria 11651
815 Ga0496111_0046886 3300048914 Bacteria 3113
816 Ga0496111_0070306 3300048914 Bacteria 2546
817 Ga0496111_0086579 3300048914 Bacteria 2292
818 Ga0496112_0000213 3300048915 Bacteria 37294
819 Ga0496112_0000524 3300048915 Bacteria 26174
820 Ga0496112_0000698 3300048915 Bacteria 23333
821 Ga0496112_0022997 3300048915 Bacteria 5948
822 Ga0496112_0032933 3300048915 Bacteria 5033
823 Ga0496112_0106936 3300048915 Bacteria 2767
824 Ga0496112_0116663 3300048915 Bacteria 2640
825 Ga0496112_0126690 3300048915 Bacteria 2524
826 Ga0496113_0030000 3300048916 Bacteria 3932
827 Ga0496115_0029025 3300048918 Bacteria 4342
828 Ga0496115_0067484 3300048918 Bacteria 2893
829 Ga0501299_000656 3300049522 Bacteria 4107
830 Ga0501031_0005492 3300049568 Bacteria 8250
831 Ga0501031_0035805 3300049568 Bacteria 3239
832 Ga0501032_0001821 3300049569 Bacteria 16847
833 Ga0501034_0002545 3300049571 Bacteria 21771
834 Ga0501034_0008364 3300049571 Bacteria 10941
835 Ga0501036_0000814 3300049572 Bacteria 23171
836 Ga0501038_0005231 3300049574 Bacteria 12062
837 Ga0501038_0005530 3300049574 Bacteria 11735
838 Ga0501042_0046546 3300049578 Bacteria 3093
839 Ga0501046_0000783 3300049580 Bacteria 30741
840 Ga0501046_0024390 3300049580 Bacteria 4964
841 Ga0501047_0015423 3300049581 Bacteria 7279
842 Ga0501047_0103961 3300049581 Bacteria 2721
843 Ga0501048_0001371 3300049582 Bacteria 18434
844 Ga0501067_0003265 3300049583 Bacteria 8929
845 Ga0501068_0000562 3300049584 Bacteria 18872
846 Ga0501069_0000891 3300049585 Bacteria 14251
847 Ga0501070_0015586 3300049586 Bacteria 6390
848 Ga0501070_0059240 3300049586 Unclassified 3175
849 Ga0501071_0008212 3300049587 Bacteria 6889
850 Ga0501072_0016238 3300049588 Bacteria 5711
851 Ga0501072_0020497 3300049588 Bacteria 5124
852 Ga0501072_0033060 3300049588 Bacteria 4052
853 Ga0501073_0000325 3300049589 Bacteria 31963
854 Ga0501074_0006426 3300049590 Bacteria 8488
855 Ga0501075_0012568 3300049591 Bacteria 6022
856 Ga0501075_0052189 3300049591 Bacteria 3075
857 Ga0501076_0002529 3300049592 Bacteria 12587
858 Ga0501076_0066478 3300049592 Bacteria 2878
859 Ga0501077_0002095 3300049593 Bacteria 12024
860 Ga0501077_0020860 3300049593 Bacteria 4148
861 Ga0501077_0056627 3300049593 Bacteria 2489
862 Ga0501202_004894 3300049652 Unclassified 2357
863 Ga0501216_000493 3300049660 Unclassified 4702
864 Ga0501217_003324 3300049661 Bacteria 3245
865 Ga0501223_001160 3300049663 Bacteria 6213
866 Ga0501227_000114 3300049665 Bacteria 13866
867 Ga0501227_004903 3300049665 Bacteria 2872
868 Ga0501233_003233 3300049668 Bacteria 2923
869 Ga0501225_0000554 3300049705 Bacteria 11667
870 Ga0501079_0053447 3300049741 Bacteria 3116
871 Ga0501079_0136469 3300049741 Bacteria 1910
872 Ga0501080_0000021 3300049742 Bacteria 91749
873 Ga0501081_0049938 3300049743 Bacteria 2881
874 Ga0501083_0019980 3300049744 Bacteria 4661
875 Ga0501035_0011574 3300049822 Bacteria 8178
876 Ga0501035_0059312 3300049822 Unclassified 3408
877 Ga0501044_0000216 3300049823 Bacteria 73383
878 Ga0501044_0002307 3300049823 Bacteria 21740
879 Ga0501044_0036208 3300049823 Bacteria 5163
880 Ga0501044_0066717 3300049823 Unclassified 3668
881 Ga0501045_0065263 3300049824 Bacteria 2673
882 Ga0501226_000690 3300049853 Unclassified 4576
883 nmdc:mga0k408_1494_c1 3300050493 Bacteria 12614
884 nmdc:mga05p37_10661_c1 3300050507 Bacteria 10904
885 nmdc:mga05p37_115524_c1 3300050507 Bacteria 3299
886 nmdc:mga05p37_117399_c1 3300050507 Bacteria 3270
887 nmdc:mga05p37_117778_c1 3300050507 Bacteria 3264
888 nmdc:mga05p37_1329_c1 3300050507 Bacteria 28742
889 nmdc:mga05p37_24955_c1 3300050507 Bacteria 7266
890 nmdc:mga05p37_2648_c1 3300050507 Bacteria 20851
891 nmdc:mga05p37_28874_c2 3300050507 Bacteria 3925
892 nmdc:mga05p37_32648_c1 3300050507 Bacteria 6368
893 nmdc:mga05p37_3341_c1 3300050507 Bacteria 18704
894 nmdc:mga05p37_592_c1 3300050507 Bacteria 39914
895 nmdc:mga05p37_68247_c1 3300050507 Bacteria 4373
896 nmdc:mga05p37_79500_c2 3300050507 Bacteria 3252
897 nmdc:mga05p37_9746_c1 3300050507 Bacteria 11391
898 nmdc:mga09592_1113_c1 3300050508 Bacteria 21394
899 nmdc:mga09592_13893_c1 3300050508 Bacteria 6580
900 nmdc:mga09592_16083_c1 3300050508 Bacteria 6115
901 nmdc:mga09592_1831_c1 3300050508 Bacteria 17093
902 nmdc:mga09592_22487_c1 3300050508 Bacteria 5204
903 nmdc:mga09592_938_c2 3300050508 Bacteria 8751
904 nmdc:mga0qj67_11023_c1 3300050509 Bacteria 6767
905 nmdc:mga0qj67_29808_c1 3300050509 Bacteria 4240
906 nmdc:mga06r32_11890_c1 3300050510 Bacteria 7840
907 nmdc:mga06r32_21426_c1 3300050510 Bacteria 5966
908 nmdc:mga06r32_26678_c1 3300050510 Bacteria 5389
909 nmdc:mga06r32_58771_c1 3300050510 Bacteria 3696
910 nmdc:mga06r32_58_c1 3300050510 Bacteria 70343
911 nmdc:mga08y16_14144_c1 3300050511 Bacteria 8399
912 nmdc:mga08y16_146_c1 3300050511 Bacteria 61071
913 nmdc:mga08y16_34637_c1 3300050511 Bacteria 5305
914 nmdc:mga08y16_36488_c1 3300050511 Bacteria 5163
915 nmdc:mga0n895_42706_c1 3300050512 Bacteria 4412
916 nmdc:mga0n895_43126_c1 3300050512 Unclassified 4394
917 nmdc:mga0n895_4910_c1 3300050512 Bacteria 11084
918 nmdc:mga0n895_57070_c1 3300050512 Bacteria 3848
919 nmdc:mga0n895_78986_c1 3300050512 Bacteria 3276
920 nmdc:mga0rr50_102_c1 3300050513 Bacteria 48211
921 nmdc:mga0rr50_43696_c1 3300050513 Bacteria 3281
922 nmdc:mga0rr50_87144_c1 3300050513 Bacteria 2423
923 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
924 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
925 nmdc:mga08x19_64191_c1 3300050514 Bacteria 2383
926 nmdc:mga0a205_32836_c1 3300050515 Bacteria 4976
927 nmdc:mga0a205_4537_c1 3300050515 Bacteria 12465
928 nmdc:mga0a205_6406_c1 3300050515 Bacteria 10635
929 nmdc:mga0a205_7360_c1 3300050515 Bacteria 9969
930 nmdc:mga0a205_9887_c1 3300050515 Bacteria 8749
931 Ga0495601_0031920 3300053077 Bacteria 3276
932 Ga0495595_0001844 3300053084 Bacteria 8234
933 Ga0495619_0021532 3300053085 Bacteria 4117
934 Ga0500568_0000518 3300053139 Bacteria 28439
935 Ga0500616_0002309 3300053153 Bacteria 16135
936 Ga0501084_0000522 3300054114 Bacteria 29401
937 Ga0530510_0078992 3300061734 Bacteria 2393
938 Ga0207681_10000423
939 LJQas_1000868
940 JGI24748J21848_1000010
941 JGI24034J26672_10000001
942 JGI24751J29686_10000056
943 JGI25406J46586_10007606
944 Ga0065714_10002185
945 Ga0065704_10001059
946 Ga0065712_10067734
947 Ga0065712_10068249
948 Ga0065712_10072647
949 Ga0065712_10084771
950 Ga0065715_10000261
951 Ga0065715_10018769
952 Ga0065715_10105872
953 Ga0065707_10002155
954 Ga0070658_10000960
955 Ga0070683_100002254
956 Ga0070690_100012354
957 Ga0070670_100000457
958 Ga0070670_100000889
959 Ga0070670_100020612
960 Ga0070670_100043760
961 Ga0068869_100010708
962 Ga0068869_100025839
963 Ga0068869_100032564
964 Ga0070666_10002771
965 Ga0070666_10004126
966 Ga0070666_10009042
967 Ga0070666_10009415
968 Ga0070666_10037182
969 Ga0070666_10056601
970 Ga0070680_100000437
971 Ga0070680_100036985
972 Ga0070680_100049124
973 Ga0070682_100000096
974 Ga0070682_100004613
975 Ga0068868_100003184
976 Ga0068868_100010905
977 Ga0068868_100022494
978 Ga0068868_100025263
979 Ga0068868_100040491
980 Ga0068868_100086623
981 Ga0070660_100027218
982 Ga0070660_100029346
983 Ga0070689_100000127
984 Ga0070689_100000856
985 Ga0070689_100010005
986 Ga0070689_100010218
987 Ga0070691_10027098
988 Ga0070687_100014397
989 Ga0070687_100022143
990 Ga0070661_100069346
991 Ga0070669_100003717
992 Ga0070669_100015027
993 Ga0070669_100044455
994 Ga0070675_100018259
995 Ga0070675_100065694
996 Ga0070671_100003022
997 Ga0070671_100026919
998 Ga0070671_100071814
999 Ga0070674_100019892
1000 Ga0070674_100026204
1001 Ga0070673_100010550
1002 Ga0070673_100018306
1003 Ga0070673_100030427
1004 Ga0070673_100033114
1005 Ga0070688_100000229
1006 Ga0070688_100001221
1007 Ga0070688_100009560
1008 Ga0070688_100009866
1009 Ga0070688_100011187
1010 Ga0070688_100025751
1011 Ga0070659_100025513
1012 Ga0070659_100084858
1013 Ga0070667_100000301
1014 Ga0070667_100027792
1015 Ga0070667_100054234
1016 Ga0070703_10000139
1017 Ga0070703_10000156
1018 Ga0070709_10000043
1019 Ga0070714_100011368
1020 Ga0070713_100000816
1021 Ga0070701_10007325
1022 Ga0070711_100000004
1023 Ga0070711_100000654
1024 Ga0070711_100010243
1025 Ga0070705_100011265
1026 Ga0070700_100009192
1027 Ga0070700_100019804
1028 Ga0070694_100002037
1029 Ga0070694_100004087
1030 Ga0070694_100012106
1031 Ga0070694_100016515
1032 Ga0070694_100027450
1033 Ga0070708_100002466
1034 Ga0070708_100004764
1035 Ga0070708_100052600
1036 Ga0070708_100063018
1037 Ga0070663_100012872
1038 Ga0070678_100018940
1039 Ga0070678_100021908
1040 Ga0070662_100065996
1041 Ga0070681_10000384
1042 Ga0070681_10006589
1043 Ga0070681_10006752
1044 Ga0070681_10006817
1045 Ga0070681_10008029
1046 Ga0070681_10034890
1047 Ga0070681_10051104
1048 Ga0068867_100001381
1049 Ga0068867_100013050
1050 Ga0068867_100037132
1051 Ga0068867_100043858
1052 Ga0070685_10024187
1053 Ga0070706_100000166
1054 Ga0070706_100000398
1055 Ga0070706_100000860
1056 Ga0070706_100001446
1057 Ga0070706_100003791
1058 Ga0070706_100008453
1059 Ga0070706_100020610
1060 Ga0070706_100033837
1061 Ga0070706_100036183
1062 Ga0070707_100003640
1063 Ga0070707_100019807
1064 Ga0070707_100021219
1065 Ga0070707_100026544
1066 Ga0070707_100042070
1067 Ga0070698_100000029
1068 Ga0070698_100000709
1069 Ga0070698_100004914
1070 Ga0070698_100007013
1071 Ga0070698_100018785
1072 Ga0070698_100022176
1073 Ga0070698_100030073
1074 Ga0070698_100117539
1075 Ga0070699_100000122
1076 Ga0070699_100000218
1077 Ga0070699_100001384
1078 Ga0070699_100003321
1079 Ga0070699_100052225
1080 Ga0070699_100052290
1081 Ga0070699_100057369
1082 Ga0070699_100074140
1083 Ga0070699_100078069
1084 Ga0070679_100000891
1085 Ga0070679_100010479
1086 Ga0070679_100037526
1087 Ga0070684_100004578
1088 Ga0070684_100010795
1089 Ga0070684_100014293
1090 Ga0070697_100000027
1091 Ga0070697_100000740
1092 Ga0070697_100001290
1093 Ga0070697_100001537
1094 Ga0070697_100005751
1095 Ga0070697_100027086
1096 Ga0070697_100038821
1097 Ga0070697_100104419
1098 Ga0068853_100002129
1099 Ga0070672_100003849
1100 Ga0070672_100022555
1101 Ga0070672_100054683
1102 Ga0070686_100001910
1103 Ga0070695_100025625
1104 Ga0070695_100041321
1105 Ga0070696_100000006
1106 Ga0070696_100004340
1107 Ga0070696_100007208
1108 Ga0070696_100034950
1109 Ga0070696_100040727
1110 Ga0070693_100000344
1111 Ga0070693_100007936
1112 Ga0070665_100022213
1113 Ga0070665_100024826
1114 Ga0070665_100041869
1115 Ga0070665_100087574
1116 Ga0070665_100092494
1117 Ga0070704_100006593
1118 Ga0068855_100000624
1119 Ga0068855_100010646
1120 Ga0068855_100044406
1121 Ga0070664_100001414
1122 Ga0070664_100005502
1123 Ga0070664_100075792
1124 Ga0068857_100002246
1125 Ga0068857_100009215
1126 Ga0068857_100009576
1127 Ga0068857_100010553
1128 Ga0068857_100012447
1129 Ga0068857_100028931
1130 Ga0068857_100042967
1131 Ga0068857_100056564
1132 Ga0068857_100064634
1133 Ga0068856_100008237
1134 Ga0068856_100014444
1135 Ga0068856_100015202
1136 Ga0068856_100056462
1137 Ga0068856_100091075
1138 Ga0070702_100004086
1139 Ga0070702_100016386
1140 Ga0070702_100033467
1141 Ga0068859_100000577
1142 Ga0068859_100000827
1143 Ga0068859_100010153
1144 Ga0068859_100014348
1145 Ga0068859_100020137
1146 Ga0068859_100025665
1147 Ga0068859_100034802
1148 Ga0068859_100044304
1149 Ga0068859_100057598
1150 Ga0068859_100061782
1151 Ga0068859_100066099
1152 Ga0068859_100066823
1153 Ga0068859_100077152
1154 Ga0068864_100004057
1155 Ga0068864_100011572
1156 Ga0068864_100083660
1157 Ga0068864_100107357
1158 Ga0068864_100111041
1159 Ga0068864_100111325
1160 Ga0068861_100000185
1161 Ga0068861_100010513
1162 Ga0068861_100049058
1163 Ga0068870_10016793
1164 Ga0068863_100020996
1165 Ga0068863_100045265
1166 Ga0068863_100063298
1167 Ga0068858_100000005
1168 Ga0068858_100001131
1169 Ga0068858_100002010
1170 Ga0068860_100000203
1171 Ga0068860_100019485
1172 Ga0068860_100022824
1173 Ga0068860_100061113
1174 Ga0068860_100089412
1175 Ga0081455_10009458
1176 Ga0081455_10010073
1177 Ga0081539_10000307
1178 Ga0081539_10000725
1179 Ga0081539_10000894
1180 Ga0081539_10001567
1181 Ga0081539_10010720
1182 Ga0070717_10035884
1183 Ga0070717_10036060
1184 Ga0070717_10039465
1185 Ga0075365_10009625
1186 Ga0070715_10000010
1187 Ga0070715_10001953
1188 Ga0070716_100020876
1189 Ga0070712_100000276
1190 Ga0075367_10008771
1191 Ga0075367_10013061
1192 Ga0075367_10050528
1193 Ga0075366_10000966
1194 Ga0075366_10044095
1195 Ga0097621_100009142
1196 Ga0097621_100009750
1197 Ga0097621_100053216
1198 Ga0075370_10014599
1199 Ga0068871_100005767
1200 Ga0068871_100014588
1201 Ga0068871_100055036
1202 Ga0075428_100000093
1203 Ga0075428_100000792
1204 Ga0075428_100001532
1205 Ga0075428_100036561
1206 Ga0075428_100043279
1207 Ga0075428_100087429
1208 Ga0075430_100002132
1209 Ga0075430_100012483
1210 Ga0075430_100018772
1211 Ga0075430_100058754
1212 Ga0075431_100000342
1213 Ga0075431_100001335
1214 Ga0075431_100002969
1215 Ga0075431_100014551
1216 Ga0075431_100048359
1217 Ga0075433_10000793
1218 Ga0075433_10005566
1219 Ga0075433_10017277
1220 Ga0075433_10047304
1221 Ga0075433_10053734
1222 Ga0075433_10056234
1223 Ga0075433_10110948
1224 Ga0075434_100000465
1225 Ga0075434_100040858
1226 Ga0075434_100073881
1227 Ga0075429_100000002
1228 Ga0075429_100014714
1229 Ga0075429_100018185
1230 Ga0068865_100003168
1231 Ga0068865_100004487
1232 Ga0068865_100041325
1233 Ga0075436_100000227
1234 Ga0075436_100022002
1235 Ga0075436_100052624
1236 Ga0097620_100000577
1237 Ga0097620_100000827
1238 Ga0097620_100010152
1239 Ga0097620_100014348
1240 Ga0097620_100020137
1241 Ga0097620_100025665
1242 Ga0097620_100034802
1243 Ga0097620_100044303
1244 Ga0097620_100057605
1245 Ga0097620_100061781
1246 Ga0097620_100066097
1247 Ga0097620_100066826
1248 Ga0097620_100077151
1249 Ga0097620_100116788
1250 Ga0075435_100000836
1251 Ga0075435_100007079
1252 Ga0075435_100025891
1253 Ga0105240_10001385
1254 Ga0105240_10001428
1255 Ga0105240_10001456
1256 Ga0105240_10003229
1257 Ga0105240_10019588
1258 Ga0105240_10024286
1259 Ga0105240_10024362
1260 Ga0105240_10039009
1261 Ga0111539_10000270
1262 Ga0111539_10000359
1263 Ga0111539_10000639
1264 Ga0111539_10003639
1265 Ga0111539_10018244
1266 Ga0111539_10019999
1267 Ga0111539_10030975
1268 Ga0111539_10102483
1269 Ga0111539_10112293
1270 Ga0105245_10003883
1271 Ga0105245_10007874
1272 Ga0105245_10012172
1273 Ga0105245_10048621
1274 Ga0105247_10000002
1275 Ga0105247_10006032
1276 Ga0114129_10000371
1277 Ga0114129_10002547
1278 Ga0114129_10003318
1279 Ga0114129_10013218
1280 Ga0114129_10022143
1281 Ga0114129_10024316
1282 Ga0114129_10052384
1283 Ga0114129_10072837
1284 Ga0114129_10084649
1285 Ga0114129_10148116
1286 Ga0105243_10000029
1287 Ga0105243_10001062
1288 Ga0105243_10003523
1289 Ga0105243_10017445
1290 Ga0105243_10028211
1291 Ga0105243_10083543
1292 Ga0105241_10060899
1293 Ga0105242_10000009
1294 Ga0105242_10002213
1295 Ga0105242_10003729
1296 Ga0105242_10004837
1297 Ga0105242_10005256
1298 Ga0105242_10010760
1299 Ga0105242_10035316
1300 Ga0105242_10046208
1301 Ga0105248_10003227
1302 Ga0105248_10005952
1303 Ga0105248_10007406
1304 Ga0105248_10010936
1305 Ga0105248_10013938
1306 Ga0105248_10022647
1307 Ga0105248_10045095
1308 Ga0105248_10050983
1309 Ga0105248_10057412
1310 Ga0105248_10072095
1311 Ga0105237_10001157
1312 Ga0105237_10008964
1313 Ga0105237_10028333
1314 Ga0105237_10045079
1315 Ga0105237_10084134
1316 Ga0105238_10001077
1317 Ga0105238_10003867
1318 Ga0105238_10069054
1319 Ga0105238_10079354
1320 Ga0105249_10000018
1321 Ga0105249_10007173
1322 Ga0105249_10034297
1323 Ga0105239_10010491
1324 Ga0105239_10014002
1325 Ga0105239_10049718
1326 Ga0157373_10001239
1327 Ga0157373_10018234
1328 Ga0157370_10013680
1329 Ga0157370_10017916
1330 Ga0157370_10031960
1331 Ga0157370_10042459
1332 Ga0157370_10066216
1333 Ga0157369_10003469
1334 Ga0157369_10008875
1335 Ga0157369_10026007
1336 Ga0157369_10059828
1337 Ga0157369_10066772
1338 Ga0157374_10010706
1339 Ga0157374_10013441
1340 Ga0157374_10014638
1341 Ga0157374_10095576
1342 Ga0157378_10000003
1343 Ga0157378_10004092
1344 Ga0157378_10008228
1345 Ga0157378_10013737
1346 Ga0157378_10041114
1347 Ga0157378_10061072
1348 Ga0157378_10072976
1349 Ga0157378_10073895
1350 Ga0163162_10000001
1351 Ga0163162_10003865
1352 Ga0163162_10004846
1353 Ga0163162_10006709
1354 Ga0163162_10008625
1355 Ga0163162_10016838
1356 Ga0163162_10024886
1357 Ga0163162_10040212
1358 Ga0163162_10083433
1359 Ga0157372_10011760
1360 Ga0157372_10020033
1361 Ga0157372_10021438
1362 Ga0157372_10039176
1363 Ga0157372_10153046
1364 Ga0157375_10003026
1365 Ga0157375_10008684
1366 Ga0157375_10023102
1367 Ga0157375_10101631
1368 Ga0157375_10122058
1369 Ga0163163_10002690
1370 Ga0163163_10003111
1371 Ga0163163_10022262
1372 Ga0163163_10036179
1373 Ga0163163_10050224
1374 Ga0163163_10055248
1375 Ga0163163_10061388
1376 Ga0163163_10096189
1377 Ga0163163_10109360
1378 Ga0157380_10000235
1379 Ga0157380_10002344
1380 Ga0157380_10003105
1381 Ga0157377_10012932
1382 Ga0157379_10016412
1383 Ga0157379_10020178
1384 Ga0157379_10035617
1385 Ga0157379_10038614
1386 Ga0157379_10040575
1387 Ga0157376_10004399
1388 Ga0157376_10010654
1389 Ga0157376_10011777
1390 Ga0157376_10031286
1391 Ga0163161_10002914
1392 Ga0163161_10005427
1393 Ga0213876_10000060
1394 Ga0213876_10000672
1395 Ga0213876_10043221
1396 Ga0213875_10000004
1397 Ga0224570_100785
1398 Ga0224572_1000011
1399 Ga0228598_1001211
1400 Ga0228598_1002189
1401 Ga0207697_10016557
1402 Ga0207653_10000281
1403 Ga0207653_10001154
1404 Ga0207710_10000002
1405 Ga0207710_10002344
1406 Ga0207680_10000775
1407 Ga0207647_10001588
1408 Ga0207647_10016946
1409 Ga0207647_10036953
1410 Ga0207685_10000006
1411 Ga0207699_10000013
1412 Ga0207699_10044197
1413 Ga0207645_10008986
1414 Ga0207643_10001116
1415 Ga0207643_10003111
1416 Ga0207643_10006159
1417 Ga0207643_10026293
1418 Ga0207705_10012447
1419 Ga0207684_10000073
1420 Ga0207684_10000358
1421 Ga0207684_10000484
1422 Ga0207684_10002122
1423 Ga0207684_10004142
1424 Ga0207684_10005339
1425 Ga0207684_10014840
1426 Ga0207684_10016528
1427 Ga0207684_10021390
1428 Ga0207684_10032586
1429 Ga0207684_10090334
1430 Ga0207707_10000072
1431 Ga0207707_10002540
1432 Ga0207707_10003681
1433 Ga0207707_10005324
1434 Ga0207707_10055899
1435 Ga0207695_10000770
1436 Ga0207695_10009550
1437 Ga0207695_10009742
1438 Ga0207695_10013269
1439 Ga0207695_10018088
1440 Ga0207695_10018870
1441 Ga0207695_10044282
1442 Ga0207695_10104307
1443 Ga0207671_10005189
1444 Ga0207671_10009114
1445 Ga0207693_10000098
1446 Ga0207693_10064925
1447 Ga0207663_10000007
1448 Ga0207660_10004578
1449 Ga0207660_10017258
1450 Ga0207662_10001235
1451 Ga0207662_10005860
1452 Ga0207657_10002229
1453 Ga0207657_10044481
1454 Ga0207657_10055694
1455 Ga0207649_10030885
1456 Ga0207652_10000083
1457 Ga0207646_10000077
1458 Ga0207646_10001197
1459 Ga0207646_10002745
1460 Ga0207646_10003355
1461 Ga0207646_10011752
1462 Ga0207646_10033411
1463 Ga0207646_10047884
1464 Ga0207646_10051578
1465 Ga0207681_10008623
1466 Ga0207681_10008802
1467 Ga0207681_10068003
1468 Ga0207694_10000399
1469 Ga0207694_10000484
1470 Ga0207694_10005539
1471 Ga0207694_10008467
1472 Ga0207650_10000001
1473 Ga0207650_10000975
1474 Ga0207650_10005521
1475 Ga0207650_10011168
1476 Ga0207650_10014884
1477 Ga0207650_10043071
1478 Ga0207687_10014145
1479 Ga0207687_10023586
1480 Ga0207687_10024053
1481 Ga0207700_10001351
1482 Ga0207700_10019546
1483 Ga0207664_10026699
1484 Ga0207644_10050611
1485 Ga0207706_10003118
1486 Ga0207706_10009857
1487 Ga0207706_10026585
1488 Ga0207686_10000010
1489 Ga0207686_10000360
1490 Ga0207686_10004290
1491 Ga0207686_10009067
1492 Ga0207686_10018488
1493 Ga0207686_10018566
1494 Ga0207709_10000052
1495 Ga0207709_10001851
1496 Ga0207709_10010398
1497 Ga0207709_10023872
1498 Ga0207670_10000021
1499 Ga0207670_10000357
1500 Ga0207670_10006501
1501 Ga0207665_10000131
1502 Ga0207665_10054042
1503 Ga0207691_10003188
1504 Ga0207691_10008810
1505 Ga0207691_10009824
1506 Ga0207691_10011274
1507 Ga0207691_10027930
1508 Ga0207711_10000701
1509 Ga0207711_10003858
1510 Ga0207711_10003901
1511 Ga0207711_10010374
1512 Ga0207711_10010593
1513 Ga0207711_10026917
1514 Ga0207711_10036761
1515 Ga0207711_10046503
1516 Ga0207711_10059096
1517 Ga0207711_10071949
1518 Ga0207711_10072763
1519 Ga0207689_10003403
1520 Ga0207689_10005347
1521 Ga0207689_10010417
1522 Ga0207689_10015475
1523 Ga0207689_10038116
1524 Ga0207667_10000776
1525 Ga0207667_10004773
1526 Ga0207667_10027335
1527 Ga0207667_10029550
1528 Ga0207667_10108979
1529 Ga0207651_10018083
1530 Ga0207712_10000022
1531 Ga0207712_10003603
1532 Ga0207712_10005702
1533 Ga0207712_10011661
1534 Ga0207658_10001561
1535 Ga0207658_10057956
1536 Ga0207677_10008941
1537 Ga0207677_10060924
1538 Ga0207703_10000150
1539 Ga0207703_10005172
1540 Ga0207703_10009246
1541 Ga0207703_10030945
1542 Ga0207703_10031126
1543 Ga0207639_10001238
1544 Ga0207639_10002185
1545 Ga0207678_10001610
1546 Ga0207708_10000108
1547 Ga0207708_10004583
1548 Ga0207708_10007856
1549 Ga0207708_10008373
1550 Ga0207708_10008875
1551 Ga0207708_10019797
1552 Ga0207708_10020224
1553 Ga0207702_10008490
1554 Ga0207702_10019455
1555 Ga0207702_10031462
1556 Ga0207641_10002868
1557 Ga0207641_10004650
1558 Ga0207641_10013955
1559 Ga0207641_10019450
1560 Ga0207641_10039085
1561 Ga0207648_10000817
1562 Ga0207648_10000889
1563 Ga0207648_10009035
1564 Ga0207648_10016996
1565 Ga0207648_10022944
1566 Ga0207648_10029182
1567 Ga0207648_10032063
1568 Ga0207676_10000852
1569 Ga0207676_10002434
1570 Ga0207676_10011182
1571 Ga0207676_10017369
1572 Ga0207676_10064210
1573 Ga0207674_10001937
1574 Ga0207674_10003646
1575 Ga0207674_10005082
1576 Ga0207674_10013398
1577 Ga0207674_10020265
1578 Ga0207674_10022367
1579 Ga0207674_10031078
1580 Ga0207674_10078171
1581 Ga0207675_100014932
1582 Ga0207675_100016144
1583 Ga0207683_10007261
1584 Ga0207683_10039798
1585 Ga0207428_10000614
1586 Ga0207428_10000773
1587 Ga0207428_10031741
1588 Ga0207428_10034624
1589 Ga0268266_10003065
1590 Ga0268266_10009330
1591 Ga0268266_10083407
1592 Ga0268265_10014278
1593 Ga0268265_10024548
1594 Ga0268265_10046235
1595 Ga0268264_10002013
1596 Ga0268264_10005556
1597 Ga0268264_10028324
1598 Ga0268264_10080842
1599 Ga0268264_10091034
1600 Ga0265323_10000130
1601 Ga0265762_1000081
1602 Ga0265762_1005107
1603 Ga0265760_10000009
1604 Ga0265760_10000098
1605 Ga0265330_10019986
1606 Ga0265325_10033521
1607 Ga0265339_10000007
1608 Ga0265331_10027474
1609 Ga0265316_10014362
1610 Ga0265316_10042130
1611 Ga0265316_10062833
1612 Ga0307408_100007180
1613 Ga0307408_100058670
1614 Ga0265313_10002310
1615 Ga0265314_10001577
1616 Ga0265314_10013999
1617 Ga0265342_10007066
1618 Ga0265342_10017289
1619 Ga0316576_10003605
1620 Ga0316576_10005304
1621 Ga0316578_10061767
1622 Ga0307405_10003081
1623 Ga0307405_10005843
1624 Ga0307405_10010329
1625 Ga0307405_10013967
1626 Ga0316577_10004385
1627 Ga0307413_10000419
1628 Ga0307413_10001511
1629 Ga0307413_10009262
1630 Ga0307410_10005053
1631 Ga0307410_10011796
1632 Ga0307406_10009094
1633 Ga0307407_10003711
1634 Ga0307412_10011010
1635 Ga0307409_100010838
1636 Ga0307409_100013398
1637 Ga0307409_100044171
1638 Ga0307409_100053454
1639 Ga0307416_100008383
1640 Ga0307416_100018467
1641 Ga0307416_100020229
1642 Ga0307416_100049460
1643 Ga0307416_100084321
1644 Ga0307414_10001198
1645 Ga0307414_10004222
1646 Ga0307411_10002441
1647 Ga0307411_10029383
1648 Ga0307411_10036054
1649 Ga0307415_100014621
1650 Ga0307415_100020145
1651 Ga0307415_100058605
1652 Ga0373934_0000737
1653 Ga0373954_0003390
1654 Ga0373957_0008556
1655 Ga0373943_0008519
1656 Ga0316574_0010997
1657 Ga0373935_0015007
1658 Ga0373935_0031021
1659 Ga0373927_0000650
1660 Ga0373927_0023863
1661 Ga0373933_0033474
1662 Ga0373947_0000881
1663 Ga0373947_0007101
1664 Ga0373937_0000177
1665 Ga0373937_0151650
1666 Ga0373937_0183489
1667 Ga0316584_0047451
1668 Ga0373925_0000106
1669 Ga0373925_0019844
1670 Ga0373925_0042695
1671 Ga0395898_0137215
1672 Ga0395905_0009429
1673 Ga0395905_0013089
1674 Ga0395905_0038282
1675 Ga0436364_0940056
1676 Ga0395901_0024217
1677 Ga0400490_21032
1678 Ga0436365_0073541
1679 Ga0436365_0706054
1680 Ga0436365_0712936
1681 Ga0436365_1344587
1682 Ga0436365_1844718
1683 Ga0436363_0316808
1684 Ga0436362_0840442
1685 Ga0439458_0000581
1686 Ga0451577_0000277
1687 Ga0451577_0007367
1688 Ga0451577_0032615
1689 Ga0451577_0058943
1690 Ga0451577_0102679
1691 Ga0453683_0007108
1692 Ga0453683_0010614
1693 Ga0466961_0037306
1694 Ga0453684_0000480
1695 Ga0453684_0000579
1696 Ga0453684_0032388
1697 Ga0453684_0073205
1698 Ga0451576_0003285
1699 Ga0451576_0012217
1700 Ga0451576_0029030
1701 Ga0451576_0076609
1702 Ga0451576_0195420
1703 Ga0495580_0000043
1704 Ga0495580_0006379
1705 Ga0495580_0011775
1706 Ga0495580_0021333
1707 Ga0495580_0026354
1708 Ga0495664_0005344
1709 Ga0495608_0030493
1710 Ga0495618_0000195
1711 Ga0495628_0000254
1712 Ga0495663_0000219
1713 Ga0495652_0045172
1714 Ga0495587_0009310
1715 Ga0495587_0020919
1716 Ga0495598_0000387
1717 Ga0495621_0000861
1718 Ga0495621_0005738
1719 Ga0495636_0010853
1720 Ga0495674_0042026
1721 Ga0495672_0000838
1722 Ga0495675_0007191
1723 Ga0495684_0022118
1724 Ga0495602_0001165
1725 Ga0496101_0002844
1726 Ga0496102_0003497
1727 Ga0496102_0031287
1728 Ga0496103_0007042
1729 Ga0496103_0030695
1730 Ga0496104_0001246
1731 Ga0496104_0006828
1732 Ga0496104_0158199
1733 Ga0496105_0000444
1734 Ga0496105_0048241
1735 Ga0496106_0000917
1736 Ga0496106_0003208
1737 Ga0496106_0018360
1738 Ga0496106_0043872
1739 Ga0496107_0000595
1740 Ga0496108_0006367
1741 Ga0496108_0012332
1742 Ga0496108_0030135
1743 Ga0496108_0042209
1744 Ga0496109_0000092
1745 Ga0496109_0022565
1746 Ga0496109_0050032
1747 Ga0496109_0099946
1748 Ga0496110_0000903
1749 Ga0496110_0016015
1750 Ga0496111_0000905
1751 Ga0496111_0002217
1752 Ga0496111_0046886
1753 Ga0496111_0070306
1754 Ga0496111_0086579
1755 Ga0496112_0000213
1756 Ga0496112_0000524
1757 Ga0496112_0000698
1758 Ga0496112_0022997
1759 Ga0496112_0032933
1760 Ga0496112_0106936
1761 Ga0496112_0116663
1762 Ga0496112_0126690
1763 Ga0496113_0030000
1764 Ga0496115_0029025
1765 Ga0496115_0067484
1766 Ga0501299_000656
1767 Ga0501031_0005492
1768 Ga0501031_0035805
1769 Ga0501032_0001821
1770 Ga0501034_0002545
1771 Ga0501034_0008364
1772 Ga0501036_0000814
1773 Ga0501038_0005231
1774 Ga0501038_0005530
1775 Ga0501042_0046546
1776 Ga0501046_0000783
1777 Ga0501046_0024390
1778 Ga0501047_0015423
1779 Ga0501047_0103961
1780 Ga0501048_0001371
1781 Ga0501067_0003265
1782 Ga0501068_0000562
1783 Ga0501069_0000891
1784 Ga0501070_0015586
1785 Ga0501070_0059240
1786 Ga0501071_0008212
1787 Ga0501072_0016238
1788 Ga0501072_0020497
1789 Ga0501072_0033060
1790 Ga0501073_0000325
1791 Ga0501074_0006426
1792 Ga0501075_0012568
1793 Ga0501075_0052189
1794 Ga0501076_0002529
1795 Ga0501076_0066478
1796 Ga0501077_0002095
1797 Ga0501077_0020860
1798 Ga0501077_0056627
1799 Ga0501202_004894
1800 Ga0501216_000493
1801 Ga0501217_003324
1802 Ga0501223_001160
1803 Ga0501227_000114
1804 Ga0501227_004903
1805 Ga0501233_003233
1806 Ga0501225_0000554
1807 Ga0501079_0053447
1808 Ga0501079_0136469
1809 Ga0501080_0000021
1810 Ga0501081_0049938
1811 Ga0501083_0019980
1812 Ga0501035_0011574
1813 Ga0501035_0059312
1814 Ga0501044_0000216
1815 Ga0501044_0002307
1816 Ga0501044_0036208
1817 Ga0501044_0066717
1818 Ga0501045_0065263
1819 Ga0501226_000690
1820 nmdc:mga0k408_1494_c1
1821 nmdc:mga05p37_10661_c1
1822 nmdc:mga05p37_115524_c1
1823 nmdc:mga05p37_117399_c1
1824 nmdc:mga05p37_117778_c1
1825 nmdc:mga05p37_1329_c1
1826 nmdc:mga05p37_24955_c1
1827 nmdc:mga05p37_2648_c1
1828 nmdc:mga05p37_28874_c2
1829 nmdc:mga05p37_32648_c1
1830 nmdc:mga05p37_3341_c1
1831 nmdc:mga05p37_592_c1
1832 nmdc:mga05p37_68247_c1
1833 nmdc:mga05p37_79500_c2
1834 nmdc:mga05p37_9746_c1
1835 nmdc:mga09592_1113_c1
1836 nmdc:mga09592_13893_c1
1837 nmdc:mga09592_16083_c1
1838 nmdc:mga09592_1831_c1
1839 nmdc:mga09592_22487_c1
1840 nmdc:mga09592_938_c2
1841 nmdc:mga0qj67_11023_c1
1842 nmdc:mga0qj67_29808_c1
1843 nmdc:mga06r32_11890_c1
1844 nmdc:mga06r32_21426_c1
1845 nmdc:mga06r32_26678_c1
1846 nmdc:mga06r32_58771_c1
1847 nmdc:mga06r32_58_c1
1848 nmdc:mga08y16_14144_c1
1849 nmdc:mga08y16_146_c1
1850 nmdc:mga08y16_34637_c1
1851 nmdc:mga08y16_36488_c1
1852 nmdc:mga0n895_42706_c1
1853 nmdc:mga0n895_43126_c1
1854 nmdc:mga0n895_4910_c1
1855 nmdc:mga0n895_57070_c1
1856 nmdc:mga0n895_78986_c1
1857 nmdc:mga0rr50_102_c1
1858 nmdc:mga0rr50_43696_c1
1859 nmdc:mga0rr50_87144_c1
1860 nmdc:mga08x19_29_c1
1861 nmdc:mga08x19_2_c1
1862 nmdc:mga08x19_64191_c1
1863 nmdc:mga0a205_32836_c1
1864 nmdc:mga0a205_4537_c1
1865 nmdc:mga0a205_6406_c1
1866 nmdc:mga0a205_7360_c1
1867 nmdc:mga0a205_9887_c1
1868 Ga0495601_0031920
1869 Ga0495595_0001844
1870 Ga0495619_0021532
1871 Ga0500568_0000518
1872 Ga0500616_0002309
1873 Ga0501084_0000522
1874 Ga0530510_0078992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

665

787

0.98

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

459

648

0.95

PF00676

E1_dh

Dehydrogenase E1 component

114

429

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9612 407 746
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9583 407 746
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9571 407 746
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9543 407 746
1w88-assembly2.cif.gz_H the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9535 407 746
ID Description Score Start End Superfamily
af_B4FUC1_232_362_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9842 614 743 3.40.50.920
af_Q8IL09_280_409_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9795 615 741 3.40.50.920
af_E5RPJ6_273_405_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9752 615 743 3.40.50.920
1um9D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9746 617 746 3.40.50.920
af_P9WIS1_221_343_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9696 620 741 3.40.50.920
ID Description Score Start End GO Terms
AF-D3JWS9-F1-model_v4 Pyruvate dehydrogenase (EC 1.2.4.1) 0.9995 611 679 GO:0004739
AF-A0A3C0PJ04-F1-model_v4 2-oxoisovalerate dehydrogenase 0.9848 612 746 GO:0003824
AF-A0A3D5M3Q5-F1-model_v4 Dehydrogenase 0.9846 638 746 GO:0004739
AF-A0A2V9IZM1-F1-model_v4 Dehydrogenase 0.9841 610 746 GO:0003824
AF-A0A812NNP2-F1-model_v4 BCDH BETA1 protein 0.9838 615 746 GO:0003824
GO:0007584
GO:0009083

Map