F486222
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 714 | 1874 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10274169|Ga0207639_102741692 |
| Length | 312 |
| Sequence | MIDVSNLVVRLGGKAVVKEVSFAAEPGTLTAICGPNGSGKTTTMKAISGELAYQGSVHMNGSEIGSLQAWQLAEMRGVLPQASSISFPFTVREIVRMGLTTGRNSRPEQADRIAADALACVDLIGFEGRFYQELSGGEQQRVQLARVLCQISEPVIDGKPCWLLLDEPVSSLDISHQLTIMTLARQFCRRGGGVIAVMHDLNLTALFADQMVLLKEGQLRAAGPVREVLQDRHLQDIFGCNLRVNRIPADGVPFVLAHSALPWAPVVPDPEPAEVRPRVYRTRAALSVRLARIADAVAPRGWVPQHHTASSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 30 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 38 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 46 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 47 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 48 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 49 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 50 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 82 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 83 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 84 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 85 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 89 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 90 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 91 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 92 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 93 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 94 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 95 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 96 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 98 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 99 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 100 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 101 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 102 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 103 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 104 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 105 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 106 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 107 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 108 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 111 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 167 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 168 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 169 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 170 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 173 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 176 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 177 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 199 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 200 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 201 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 202 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 203 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 204 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 205 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 206 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 207 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 208 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 209 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 213 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 214 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 215 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 216 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 217 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 219 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 220 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 223 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 224 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 225 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 226 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 227 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 228 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 229 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 230 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 231 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 232 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 233 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 234 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 235 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 236 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 237 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 238 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 239 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 240 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 241 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 242 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 243 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 244 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 245 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 246 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 247 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 248 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 249 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 250 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 251 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 252 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 253 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 254 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 255 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 256 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 257 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 258 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 259 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 260 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 261 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 262 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 263 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 264 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 265 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 266 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 267 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 268 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 269 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 270 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 271 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 272 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 273 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 274 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 275 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 276 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 277 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 278 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 279 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 280 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 281 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 282 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 283 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 284 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 285 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 286 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 287 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 288 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 289 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 290 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 291 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 292 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 293 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 294 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 295 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 296 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 297 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 298 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 299 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 300 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 301 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 302 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 303 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 304 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 305 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 306 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 307 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 308 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 309 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 310 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 311 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 312 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 313 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 314 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 315 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 316 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 317 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 318 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 319 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 320 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 321 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 322 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 323 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 324 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 325 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 326 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 327 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 328 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 329 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 330 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 331 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 332 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 333 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 334 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 335 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 336 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 337 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 338 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 339 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 340 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 341 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 342 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 343 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 344 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 345 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 346 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 347 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 348 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 349 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 350 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 351 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 352 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 353 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 354 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 355 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 356 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 357 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 358 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 359 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 360 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 361 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 362 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 363 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 364 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 365 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 366 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 367 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 368 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 369 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 370 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 371 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 372 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 373 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 374 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 375 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 376 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 377 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 378 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 379 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 380 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 381 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 382 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 383 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 384 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 385 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 386 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 387 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 388 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 389 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 390 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 391 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 392 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 393 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 394 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 395 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 396 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 397 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 398 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 399 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 400 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 401 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 402 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 403 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 404 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 405 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 406 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 407 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 408 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 409 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 410 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 411 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 412 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 413 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 414 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 415 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 416 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 417 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 418 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 419 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 420 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 421 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 422 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 423 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 424 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 425 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 426 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 427 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 428 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 429 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 430 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 431 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 432 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 433 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 434 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 435 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 436 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 437 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 438 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 439 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 440 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 441 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 442 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 443 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 444 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 445 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 446 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 447 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 448 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 449 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 450 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 451 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 452 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 453 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 454 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 455 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 456 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 457 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 458 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 459 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 460 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 461 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 462 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 463 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 464 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 465 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 466 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 467 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 468 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 469 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 470 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 471 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 472 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 473 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 474 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 475 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 476 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 477 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 478 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 479 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 480 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 481 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 482 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 483 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 484 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 485 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 486 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 487 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 488 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 489 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 490 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 491 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 492 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 493 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 494 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 495 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 496 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 497 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 498 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 499 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 500 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 501 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 502 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 503 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 504 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 505 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 506 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 507 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 508 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 509 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 510 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 511 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 512 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 513 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 514 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 515 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 516 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 517 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 518 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 519 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 520 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 521 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 522 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 523 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 524 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 525 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 526 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 527 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 528 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 529 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 530 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 531 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 532 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 533 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 534 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 535 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 536 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 537 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 538 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 539 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 540 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 541 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 542 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 543 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 544 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 545 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 546 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 547 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 548 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 549 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 550 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 551 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 552 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 553 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 554 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 555 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 556 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 557 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 558 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 559 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 560 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 561 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 562 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 563 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 564 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 565 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 566 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 567 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 568 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 569 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 570 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 571 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 572 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 573 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 574 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 575 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 576 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 577 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 578 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 579 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 580 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 581 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 582 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 583 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 584 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 585 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 586 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 587 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 588 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 589 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 590 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 591 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 592 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 593 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 594 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 595 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 596 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 597 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 598 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 599 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 600 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 601 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 602 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 603 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 604 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 605 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 606 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 607 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 608 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 609 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 610 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 611 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 612 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 613 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 614 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 615 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 616 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 617 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 618 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 619 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 620 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 621 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 622 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 623 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 624 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 625 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 626 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 627 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 628 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 629 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 630 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 631 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 632 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 633 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 634 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 635 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 636 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 637 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 638 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 639 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 640 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 641 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 642 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 643 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 644 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 645 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 646 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 647 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 648 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 649 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 650 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 651 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 652 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 653 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 654 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 655 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 656 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 657 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 658 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 659 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 660 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 661 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 662 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 663 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 664 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 665 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 666 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 667 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 668 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 669 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 670 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 671 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 672 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 673 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 674 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 675 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 676 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 677 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 678 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 679 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 680 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 681 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 682 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 683 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 684 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 685 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 686 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 687 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 688 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 689 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 690 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 691 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 692 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 693 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 694 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 695 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 696 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 697 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 698 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 699 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 700 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 701 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 702 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 703 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 704 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 705 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 706 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 707 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 708 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 709 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 710 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 711 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 712 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 713 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 714 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.39 |
| Metatranscriptomes | 0 |
| Isolates | 52.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.61 |
| Nodule | 41.52 |
| Rhizoplane | 1.81 |
| Rhizosphere | 23.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207639_10274169 | 3300026041 | Bacteria | 1481 |
| 2 | JGI24740J21852_10004555 | 3300001979 | Bacteria | 5963 |
| 3 | JGI25162J39368_1000149 | 3300002737 | Bacteria | 76227 |
| 4 | JGI25162J39368_1000211 | 3300002737 | Bacteria | 61063 |
| 5 | JGI25152J39213_1000899 | 3300002773 | Bacteria | 14563 |
| 6 | JGI25152J39213_1003034 | 3300002773 | Bacteria | 5924 |
| 7 | JGI25159J45721_1000008 | 3300002987 | Bacteria | 172667 |
| 8 | JGI25159J45721_1006352 | 3300002987 | Bacteria | 3547 |
| 9 | JGI25151J46595_10000027 | 3300003187 | Bacteria | 208739 |
| 10 | JGI25151J46595_10001211 | 3300003187 | Bacteria | 18438 |
| 11 | JGI25151J46595_10008331 | 3300003187 | Bacteria | 4995 |
| 12 | JGI25151J46595_10014542 | 3300003187 | Bacteria | 3502 |
| 13 | JGI25151J46595_10022311 | 3300003187 | Bacteria | 2631 |
| 14 | JGI25165J46597_1000938 | 3300003214 | Bacteria | 19980 |
| 15 | JGI25165J46597_1001280 | 3300003214 | Bacteria | 14630 |
| 16 | JGI25165J46597_1004226 | 3300003214 | Bacteria | 3165 |
| 17 | JGI25153J46596_10000608 | 3300003215 | Bacteria | 21909 |
| 18 | JGI25153J46596_10003461 | 3300003215 | Bacteria | 8839 |
| 19 | JGI25153J46596_10007133 | 3300003215 | Bacteria | 5544 |
| 20 | rootL2_10007936 | 3300003322 | Bacteria | 8791 |
| 21 | rootH1_10025853 | 3300003323 | Bacteria | 1804 |
| 22 | rootH1_10025854 | 3300003323 | Bacteria | 2122 |
| 23 | rootH1_10148901 | 3300003323 | Bacteria | 1207 |
| 24 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 25 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 26 | JGI25160J50197_1001321 | 3300003354 | Bacteria | 12519 |
| 27 | JGI25160J50197_1001492 | 3300003354 | Bacteria | 11623 |
| 28 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 29 | JGI25161J50226_1000163 | 3300003374 | Bacteria | 46470 |
| 30 | JGI25161J50226_1002090 | 3300003374 | Bacteria | 5397 |
| 31 | Ga0055526_1001871 | 3300003771 | Bacteria | 14577 |
| 32 | Ga0055526_1002020 | 3300003771 | Bacteria | 13960 |
| 33 | Ga0055526_1002721 | 3300003771 | Bacteria | 11747 |
| 34 | Ga0055526_1025387 | 3300003771 | Bacteria | 1903 |
| 35 | Ga0055524_1001345 | 3300003775 | Bacteria | 14335 |
| 36 | Ga0055524_1012228 | 3300003775 | Bacteria | 3305 |
| 37 | Ga0055524_1023782 | 3300003775 | Bacteria | 1964 |
| 38 | Ga0055524_1043633 | 3300003775 | Bacteria | 1100 |
| 39 | Ga0055528_1000247 | 3300003790 | Bacteria | 45698 |
| 40 | Ga0055528_1003198 | 3300003790 | Bacteria | 8371 |
| 41 | Ga0055528_1008999 | 3300003790 | Bacteria | 4215 |
| 42 | Ga0055528_1026883 | 3300003790 | Bacteria | 1638 |
| 43 | Ga0055540_1000607 | 3300003792 | Bacteria | 25671 |
| 44 | Ga0055540_1001828 | 3300003792 | Bacteria | 12035 |
| 45 | Ga0055531_10030140 | 3300003794 | Bacteria | 1830 |
| 46 | Ga0055543_1000007 | 3300004625 | Bacteria | 204042 |
| 47 | Ga0055543_1000026 | 3300004625 | Bacteria | 136177 |
| 48 | Ga0055543_1000104 | 3300004625 | Bacteria | 73576 |
| 49 | Ga0055543_1000108 | 3300004625 | Bacteria | 71519 |
| 50 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 51 | Ga0065165_1000178 | 3300005262 | Bacteria | 113319 |
| 52 | Ga0065165_1010050 | 3300005262 | Bacteria | 4155 |
| 53 | Ga0065165_1033708 | 3300005262 | Bacteria | 1591 |
| 54 | Ga0070670_100001446 | 3300005331 | Bacteria | 19064 |
| 55 | Ga0070668_100483315 | 3300005347 | Bacteria | 1070 |
| 56 | Ga0070665_100146523 | 3300005548 | Bacteria | 2364 |
| 57 | Ga0070665_100169482 | 3300005548 | Bacteria | 2185 |
| 58 | Ga0070665_100326144 | 3300005548 | Bacteria | 1539 |
| 59 | Ga0068855_100100926 | 3300005563 | Bacteria | 3322 |
| 60 | Ga0068856_100039412 | 3300005614 | Bacteria | 4639 |
| 61 | Ga0068856_100053210 | 3300005614 | Bacteria | 3992 |
| 62 | Ga0068852_100312888 | 3300005616 | Bacteria | 1523 |
| 63 | Ga0075365_10002133 | 3300006038 | Bacteria | 9493 |
| 64 | Ga0075365_10083738 | 3300006038 | Bacteria | 2164 |
| 65 | Ga0075365_10215109 | 3300006038 | Bacteria | 1348 |
| 66 | Ga0075363_100127193 | 3300006048 | Bacteria | 1427 |
| 67 | Ga0075362_10007089 | 3300006177 | Bacteria | 4218 |
| 68 | Ga0075367_10002388 | 3300006178 | Bacteria | 8556 |
| 69 | Ga0075369_10001117 | 3300006186 | Bacteria | 9017 |
| 70 | Ga0075369_10097713 | 3300006186 | Bacteria | 1315 |
| 71 | Ga0075370_10034712 | 3300006353 | Bacteria | 2828 |
| 72 | Ga0079104_1005065 | 3300006946 | Bacteria | 5372 |
| 73 | Ga0105244_10189625 | 3300009036 | Bacteria | 973 |
| 74 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 75 | Ga0105237_10001161 | 3300009545 | Bacteria | 35234 |
| 76 | Ga0105238_10566216 | 3300009551 | Bacteria | 1141 |
| 77 | Ga0123341_1000018 | 3300009765 | Bacteria | 81421 |
| 78 | Ga0123341_1078856 | 3300009765 | Bacteria | 1318 |
| 79 | Ga0123341_1090639 | 3300009765 | Bacteria | 1099 |
| 80 | Ga0123342_1009978 | 3300009766 | Bacteria | 11071 |
| 81 | Ga0123342_1038664 | 3300009766 | Bacteria | 1848 |
| 82 | Ga0105239_10005301 | 3300010375 | Bacteria | 15145 |
| 83 | Ga0157373_10123453 | 3300013100 | Bacteria | 1820 |
| 84 | Ga0157370_10000015 | 3300013104 | Bacteria | 185771 |
| 85 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 86 | Ga0182008_10060340 | 3300014497 | Bacteria | 1870 |
| 87 | Ga0182007_10000385 | 3300015262 | Bacteria | 27600 |
| 88 | Ga0183363_1078 | 3300015690 | Bacteria | 29406 |
| 89 | Ga0214542_1015589 | 3300021321 | Bacteria | 7832 |
| 90 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 91 | Ga0228711_1000017 | 3300022739 | Bacteria | 121084 |
| 92 | Ga0228710_1000005 | 3300022740 | Bacteria | 233531 |
| 93 | Ga0209436_100058 | 3300025208 | Bacteria | 60755 |
| 94 | Ga0209436_101354 | 3300025208 | Bacteria | 8660 |
| 95 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 96 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 97 | Ga0207425_1000043 | 3300025245 | Bacteria | 208791 |
| 98 | Ga0207425_1000436 | 3300025245 | Bacteria | 27617 |
| 99 | Ga0207425_1002033 | 3300025245 | Bacteria | 7534 |
| 100 | Ga0209677_100289 | 3300025253 | Bacteria | 33302 |
| 101 | Ga0209148_1003810 | 3300025254 | Bacteria | 3949 |
| 102 | Ga0209129_1000072 | 3300025258 | Bacteria | 208805 |
| 103 | Ga0209129_1000128 | 3300025258 | Bacteria | 130420 |
| 104 | Ga0209129_1000765 | 3300025258 | Bacteria | 20447 |
| 105 | Ga0209129_1001667 | 3300025258 | Bacteria | 12027 |
| 106 | Ga0209129_1004976 | 3300025258 | Bacteria | 4912 |
| 107 | Ga0209129_1006922 | 3300025258 | Bacteria | 3510 |
| 108 | Ga0209129_1006924 | 3300025258 | Bacteria | 3509 |
| 109 | Ga0209233_1000137 | 3300025261 | Bacteria | 200314 |
| 110 | Ga0209233_1000149 | 3300025261 | Bacteria | 181183 |
| 111 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 112 | Ga0209233_1013152 | 3300025261 | Bacteria | 2370 |
| 113 | Ga0209565_1030534 | 3300025263 | Bacteria | 1052 |
| 114 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 115 | Ga0209673_1000125 | 3300025273 | Bacteria | 168465 |
| 116 | Ga0209673_1000256 | 3300025273 | Bacteria | 100514 |
| 117 | Ga0209673_1001756 | 3300025273 | Bacteria | 18064 |
| 118 | Ga0209673_1003121 | 3300025273 | Bacteria | 10126 |
| 119 | Ga0209673_1004623 | 3300025273 | Bacteria | 7285 |
| 120 | Ga0209673_1037816 | 3300025273 | Bacteria | 1413 |
| 121 | Ga0209673_1053543 | 3300025273 | Bacteria | 1052 |
| 122 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 123 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 124 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 125 | Ga0209675_1028676 | 3300025291 | Bacteria | 1350 |
| 126 | Ga0209676_1012015 | 3300025292 | Bacteria | 3442 |
| 127 | Ga0209676_1034027 | 3300025292 | Bacteria | 1510 |
| 128 | Ga0209025_1000120 | 3300025294 | Bacteria | 208791 |
| 129 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 130 | Ga0209025_1000451 | 3300025294 | Bacteria | 80470 |
| 131 | Ga0209025_1000537 | 3300025294 | Bacteria | 71838 |
| 132 | Ga0209025_1000545 | 3300025294 | Bacteria | 70608 |
| 133 | Ga0209025_1008140 | 3300025294 | Bacteria | 7612 |
| 134 | Ga0209025_1009023 | 3300025294 | Bacteria | 7037 |
| 135 | Ga0209025_1076920 | 3300025294 | Bacteria | 1153 |
| 136 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 137 | Ga0209564_1000259 | 3300025295 | Bacteria | 112570 |
| 138 | Ga0209564_1000841 | 3300025295 | Bacteria | 41363 |
| 139 | Ga0209564_1002367 | 3300025295 | Bacteria | 15158 |
| 140 | Ga0209564_1002386 | 3300025295 | Bacteria | 15044 |
| 141 | Ga0209564_1010644 | 3300025295 | Bacteria | 4209 |
| 142 | Ga0209564_1020991 | 3300025295 | Bacteria | 2370 |
| 143 | Ga0209758_1000111 | 3300025297 | Bacteria | 208790 |
| 144 | Ga0209758_1000254 | 3300025297 | Bacteria | 107330 |
| 145 | Ga0209758_1000592 | 3300025297 | Bacteria | 56476 |
| 146 | Ga0209758_1000678 | 3300025297 | Bacteria | 50806 |
| 147 | Ga0209758_1003028 | 3300025297 | Bacteria | 16025 |
| 148 | Ga0209758_1004877 | 3300025297 | Bacteria | 10795 |
| 149 | Ga0209758_1032268 | 3300025297 | Bacteria | 2130 |
| 150 | Ga0209758_1038456 | 3300025297 | Bacteria | 1835 |
| 151 | Ga0209050_1009447 | 3300025298 | Bacteria | 4989 |
| 152 | Ga0209050_1015458 | 3300025298 | Bacteria | 3203 |
| 153 | Ga0209256_1000211 | 3300025299 | Bacteria | 110131 |
| 154 | Ga0209256_1000283 | 3300025299 | Bacteria | 89387 |
| 155 | Ga0209256_1000669 | 3300025299 | Bacteria | 46351 |
| 156 | Ga0209256_1000885 | 3300025299 | Bacteria | 36961 |
| 157 | Ga0209256_1002050 | 3300025299 | Bacteria | 17868 |
| 158 | Ga0209256_1009263 | 3300025299 | Bacteria | 4349 |
| 159 | Ga0209256_1024647 | 3300025299 | Bacteria | 1767 |
| 160 | Ga0209256_1038223 | 3300025299 | Bacteria | 1245 |
| 161 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 162 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 163 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 164 | Ga0207426_1000208 | 3300025302 | Bacteria | 140385 |
| 165 | Ga0207426_1000936 | 3300025302 | Bacteria | 29086 |
| 166 | Ga0209051_1000176 | 3300025303 | Bacteria | 115875 |
| 167 | Ga0209051_1003032 | 3300025303 | Bacteria | 11372 |
| 168 | Ga0209051_1003066 | 3300025303 | Bacteria | 11293 |
| 169 | Ga0209051_1021245 | 3300025303 | Bacteria | 2770 |
| 170 | Ga0209051_1056082 | 3300025303 | Bacteria | 1274 |
| 171 | Ga0209257_1004862 | 3300025304 | Bacteria | 9928 |
| 172 | Ga0209257_1013370 | 3300025304 | Bacteria | 3660 |
| 173 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 174 | Ga0207671_10000080 | 3300025914 | Bacteria | 148567 |
| 175 | Ga0207650_10000624 | 3300025925 | Bacteria | 28219 |
| 176 | Ga0207644_10015740 | 3300025931 | Bacteria | 5082 |
| 177 | Ga0207640_10319644 | 3300025981 | Bacteria | 1235 |
| 178 | Ga0207702_10043016 | 3300026078 | Bacteria | 3791 |
| 179 | Ga0207702_10045362 | 3300026078 | Bacteria | 3698 |
| 180 | Ga0207698_10343433 | 3300026142 | Bacteria | 1407 |
| 181 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 182 | Ga0209281_1001180 | 3300027111 | Bacteria | 18042 |
| 183 | Ga0209371_1002582 | 3300027312 | Bacteria | 9967 |
| 184 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 185 | Ga0268266_10097108 | 3300028379 | Bacteria | 2591 |
| 186 | Ga0268266_10154083 | 3300028379 | Bacteria | 2074 |
| 187 | Ga0268266_10265403 | 3300028379 | Bacteria | 1592 |
| 188 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 189 | Ga0307515_10005257 | 3300028794 | Bacteria | 26313 |
| 190 | Ga0307515_10006504 | 3300028794 | Bacteria | 23375 |
| 191 | Ga0268256_1003727 | 3300030500 | Bacteria | 6704 |
| 192 | Ga0307513_10002736 | 3300031456 | Bacteria | 24255 |
| 193 | Ga0307513_10004524 | 3300031456 | Bacteria | 18536 |
| 194 | Ga0307408_100191993 | 3300031548 | Bacteria | 1646 |
| 195 | Ga0307405_10001465 | 3300031731 | Bacteria | 9949 |
| 196 | Ga0307410_10148222 | 3300031852 | Bacteria | 1744 |
| 197 | Ga0307412_10001457 | 3300031911 | Bacteria | 13166 |
| 198 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 199 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 200 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 201 | Ga0395898_0076038 | 3300037466 | Bacteria | 3243 |
| 202 | Ga0395901_0165628 | 3300038443 | Bacteria | 2321 |
| 203 | Ga0439436_0002190 | 3300041404 | Bacteria | 5843 |
| 204 | Ga0439466_0063380 | 3300041411 | Bacteria | 1186 |
| 205 | Ga0439465_0005328 | 3300041413 | Bacteria | 4109 |
| 206 | Ga0439465_0005625 | 3300041413 | Bacteria | 3992 |
| 207 | Ga0439465_0006019 | 3300041413 | Bacteria | 3856 |
| 208 | Ga0439465_0063530 | 3300041413 | Bacteria | 1227 |
| 209 | Ga0439465_0066573 | 3300041413 | Bacteria | 1201 |
| 210 | Ga0451807_0935891 | 3300041486 | Bacteria | 983 |
| 211 | Ga0451839_0542176 | 3300041496 | Bacteria | 3127 |
| 212 | Ga0451841_0577157 | 3300041498 | Bacteria | 3073 |
| 213 | Ga0451845_0517278 | 3300041501 | Bacteria | 1796 |
| 214 | Ga0451845_0608757 | 3300041501 | Bacteria | 1321 |
| 215 | Ga0451851_0417130 | 3300041507 | Bacteria | 3124 |
| 216 | Ga0451855_0274722 | 3300041511 | Bacteria | 803 |
| 217 | Ga0451853_3019187 | 3300041512 | Bacteria | 1536 |
| 218 | Ga0439431_0004203 | 3300041997 | Bacteria | 3158 |
| 219 | Ga0439449_0009721 | 3300042007 | Bacteria | 3639 |
| 220 | Ga0439449_0011947 | 3300042007 | Bacteria | 3264 |
| 221 | Ga0439462_0002411 | 3300042015 | Bacteria | 4341 |
| 222 | Ga0450910_003987 | 3300042147 | Bacteria | 1982 |
| 223 | Ga0439434_0004579 | 3300042435 | Bacteria | 4047 |
| 224 | Ga0450918_007282 | 3300042531 | Bacteria | 1961 |
| 225 | Ga0466966_0108748 | 3300044684 | Bacteria | 1710 |
| 226 | Ga0466963_0051153 | 3300044694 | Bacteria | 2737 |
| 227 | Ga0466971_0067186 | 3300044719 | Bacteria | 1625 |
| 228 | Ga0466970_0008960 | 3300044765 | Bacteria | 5046 |
| 229 | Ga0466957_0121407 | 3300044842 | Bacteria | 1666 |
| 230 | Ga0466958_0039723 | 3300045836 | Bacteria | 2827 |
| 231 | Ga0495617_040351 | 3300046452 | Bacteria | 1561 |
| 232 | Ga0495592_0231349 | 3300046454 | Bacteria | 1230 |
| 233 | Ga0495629_0183097 | 3300046459 | Bacteria | 1451 |
| 234 | Ga0495638_0000746 | 3300046460 | Bacteria | 34841 |
| 235 | Ga0495650_0056795 | 3300046471 | Bacteria | 1587 |
| 236 | Ga0495605_0001667 | 3300046474 | Bacteria | 14285 |
| 237 | Ga0495585_0059643 | 3300046492 | Bacteria | 2102 |
| 238 | Ga0495607_0029078 | 3300046501 | Bacteria | 3404 |
| 239 | Ga0495607_0030837 | 3300046501 | Bacteria | 3287 |
| 240 | Ga0495583_0014903 | 3300046506 | Bacteria | 4256 |
| 241 | Ga0495606_0001297 | 3300046507 | Bacteria | 34485 |
| 242 | Ga0495606_0037171 | 3300046507 | Bacteria | 3308 |
| 243 | Ga0495610_0002186 | 3300046512 | Bacteria | 16597 |
| 244 | Ga0495616_0009440 | 3300046513 | Bacteria | 5706 |
| 245 | Ga0495618_0069806 | 3300046514 | Bacteria | 2234 |
| 246 | Ga0495620_0022072 | 3300046515 | Bacteria | 3075 |
| 247 | Ga0495620_0027186 | 3300046515 | Bacteria | 2680 |
| 248 | Ga0495631_0000518 | 3300046518 | Bacteria | 25896 |
| 249 | Ga0495632_0001449 | 3300046519 | Bacteria | 19723 |
| 250 | Ga0495632_0006976 | 3300046519 | Bacteria | 7171 |
| 251 | Ga0495632_0016788 | 3300046519 | Bacteria | 4060 |
| 252 | Ga0495643_0005454 | 3300046522 | Bacteria | 8602 |
| 253 | Ga0495643_0009985 | 3300046522 | Bacteria | 5862 |
| 254 | Ga0495643_0058031 | 3300046522 | Bacteria | 2061 |
| 255 | Ga0495648_0031474 | 3300046524 | Bacteria | 3492 |
| 256 | Ga0495648_0153543 | 3300046524 | Bacteria | 1198 |
| 257 | Ga0495652_0152990 | 3300046529 | Bacteria | 1800 |
| 258 | Ga0495654_0086295 | 3300046530 | Bacteria | 1463 |
| 259 | Ga0495587_0179067 | 3300046536 | Bacteria | 1203 |
| 260 | Ga0495609_0009963 | 3300046538 | Bacteria | 4577 |
| 261 | Ga0495609_0040304 | 3300046538 | Bacteria | 2102 |
| 262 | Ga0495597_0056838 | 3300046542 | Bacteria | 1713 |
| 263 | Ga0495622_0034388 | 3300046557 | Bacteria | 2364 |
| 264 | Ga0495633_0023315 | 3300046558 | Bacteria | 3067 |
| 265 | Ga0495633_0052680 | 3300046558 | Bacteria | 1916 |
| 266 | Ga0495656_0014559 | 3300046615 | Bacteria | 2951 |
| 267 | Ga0495656_0043844 | 3300046615 | Bacteria | 1880 |
| 268 | Ga0495668_0004830 | 3300046616 | Bacteria | 9377 |
| 269 | Ga0495611_0005153 | 3300046648 | Bacteria | 5603 |
| 270 | Ga0495611_0019043 | 3300046648 | Bacteria | 2948 |
| 271 | Ga0495625_0004688 | 3300046660 | Bacteria | 12835 |
| 272 | Ga0495625_0036128 | 3300046660 | Bacteria | 3634 |
| 273 | Ga0495625_0046542 | 3300046660 | Bacteria | 3130 |
| 274 | Ga0495625_0051062 | 3300046660 | Bacteria | 2966 |
| 275 | Ga0495625_0140658 | 3300046660 | Bacteria | 1628 |
| 276 | Ga0495661_0076663 | 3300046665 | Bacteria | 1939 |
| 277 | Ga0495588_0070613 | 3300046674 | Bacteria | 1815 |
| 278 | Ga0495624_0079396 | 3300046690 | Bacteria | 2035 |
| 279 | Ga0495670_0010277 | 3300046691 | Bacteria | 4599 |
| 280 | Ga0495670_0127276 | 3300046691 | Bacteria | 1326 |
| 281 | Ga0495671_0027098 | 3300046692 | Bacteria | 2962 |
| 282 | Ga0495660_0048243 | 3300046810 | Bacteria | 2329 |
| 283 | Ga0495660_0049810 | 3300046810 | Bacteria | 2284 |
| 284 | Ga0495604_0037338 | 3300047317 | Bacteria | 3826 |
| 285 | Ga0495636_0031727 | 3300047318 | Bacteria | 2167 |
| 286 | Ga0495687_029489 | 3300047443 | Bacteria | 2538 |
| 287 | Ga0495687_074926 | 3300047443 | Bacteria | 1344 |
| 288 | Ga0495677_0152053 | 3300047445 | Bacteria | 891 |
| 289 | Ga0495673_0146266 | 3300047469 | Bacteria | 917 |
| 290 | Ga0495681_0035511 | 3300047470 | Bacteria | 2474 |
| 291 | Ga0495681_0065139 | 3300047470 | Bacteria | 1667 |
| 292 | Ga0495681_0094327 | 3300047470 | Bacteria | 1317 |
| 293 | Ga0495686_0000418 | 3300047472 | Bacteria | 67274 |
| 294 | Ga0495686_0002364 | 3300047472 | Bacteria | 17981 |
| 295 | Ga0495686_0010867 | 3300047472 | Bacteria | 6447 |
| 296 | Ga0495686_0057962 | 3300047472 | Bacteria | 2416 |
| 297 | Ga0495686_0103574 | 3300047472 | Bacteria | 1714 |
| 298 | Ga0496100_0003974 | 3300048903 | Bacteria | 7772 |
| 299 | Ga0496101_0044657 | 3300048904 | Bacteria | 3171 |
| 300 | Ga0496101_0257032 | 3300048904 | Bacteria | 1362 |
| 301 | Ga0496102_0008867 | 3300048905 | Bacteria | 8630 |
| 302 | Ga0496103_0010981 | 3300048906 | Bacteria | 5360 |
| 303 | Ga0496103_0072928 | 3300048906 | Bacteria | 2151 |
| 304 | Ga0496104_0340241 | 3300048907 | Bacteria | 1413 |
| 305 | Ga0496105_0122365 | 3300048908 | Bacteria | 2145 |
| 306 | Ga0496106_0052791 | 3300048909 | Bacteria | 3068 |
| 307 | Ga0496106_0055929 | 3300048909 | Bacteria | 2983 |
| 308 | Ga0496113_0454510 | 3300048916 | Bacteria | 1029 |
| 309 | Ga0496114_0086478 | 3300048917 | Bacteria | 2657 |
| 310 | Ga0496116_0012735 | 3300048919 | Bacteria | 6841 |
| 311 | Ga0496116_0012821 | 3300048919 | Bacteria | 6811 |
| 312 | Ga0496116_0032068 | 3300048919 | Bacteria | 3750 |
| 313 | Ga0496116_0180844 | 3300048919 | Bacteria | 1129 |
| 314 | Ga0496116_0216259 | 3300048919 | Bacteria | 987 |
| 315 | Ga0496117_0003887 | 3300048920 | Bacteria | 16943 |
| 316 | Ga0496117_0005580 | 3300048920 | Bacteria | 13167 |
| 317 | Ga0496117_0010882 | 3300048920 | Bacteria | 8206 |
| 318 | Ga0496117_0073253 | 3300048920 | Bacteria | 2286 |
| 319 | Ga0496117_0095863 | 3300048920 | Bacteria | 1894 |
| 320 | Ga0496117_0109230 | 3300048920 | Bacteria | 1727 |
| 321 | Ga0496118_0003614 | 3300048921 | Bacteria | 19207 |
| 322 | Ga0496118_0004868 | 3300048921 | Bacteria | 15633 |
| 323 | Ga0496118_0013710 | 3300048921 | Bacteria | 7647 |
| 324 | Ga0496118_0036618 | 3300048921 | Bacteria | 3963 |
| 325 | Ga0496118_0046256 | 3300048921 | Bacteria | 3388 |
| 326 | Ga0496119_0046552 | 3300048922 | Bacteria | 2708 |
| 327 | Ga0496119_0053932 | 3300048922 | Bacteria | 2451 |
| 328 | Ga0496119_0104505 | 3300048922 | Bacteria | 1584 |
| 329 | Ga0496120_0061450 | 3300048923 | Bacteria | 2096 |
| 330 | Ga0496121_0005802 | 3300048924 | Bacteria | 15658 |
| 331 | Ga0496121_0019161 | 3300048924 | Bacteria | 6857 |
| 332 | Ga0496121_0057768 | 3300048924 | Bacteria | 3213 |
| 333 | Ga0496121_0086372 | 3300048924 | Bacteria | 2465 |
| 334 | Ga0496121_0293245 | 3300048924 | Bacteria | 1107 |
| 335 | Ga0496121_0386265 | 3300048924 | Bacteria | 921 |
| 336 | Ga0496122_0002474 | 3300048925 | Bacteria | 26122 |
| 337 | Ga0496122_0004381 | 3300048925 | Bacteria | 17581 |
| 338 | Ga0496122_0028667 | 3300048925 | Bacteria | 4716 |
| 339 | Ga0496122_0034028 | 3300048925 | Bacteria | 4178 |
| 340 | Ga0496122_0036119 | 3300048925 | Bacteria | 4004 |
| 341 | Ga0496122_0088694 | 3300048925 | Bacteria | 2118 |
| 342 | Ga0496122_0101019 | 3300048925 | Bacteria | 1928 |
| 343 | Ga0496122_0113907 | 3300048925 | Bacteria | 1765 |
| 344 | Ga0496123_0000839 | 3300048926 | Bacteria | 49128 |
| 345 | Ga0496123_0007514 | 3300048926 | Bacteria | 10229 |
| 346 | Ga0496123_0034193 | 3300048926 | Bacteria | 3645 |
| 347 | Ga0496123_0040913 | 3300048926 | Bacteria | 3220 |
| 348 | Ga0496123_0117119 | 3300048926 | Bacteria | 1507 |
| 349 | Ga0496123_0124912 | 3300048926 | Bacteria | 1438 |
| 350 | Ga0496123_0215421 | 3300048926 | Bacteria | 972 |
| 351 | Ga0496124_0001743 | 3300048927 | Bacteria | 30475 |
| 352 | Ga0496124_0005611 | 3300048927 | Bacteria | 14038 |
| 353 | Ga0496124_0005719 | 3300048927 | Bacteria | 13853 |
| 354 | Ga0496124_0010468 | 3300048927 | Bacteria | 9389 |
| 355 | Ga0496124_0037267 | 3300048927 | Bacteria | 4231 |
| 356 | Ga0496124_0082710 | 3300048927 | Bacteria | 2635 |
| 357 | Ga0496124_0101101 | 3300048927 | Bacteria | 2336 |
| 358 | Ga0496124_0135947 | 3300048927 | Bacteria | 1946 |
| 359 | Ga0496124_0150465 | 3300048927 | Bacteria | 1826 |
| 360 | Ga0496124_0411325 | 3300048927 | Bacteria | 935 |
| 361 | Ga0496125_0002475 | 3300048928 | Bacteria | 23966 |
| 362 | Ga0496125_0004711 | 3300048928 | Bacteria | 15545 |
| 363 | Ga0496125_0011734 | 3300048928 | Bacteria | 8733 |
| 364 | Ga0496125_0080363 | 3300048928 | Bacteria | 2495 |
| 365 | Ga0496125_0131158 | 3300048928 | Bacteria | 1764 |
| 366 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 367 | Ga0496126_0008731 | 3300048929 | Bacteria | 10883 |
| 368 | Ga0496126_0066328 | 3300048929 | Bacteria | 3227 |
| 369 | Ga0496126_0260269 | 3300048929 | Bacteria | 1443 |
| 370 | Ga0501031_0000202 | 3300049568 | Bacteria | 33947 |
| 371 | Ga0501032_0000443 | 3300049569 | Bacteria | 33947 |
| 372 | Ga0501032_0105637 | 3300049569 | Bacteria | 1865 |
| 373 | Ga0501032_0275438 | 3300049569 | Bacteria | 1090 |
| 374 | Ga0501033_0000097 | 3300049570 | Bacteria | 83228 |
| 375 | Ga0501033_0010825 | 3300049570 | Bacteria | 6995 |
| 376 | Ga0501034_0000186 | 3300049571 | Bacteria | 116500 |
| 377 | Ga0501034_0011544 | 3300049571 | Bacteria | 9150 |
| 378 | Ga0501034_0041553 | 3300049571 | Bacteria | 4653 |
| 379 | Ga0501034_0135186 | 3300049571 | Bacteria | 2446 |
| 380 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 381 | Ga0501036_0146379 | 3300049572 | Bacteria | 1993 |
| 382 | Ga0501036_0249412 | 3300049572 | Bacteria | 1488 |
| 383 | Ga0501036_0345260 | 3300049572 | Bacteria | 1243 |
| 384 | Ga0501037_0000443 | 3300049573 | Bacteria | 33927 |
| 385 | Ga0501038_0000867 | 3300049574 | Bacteria | 26767 |
| 386 | Ga0501038_0036305 | 3300049574 | Bacteria | 4326 |
| 387 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 388 | Ga0501039_0069810 | 3300049575 | Bacteria | 2729 |
| 389 | Ga0501040_0001925 | 3300049576 | Bacteria | 13348 |
| 390 | Ga0501040_0014483 | 3300049576 | Bacteria | 5197 |
| 391 | Ga0501043_0000543 | 3300049579 | Bacteria | 33914 |
| 392 | Ga0501043_0037844 | 3300049579 | Bacteria | 3795 |
| 393 | Ga0501043_0078405 | 3300049579 | Bacteria | 2595 |
| 394 | Ga0501043_0143718 | 3300049579 | Bacteria | 1868 |
| 395 | Ga0501047_0002364 | 3300049581 | Bacteria | 18037 |
| 396 | Ga0501047_0157248 | 3300049581 | Bacteria | 2146 |
| 397 | Ga0501047_0168987 | 3300049581 | Bacteria | 2056 |
| 398 | Ga0501047_0172428 | 3300049581 | Bacteria | 2032 |
| 399 | Ga0501067_0146215 | 3300049583 | Bacteria | 1317 |
| 400 | Ga0501068_0169680 | 3300049584 | Bacteria | 1377 |
| 401 | Ga0501070_0009430 | 3300049586 | Bacteria | 8251 |
| 402 | Ga0501070_0169394 | 3300049586 | Bacteria | 1799 |
| 403 | Ga0501070_0269910 | 3300049586 | Bacteria | 1389 |
| 404 | Ga0501073_0271248 | 3300049589 | Bacteria | 1171 |
| 405 | Ga0501080_0069209 | 3300049742 | Bacteria | 3282 |
| 406 | Ga0501083_0099443 | 3300049744 | Bacteria | 1918 |
| 407 | Ga0501083_0199315 | 3300049744 | Bacteria | 1306 |
| 408 | Ga0501035_0000100 | 3300049822 | Bacteria | 107321 |
| 409 | Ga0501035_0038128 | 3300049822 | Bacteria | 4352 |
| 410 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 411 | Ga0501044_0036127 | 3300049823 | Bacteria | 5169 |
| 412 | Ga0501044_0101205 | 3300049823 | Bacteria | 2899 |
| 413 | Ga0501044_0150409 | 3300049823 | Bacteria | 2311 |
| 414 | Ga0501045_0334474 | 3300049824 | Bacteria | 1127 |
| 415 | nmdc:mga0yw44_19685_c1 | 3300050492 | Bacteria | 3727 |
| 416 | Ga0500578_0093222 | 3300053086 | Bacteria | 1910 |
| 417 | Ga0500643_026321 | 3300053087 | Bacteria | 1823 |
| 418 | Ga0500646_0007652 | 3300053090 | Bacteria | 2761 |
| 419 | Ga0500651_0243042 | 3300053093 | Bacteria | 1049 |
| 420 | Ga0500650_0028901 | 3300053098 | Bacteria | 2507 |
| 421 | Ga0500556_0023251 | 3300053104 | Bacteria | 2023 |
| 422 | Ga0500557_000282 | 3300053105 | Bacteria | 6913 |
| 423 | Ga0500560_070174 | 3300053107 | Bacteria | 1154 |
| 424 | Ga0500562_002778 | 3300053108 | Bacteria | 4356 |
| 425 | Ga0500569_016074 | 3300053109 | Bacteria | 1888 |
| 426 | Ga0500594_0000635 | 3300053118 | Bacteria | 7500 |
| 427 | Ga0500618_006727 | 3300053125 | Bacteria | 3347 |
| 428 | Ga0500618_006924 | 3300053125 | Bacteria | 3280 |
| 429 | Ga0500658_0000880 | 3300053134 | Bacteria | 12318 |
| 430 | Ga0500658_0005307 | 3300053134 | Bacteria | 4790 |
| 431 | Ga0500568_0000629 | 3300053139 | Bacteria | 25351 |
| 432 | Ga0500568_0002233 | 3300053139 | Bacteria | 11604 |
| 433 | Ga0500590_000127 | 3300053148 | Bacteria | 21175 |
| 434 | Ga0500604_0017296 | 3300053151 | Bacteria | 1994 |
| 435 | Ga0500616_0005719 | 3300053153 | Bacteria | 8370 |
| 436 | Ga0500616_0110610 | 3300053153 | Bacteria | 1327 |
| 437 | Ga0500620_000852 | 3300053155 | Bacteria | 5300 |
| 438 | Ga0500622_0001672 | 3300053156 | Bacteria | 17312 |
| 439 | Ga0500627_0032004 | 3300053158 | Bacteria | 2214 |
| 440 | Ga0500633_0016986 | 3300053160 | Bacteria | 2125 |
| 441 | Ga0500633_0051404 | 3300053160 | Bacteria | 1423 |
| 442 | Ga0500636_0097124 | 3300053177 | Bacteria | 1680 |
| 443 | Ga0500645_015656 | 3300053730 | Bacteria | 2400 |
| 444 | Ga0501082_0056138 | 3300060353 | Bacteria | 3392 |
| 445 | 2501078086 | 2501025502 | Bacteria | 9641094 |
| 446 | 2509108047 | 2508501122 | Bacteria | 6292184 |
| 447 | 2509376774 | 2509276019 | Bacteria | 6802256 |
| 448 | 2509390175 | 2509276021 | Bacteria | 7634384 |
| 449 | 2509447535 | 2509276033 | Bacteria | 7180565 |
| 450 | 2510134359 | 2510065019 | Bacteria | 6903379 |
| 451 | 2510308320 | 2510065057 | Bacteria | 6649661 |
| 452 | 2510895792 | 2510461076 | Bacteria | 8618824 |
| 453 | 2511091957 | 2510917013 | Bacteria | 9951648 |
| 454 | 2511131929 | 2510917022 | Bacteria | 6504556 |
| 455 | 2511182654 | 2510917028 | Bacteria | 6185411 |
| 456 | 2511194915 | 2510917030 | Bacteria | 7460662 |
| 457 | 2511391278 | 2511231027 | Bacteria | 5013807 |
| 458 | 2511502503 | 2511231052 | Bacteria | 6974333 |
| 459 | 2512533878 | 2512047086 | Bacteria | 6850303 |
| 460 | 2512970367 | 2512875026 | Bacteria | 6861065 |
| 461 | 2513567521 | 2513237084 | Bacteria | 7231967 |
| 462 | 2513577857 | 2513237085 | Bacteria | 7695351 |
| 463 | 2513587465 | 2513237086 | Bacteria | 7265287 |
| 464 | 2513598404 | 2513237088 | Bacteria | 6927906 |
| 465 | 2513601431 | 2513237089 | Bacteria | 6553624 |
| 466 | 2513619558 | 2513237091 | Bacteria | 6900273 |
| 467 | 2513631996 | 2513237093 | Bacteria | 7545552 |
| 468 | 2513712530 | 2513237103 | Bacteria | 7647401 |
| 469 | 2513867916 | 2513237138 | Bacteria | 7368160 |
| 470 | 2513881809 | 2513237140 | Bacteria | 7076289 |
| 471 | 2513904953 | 2513237143 | Bacteria | 6664116 |
| 472 | 2513910648 | 2513237144 | Bacteria | 7530820 |
| 473 | 2513928093 | 2513237146 | Bacteria | 7166346 |
| 474 | 2513983629 | 2513237156 | Bacteria | 6402557 |
| 475 | 2513997574 | 2513237159 | Bacteria | 6810126 |
| 476 | 2514003122 | 2513237160 | Bacteria | 6650282 |
| 477 | 2514420214 | 2513237305 | Bacteria | 7293571 |
| 478 | 2514588972 | 2513237351 | Bacteria | 6968952 |
| 479 | 2515113530 | 2515075009 | Bacteria | 7288508 |
| 480 | 2515609292 | 2515154107 | Bacteria | 6795637 |
| 481 | 2515635243 | 2515154113 | Bacteria | 7807172 |
| 482 | 2515643850 | 2515154114 | Bacteria | 7848616 |
| 483 | 2515654938 | 2515154116 | Bacteria | 7552979 |
| 484 | 2515739884 | 2515154134 | Bacteria | 7220242 |
| 485 | 2516893878 | 2516653046 | Bacteria | 6989037 |
| 486 | 2517037142 | 2516653077 | Bacteria | 7555578 |
| 487 | 2517077483 | 2516653085 | Bacteria | 7346596 |
| 488 | 2517096249 | 2517093000 | Bacteria | 7412387 |
| 489 | 2517408107 | 2517287029 | Bacteria | 6905599 |
| 490 | 2517570595 | 2517487022 | Bacteria | 7227575 |
| 491 | 2520381948 | 2519899620 | Bacteria | 6499161 |
| 492 | 2524448298 | 2524023207 | Bacteria | 6813453 |
| 493 | 2524459012 | 2524023209 | Bacteria | 6679728 |
| 494 | 2530646387 | 2529292951 | Bacteria | 6916614 |
| 495 | 2535517230 | 2534681796 | Bacteria | 7146037 |
| 496 | 2551679615 | 2551306084 | Bacteria | 8942552 |
| 497 | 2551689446 | 2551306085 | Bacteria | 7347181 |
| 498 | 2551704732 | 2551306087 | Bacteria | 7351905 |
| 499 | 2551710591 | 2551306089 | Bacteria | 7162724 |
| 500 | 2551723158 | 2551306090 | Bacteria | 7953713 |
| 501 | 2551735560 | 2551306092 | Bacteria | 6992595 |
| 502 | 2551740098 | 2551306093 | Bacteria | 7064773 |
| 503 | 2558865869 | 2558860100 | Bacteria | 8458965 |
| 504 | 2585167553 | 2582581283 | Bacteria | 6030556 |
| 505 | 2585205102 | 2582581294 | Bacteria | 6626667 |
| 506 | 2585225255 | 2582581298 | Bacteria | 7315509 |
| 507 | 2585230680 | 2582581299 | Bacteria | 6518058 |
| 508 | 2585259115 | 2582581304 | Bacteria | 5831370 |
| 509 | 2585265780 | 2582581306 | Bacteria | 6450535 |
| 510 | 2585273969 | 2582581307 | Bacteria | 6597605 |
| 511 | 2585279430 | 2582581308 | Bacteria | 7413247 |
| 512 | 2585322910 | 2582581315 | Bacteria | 7318924 |
| 513 | 2585331078 | 2582581316 | Bacteria | 7774528 |
| 514 | 2585389027 | 2582581865 | Bacteria | 6644329 |
| 515 | 2585395173 | 2582581866 | Bacteria | 6859583 |
| 516 | 2585404602 | 2582581867 | Bacteria | 7184437 |
| 517 | 2585524910 | 2585427526 | Bacteria | 7258840 |
| 518 | 2585531086 | 2585427527 | Bacteria | 7273426 |
| 519 | 2585542783 | 2585427528 | Bacteria | 6842387 |
| 520 | 2585547811 | 2585427529 | Bacteria | 7395659 |
| 521 | 2585552993 | 2585427530 | Bacteria | 7383882 |
| 522 | 2585560420 | 2585427531 | Bacteria | 6992870 |
| 523 | 2585824861 | 2585427590 | Bacteria | 6824633 |
| 524 | 2585841425 | 2585427593 | Bacteria | 7141551 |
| 525 | 2585847703 | 2585427594 | Bacteria | 6180594 |
| 526 | 2585898614 | 2585427608 | Bacteria | 6544331 |
| 527 | 2585903798 | 2585427609 | Bacteria | 6667127 |
| 528 | 2587981083 | 2585428125 | Bacteria | 6662905 |
| 529 | 2597814374 | 2597489875 | Bacteria | 7010078 |
| 530 | 2599421102 | 2599185170 | Bacteria | 7295545 |
| 531 | 2600196076 | 2599185352 | Bacteria | 7228948 |
| 532 | 2616296660 | 2615840624 | Bacteria | 6557588 |
| 533 | 2616307003 | 2615840626 | Bacteria | 7921970 |
| 534 | 2616554616 | 2615840698 | Bacteria | 7319877 |
| 535 | 2617384883 | 2617270742 | Bacteria | 6808054 |
| 536 | 2643804384 | 2643221557 | Bacteria | 7184309 |
| 537 | 2644002914 | 2643221599 | Bacteria | 6292121 |
| 538 | 2644050103 | 2643221607 | Bacteria | 6314006 |
| 539 | 2644065155 | 2643221610 | Bacteria | 7480339 |
| 540 | 2644105446 | 2643221618 | Bacteria | 7717186 |
| 541 | 2644129083 | 2643221623 | Bacteria | 5239945 |
| 542 | 2644146449 | 2643221626 | Bacteria | 8069654 |
| 543 | 2644168758 | 2643221629 | Bacteria | 5850260 |
| 544 | 2644204837 | 2643221636 | Bacteria | 6583769 |
| 545 | 2644208696 | 2643221637 | Bacteria | 5345260 |
| 546 | 2644237894 | 2643221643 | Bacteria | 5749658 |
| 547 | 2644308197 | 2643221655 | Bacteria | 7722067 |
| 548 | 2644334021 | 2643221659 | Bacteria | 7890716 |
| 549 | 2644347307 | 2643221662 | Bacteria | 5851492 |
| 550 | 2644377564 | 2643221668 | Bacteria | 7306521 |
| 551 | 2644416827 | 2643221675 | Bacteria | 7473456 |
| 552 | 2644449867 | 2643221680 | Bacteria | 7473610 |
| 553 | 2644483024 | 2643221686 | Bacteria | 6310811 |
| 554 | 2644497692 | 2643221689 | Bacteria | 6042950 |
| 555 | 2644541618 | 2643221698 | Bacteria | 7756764 |
| 556 | 2644615479 | 2643221712 | Bacteria | 7729434 |
| 557 | 2644652226 | 2643221718 | Bacteria | 5345506 |
| 558 | 2644672780 | 2643221723 | Bacteria | 7095460 |
| 559 | 2644690001 | 2643221726 | Bacteria | 7455827 |
| 560 | 2644743308 | 2643221736 | Bacteria | 6608466 |
| 561 | 2671111861 | 2667528174 | Bacteria | 6435400 |
| 562 | 2719386834 | 2718217927 | Bacteria | 6972593 |
| 563 | 2719666574 | 2718217997 | Bacteria | 6740740 |
| 564 | 2720492994 | 2718218199 | Bacteria | 6740745 |
| 565 | 2720614470 | 2718218232 | Bacteria | 6720332 |
| 566 | 2720621246 | 2718218233 | Bacteria | 6662049 |
| 567 | 2720632572 | 2718218235 | Bacteria | 6630699 |
| 568 | 2720776294 | 2718218269 | Bacteria | 6906114 |
| 569 | 2721400557 | 2718218423 | Bacteria | 6438183 |
| 570 | 2723027886 | 2721755556 | Bacteria | 6745503 |
| 571 | 2723561514 | 2721755684 | Bacteria | 6859907 |
| 572 | 2723568144 | 2721755685 | Bacteria | 6704835 |
| 573 | 2723575730 | 2721755686 | Bacteria | 7343952 |
| 574 | 2724039370 | 2721755809 | Bacteria | 6438790 |
| 575 | 2724090901 | 2721755819 | Bacteria | 6906405 |
| 576 | 2724105409 | 2721755822 | Bacteria | 6726041 |
| 577 | 2724111232 | 2721755823 | Bacteria | 6752556 |
| 578 | 2725950239 | 2724679232 | Bacteria | 7646494 |
| 579 | 2730108822 | 2728369352 | Bacteria | 6745171 |
| 580 | 2738805420 | 2738541293 | Bacteria | 7065685 |
| 581 | 2739033235 | 2738541333 | Bacteria | 7106503 |
| 582 | 2765467210 | 2765235802 | Bacteria | 5618596 |
| 583 | 2766066279 | 2765235942 | Bacteria | 7445910 |
| 584 | 2770198806 | 2767802442 | Bacteria | 5747986 |
| 585 | 2776273014 | 2775506902 | Bacteria | 6208009 |
| 586 | 2776282143 | 2775506904 | Bacteria | 5954060 |
| 587 | 2778173383 | 2775507266 | Bacteria | 7392367 |
| 588 | 2792638784 | 2791355094 | Bacteria | 7011481 |
| 589 | 2793294020 | 2791355256 | Bacteria | 6798008 |
| 590 | 2793314305 | 2791355259 | Bacteria | 7254731 |
| 591 | 2793323790 | 2791355260 | Bacteria | 6598818 |
| 592 | 2793329696 | 2791355261 | Bacteria | 6661293 |
| 593 | 2793342297 | 2791355263 | Bacteria | 6872478 |
| 594 | 2793355317 | 2791355265 | Bacteria | 6539969 |
| 595 | 2793362967 | 2791355266 | Bacteria | 7116587 |
| 596 | 2793369879 | 2791355267 | Bacteria | 7222458 |
| 597 | 2802716724 | 2802428858 | Bacteria | 6636079 |
| 598 | 2802725535 | 2802428859 | Bacteria | 6667919 |
| 599 | 2802730373 | 2802428860 | Bacteria | 6525526 |
| 600 | 2802737656 | 2802428861 | Bacteria | 6534206 |
| 601 | 2802742955 | 2802428862 | Bacteria | 6633353 |
| 602 | 2802750379 | 2802428863 | Bacteria | 6410669 |
| 603 | 2805929534 | 2802429605 | Bacteria | 6875453 |
| 604 | 2805936838 | 2802429606 | Bacteria | 6346811 |
| 605 | 2806047523 | 2802429633 | Bacteria | 7341974 |
| 606 | 2806055127 | 2802429634 | Bacteria | 7083200 |
| 607 | 2806063063 | 2802429635 | Bacteria | 7650140 |
| 608 | 2806069798 | 2802429636 | Bacteria | 7597525 |
| 609 | 2806075727 | 2802429637 | Bacteria | 7067217 |
| 610 | 2819609927 | 2818991448 | Bacteria | 6772224 |
| 611 | 2819640037 | 2818991453 | Bacteria | 7181617 |
| 612 | 2838019937 | 2838016132 | Bacteria | 6577831 |
| 613 | 2838033238 | 2838029111 | Bacteria | 6603031 |
| 614 | 2838041465 | 2838035591 | Bacteria | 7166484 |
| 615 | 2838045609 | 2838042994 | Bacteria | 6046894 |
| 616 | 2838052747 | 2838048938 | Bacteria | 6044578 |
| 617 | 2838065004 | 2838061910 | Bacteria | 6794874 |
| 618 | 2838069729 | 2838068647 | Bacteria | 6208656 |
| 619 | 2838079678 | 2838074704 | Bacteria | 6785777 |
| 620 | 2838665857 | 2838661181 | Bacteria | 7385261 |
| 621 | 2838671765 | 2838668709 | Bacteria | 6671819 |
| 622 | 2838686639 | 2838686498 | Bacteria | 7807632 |
| 623 | 2838698026 | 2838694306 | Bacteria | 6853137 |
| 624 | 2838704444 | 2838701080 | Bacteria | 6669771 |
| 625 | 2838711141 | 2838707686 | Bacteria | 6619912 |
| 626 | 2838734881 | 2838729681 | Bacteria | 7400765 |
| 627 | 2838747496 | 2838742623 | Bacteria | 7396178 |
| 628 | 2839996428 | 2839993093 | Bacteria | 5512535 |
| 629 | 2840770364 | 2840764183 | Bacteria | 6358399 |
| 630 | 2841854468 | 2841851746 | Bacteria | 7532261 |
| 631 | 2841867387 | 2841864319 | Bacteria | 6742987 |
| 632 | 2842079316 | 2842077413 | Bacteria | 6508645 |
| 633 | 2842115578 | 2842110456 | Bacteria | 7656360 |
| 634 | 2842118173 | 2842118031 | Bacteria | 7033875 |
| 635 | 2842149662 | 2842146304 | Bacteria | 5957337 |
| 636 | 2842158513 | 2842156927 | Bacteria | 6894975 |
| 637 | 2842169043 | 2842163707 | Bacteria | 6916235 |
| 638 | 2842182127 | 2842180545 | Bacteria | 6888678 |
| 639 | 2842195635 | 2842192696 | Bacteria | 6147454 |
| 640 | 2842218360 | 2842217011 | Bacteria | 7497767 |
| 641 | 2842229873 | 2842229732 | Bacteria | 7475766 |
| 642 | 2842240087 | 2842237096 | Bacteria | 6620661 |
| 643 | 2842243762 | 2842243621 | Bacteria | 7421798 |
| 644 | 2842254171 | 2842250916 | Bacteria | 6579627 |
| 645 | 2842258153 | 2842257432 | Bacteria | 7401195 |
| 646 | 2842267656 | 2842264693 | Bacteria | 6472963 |
| 647 | 2842271823 | 2842271015 | Bacteria | 7807131 |
| 648 | 2842284406 | 2842278818 | Bacteria | 6340002 |
| 649 | 2842285192 | 2842285085 | Bacteria | 6011953 |
| 650 | 2842292978 | 2842291075 | Bacteria | 7076806 |
| 651 | 2842298364 | 2842298080 | Bacteria | 6123127 |
| 652 | 2842305434 | 2842304105 | Bacteria | 7023636 |
| 653 | 2842314158 | 2842311132 | Bacteria | 6616990 |
| 654 | 2842319961 | 2842317721 | Bacteria | 6793725 |
| 655 | 2842347643 | 2842341865 | Bacteria | 7003929 |
| 656 | 2842360376 | 2842357229 | Bacteria | 6485165 |
| 657 | 2842368705 | 2842363717 | Bacteria | 6844742 |
| 658 | 2842373660 | 2842370503 | Bacteria | 7038661 |
| 659 | 2842379375 | 2842377471 | Bacteria | 7140707 |
| 660 | 2842384684 | 2842384541 | Bacteria | 7057858 |
| 661 | 2842400587 | 2842395702 | Bacteria | 6780583 |
| 662 | 2842402550 | 2842402390 | Bacteria | 6681310 |
| 663 | 2842410079 | 2842409023 | Bacteria | 6687331 |
| 664 | 2842416727 | 2842415677 | Bacteria | 6596907 |
| 665 | 2842423343 | 2842422224 | Bacteria | 6239196 |
| 666 | 2842430300 | 2842428310 | Bacteria | 6767288 |
| 667 | 2842436888 | 2842434925 | Bacteria | 6502746 |
| 668 | 2842443270 | 2842441272 | Bacteria | 6769273 |
| 669 | 2842449135 | 2842447887 | Bacteria | 6754142 |
| 670 | 2842467172 | 2842462802 | Bacteria | 6588055 |
| 671 | 2842471242 | 2842469257 | Bacteria | 6752936 |
| 672 | 2842480097 | 2842475841 | Bacteria | 6603183 |
| 673 | 2842483709 | 2842482326 | Bacteria | 7212537 |
| 674 | 2842493499 | 2842489311 | Bacteria | 6620893 |
| 675 | 2842497649 | 2842495871 | Bacteria | 6820686 |
| 676 | 2842505118 | 2842502639 | Bacteria | 6604161 |
| 677 | 2842510380 | 2842509118 | Bacteria | 6850950 |
| 678 | 2842522183 | 2842521101 | Bacteria | 6569494 |
| 679 | 2842875729 | 2842871566 | Bacteria | 4827117 |
| 680 | 2844166360 | 2844163670 | Bacteria | 7266046 |
| 681 | 2844457937 | 2844454524 | Bacteria | 7952546 |
| 682 | 2847419761 | 2847417321 | Bacteria | 6913799 |
| 683 | 2848994778 | 2848992105 | Bacteria | 6810864 |
| 684 | 2850081776 | 2850079185 | Bacteria | 6848280 |
| 685 | 2852390795 | 2852387548 | Bacteria | 8025568 |
| 686 | 2855826604 | 2855825444 | Bacteria | 6785811 |
| 687 | 2855841994 | 2855839649 | Bacteria | 7135830 |
| 688 | 2855877277 | 2855872281 | Bacteria | 6964271 |
| 689 | 2857517014 | 2857516855 | Bacteria | 7787325 |
| 690 | 2858802668 | 2858800743 | Bacteria | 6603254 |
| 691 | 2871454819 | 2871451962 | Bacteria | 7336357 |
| 692 | 2882635620 | 2882632389 | Bacteria | 8154593 |
| 693 | 2889792368 | 2889790730 | Bacteria | 5689708 |
| 694 | 2889916997 | 2889914905 | Bacteria | 5702301 |
| 695 | 2891373701 | 2891373044 | Bacteria | 5202277 |
| 696 | 2894657084 | 2894652903 | Bacteria | 4587256 |
| 697 | 2896391211 | 2896384573 | Bacteria | 7700774 |
| 698 | 2904582563 | 2904578770 | Bacteria | 5302906 |
| 699 | 2915981135 | 2915980308 | Bacteria | 6624279 |
| 700 | 2915993233 | 2915986958 | Bacteria | 6739310 |
| 701 | 2915999039 | 2915993759 | Bacteria | 7016183 |
| 702 | 2916005045 | 2916000859 | Bacteria | 6865702 |
| 703 | 2916012711 | 2916007675 | Bacteria | 6898660 |
| 704 | 2916018961 | 2916014648 | Bacteria | 6946486 |
| 705 | 2916023016 | 2916021584 | Bacteria | 6854472 |
| 706 | 2916033855 | 2916028427 | Bacteria | 6748433 |
| 707 | 2916039364 | 2916035215 | Bacteria | 6755766 |
| 708 | 2916044373 | 2916041962 | Bacteria | 6820487 |
| 709 | 2916050421 | 2916048683 | Bacteria | 6543552 |
| 710 | 2916060333 | 2916055098 | Bacteria | 6758838 |
| 711 | 2916063323 | 2916061851 | Bacteria | 6737736 |
| 712 | 2916075751 | 2916068649 | Bacteria | 6943657 |
| 713 | 2916080471 | 2916076590 | Bacteria | 6596108 |
| 714 | 2919105589 | 2919100787 | Bacteria | 7710546 |
| 715 | 2919124043 | 2919119836 | Bacteria | 5208557 |
| 716 | 2919410361 | 2919408235 | Bacteria | 6149349 |
| 717 | 2919679727 | 2919679072 | Bacteria | 4629602 |
| 718 | 2920761186 | 2920760137 | Bacteria | 7427611 |
| 719 | 2920825622 | 2920822456 | Bacteria | 6897201 |
| 720 | 2921205763 | 2921201388 | Bacteria | 6926299 |
| 721 | 2921212556 | 2921208531 | Bacteria | 6745326 |
| 722 | 2921243988 | 2921237296 | Bacteria | 6876710 |
| 723 | 2921244487 | 2921244191 | Bacteria | 6568419 |
| 724 | 2921251644 | 2921250672 | Bacteria | 6677771 |
| 725 | 2921262655 | 2921257292 | Bacteria | 6808382 |
| 726 | 2921269413 | 2921263974 | Bacteria | 6864552 |
| 727 | 2921287130 | 2921282425 | Bacteria | 6826397 |
| 728 | 2921294122 | 2921289301 | Bacteria | 7316391 |
| 729 | 2921299564 | 2921296804 | Bacteria | 7176999 |
| 730 | 2923562262 | 2923556063 | Bacteria | 6793593 |
| 731 | 2924150320 | 2924144063 | Bacteria | 6883928 |
| 732 | 2924156528 | 2924150972 | Bacteria | 7169444 |
| 733 | 2924159883 | 2924158325 | Bacteria | 7188855 |
| 734 | 2924172253 | 2924165586 | Bacteria | 7260590 |
| 735 | 2924178431 | 2924172951 | Bacteria | 6749356 |
| 736 | 2924183502 | 2924179722 | Bacteria | 6843264 |
| 737 | 2924193087 | 2924186466 | Bacteria | 6876637 |
| 738 | 2924196437 | 2924193448 | Bacteria | 6955718 |
| 739 | 2924203887 | 2924200457 | Bacteria | 6757188 |
| 740 | 2924210798 | 2924207177 | Bacteria | 6917007 |
| 741 | 2924218396 | 2924214083 | Bacteria | 7080103 |
| 742 | 2924225632 | 2924221636 | Bacteria | 7113495 |
| 743 | 2924233274 | 2924228884 | Bacteria | 6633132 |
| 744 | 2924766773 | 2924762789 | Bacteria | 6561353 |
| 745 | 2928524837 | 2928521798 | Bacteria | 4960112 |
| 746 | 2933571241 | 2933570622 | Bacteria | 7023390 |
| 747 | 2933591993 | 2933586486 | Bacteria | 7667493 |
| 748 | 2933600536 | 2933599457 | Bacteria | 5858799 |
| 749 | 2935896590 | 2935894831 | Bacteria | 6620579 |
| 750 | 2935901485 | 2935901341 | Bacteria | 7341747 |
| 751 | 2936371628 | 2936367885 | Bacteria | 7324495 |
| 752 | 2936377001 | 2936375103 | Bacteria | 6652732 |
| 753 | 2936383409 | 2936381700 | Bacteria | 7006523 |
| 754 | 2937002755 | 2936996657 | Bacteria | 6298727 |
| 755 | 2937005319 | 2937002841 | Bacteria | 6934057 |
| 756 | 2937012854 | 2937009748 | Bacteria | 6746052 |
| 757 | 2937021880 | 2937016420 | Bacteria | 6782579 |
| 758 | 2937027330 | 2937023124 | Bacteria | 6815156 |
| 759 | 2937035626 | 2937029754 | Bacteria | 6424026 |
| 760 | 2937039659 | 2937036028 | Bacteria | 6846469 |
| 761 | 2937048470 | 2937042894 | Bacteria | 6741576 |
| 762 | 2937055575 | 2937049772 | Bacteria | 6757901 |
| 763 | 2937063786 | 2937056579 | Bacteria | 7107896 |
| 764 | 2937068700 | 2937063883 | Bacteria | 7199456 |
| 765 | 2937075923 | 2937071275 | Bacteria | 6984483 |
| 766 | 2937080688 | 2937078374 | Bacteria | 6610289 |
| 767 | 2937088885 | 2937084907 | Bacteria | 6618516 |
| 768 | 2937097441 | 2937091812 | Bacteria | 6979387 |
| 769 | 2937101156 | 2937098957 | Bacteria | 7249374 |
| 770 | 2937110207 | 2937106411 | Bacteria | 6947143 |
| 771 | 2937117687 | 2937113482 | Bacteria | 6505872 |
| 772 | 2937124520 | 2937119839 | Bacteria | 6597547 |
| 773 | 2937132284 | 2937126314 | Bacteria | 6771275 |
| 774 | 2941504612 | 2941499720 | Bacteria | 7599444 |
| 775 | 2954011203 | 2954011201 | Bacteria | 4762601 |
| 776 | 2957380699 | 2957375807 | Bacteria | 6425588 |
| 777 | 2957387273 | 2957382221 | Bacteria | 6737050 |
| 778 | 2957389513 | 2957388812 | Bacteria | 6778072 |
| 779 | 2957397247 | 2957395598 | Bacteria | 6822399 |
| 780 | 2957408310 | 2957402308 | Bacteria | 6741770 |
| 781 | 2957412934 | 2957408893 | Bacteria | 6558585 |
| 782 | 2957418932 | 2957415311 | Bacteria | 6991633 |
| 783 | 2957426302 | 2957422303 | Bacteria | 7172205 |
| 784 | 2957435828 | 2957430029 | Bacteria | 7022557 |
| 785 | 2957441148 | 2957437181 | Bacteria | 6568994 |
| 786 | 2957450232 | 2957443900 | Bacteria | 6869977 |
| 787 | 2957455769 | 2957450854 | Bacteria | 6765715 |
| 788 | 2957460461 | 2957457609 | Bacteria | 6967680 |
| 789 | 2957468809 | 2957464669 | Bacteria | 6568877 |
| 790 | 2957476639 | 2957471148 | Bacteria | 6797643 |
| 791 | 2957483159 | 2957478035 | Bacteria | 6756658 |
| 792 | 2957489189 | 2957484790 | Bacteria | 6703082 |
| 793 | 2957495143 | 2957491536 | Bacteria | 6695180 |
| 794 | 2957501681 | 2957498199 | Bacteria | 7126688 |
| 795 | 2957512313 | 2957505466 | Bacteria | 7253085 |
| 796 | 2960584875 | 2960584000 | Bacteria | 6864594 |
| 797 | 2960591801 | 2960591022 | Bacteria | 6622873 |
| 798 | 2960602116 | 2960597568 | Bacteria | 6550735 |
| 799 | 2960610261 | 2960603979 | Bacteria | 6898737 |
| 800 | 2960613109 | 2960610863 | Bacteria | 6691244 |
| 801 | 2960617986 | 2960617483 | Bacteria | 6727748 |
| 802 | 2960629770 | 2960624210 | Bacteria | 6875384 |
| 803 | 2960634002 | 2960631154 | Bacteria | 6732508 |
| 804 | 2960638332 | 2960637947 | Bacteria | 7296468 |
| 805 | 2960651103 | 2960645483 | Bacteria | 7211087 |
| 806 | 2960655048 | 2960652885 | Bacteria | 7083688 |
| 807 | 2960667080 | 2960660292 | Bacteria | 7041660 |
| 808 | 2960670716 | 2960667422 | Bacteria | 6763020 |
| 809 | 2960680535 | 2960674078 | Bacteria | 6609048 |
| 810 | 2960680815 | 2960680706 | Bacteria | 6624464 |
| 811 | 2960688193 | 2960687367 | Bacteria | 6535474 |
| 812 | 2960699591 | 2960693952 | Bacteria | 6749742 |
| 813 | 2964618167 | 2964615318 | Bacteria | 6809089 |
| 814 | 2964628044 | 2964621998 | Bacteria | 6834995 |
| 815 | 2964634216 | 2964628898 | Bacteria | 7083044 |
| 816 | 2964639153 | 2964636051 | Bacteria | 7091832 |
| 817 | 2964646239 | 2964643177 | Bacteria | 6820887 |
| 818 | 2964651258 | 2964649959 | Bacteria | 6675118 |
| 819 | 2964656951 | 2964656573 | Bacteria | 7100150 |
| 820 | 2964667675 | 2964663802 | Bacteria | 7019362 |
| 821 | 2964676580 | 2964670856 | Bacteria | 6851364 |
| 822 | 2964682675 | 2964678106 | Bacteria | 6792020 |
| 823 | 2964689230 | 2964685014 | Bacteria | 6839111 |
| 824 | 2964694794 | 2964691889 | Bacteria | 6802758 |
| 825 | 2964704512 | 2964698721 | Bacteria | 6765331 |
| 826 | 2964706509 | 2964705432 | Bacteria | 7114648 |
| 827 | 2964714774 | 2964712639 | Bacteria | 6695970 |
| 828 | 2964725795 | 2964719344 | Bacteria | 7286602 |
| 829 | 2967666776 | 2967664464 | Bacteria | 6948836 |
| 830 | 2967677774 | 2967671571 | Bacteria | 7021409 |
| 831 | 2967685813 | 2967678726 | Bacteria | 7264382 |
| 832 | 2967690051 | 2967686174 | Bacteria | 6678622 |
| 833 | 2967698648 | 2967693043 | Bacteria | 6804451 |
| 834 | 2967711430 | 2967706974 | Bacteria | 7186053 |
| 835 | 2967727231 | 2967721400 | Bacteria | 7073753 |
| 836 | 2967734117 | 2967728569 | Bacteria | 6641507 |
| 837 | 2967739853 | 2967735183 | Bacteria | 6827012 |
| 838 | 2967745101 | 2967742019 | Bacteria | 6794534 |
| 839 | 2967754213 | 2967748971 | Bacteria | 6733771 |
| 840 | 2967759661 | 2967755722 | Bacteria | 6814706 |
| 841 | 2967768454 | 2967762386 | Bacteria | 6923502 |
| 842 | 2967772692 | 2967769361 | Bacteria | 6587838 |
| 843 | 2967779401 | 2967775926 | Bacteria | 6738189 |
| 844 | 2970024328 | 2970019648 | Bacteria | 7072033 |
| 845 | 2970027593 | 2970026789 | Bacteria | 6785236 |
| 846 | 2970035971 | 2970033650 | Bacteria | 7118744 |
| 847 | 2970045211 | 2970040964 | Bacteria | 6731123 |
| 848 | 2970051475 | 2970047711 | Bacteria | 7088379 |
| 849 | 2970056215 | 2970054988 | Bacteria | 6611507 |
| 850 | 2970065490 | 2970061556 | Bacteria | 7099761 |
| 851 | 2970070980 | 2970068827 | Bacteria | 7123112 |
| 852 | 2970079410 | 2970076120 | Bacteria | 6697332 |
| 853 | 2970084621 | 2970082768 | Bacteria | 6183754 |
| 854 | 2970094322 | 2970088815 | Bacteria | 6933825 |
| 855 | 2970099960 | 2970095765 | Bacteria | 6936963 |
| 856 | 2970103978 | 2970102677 | Bacteria | 6812532 |
| 857 | 2970111906 | 2970109326 | Bacteria | 6863976 |
| 858 | 2970120548 | 2970116247 | Bacteria | 6501857 |
| 859 | 2970126320 | 2970122695 | Bacteria | 6625855 |
| 860 | 2970134686 | 2970129317 | Bacteria | 6806560 |
| 861 | 2970141774 | 2970136068 | Bacteria | 7207982 |
| 862 | 2970147122 | 2970143518 | Bacteria | 6446480 |
| 863 | 2970152445 | 2970149975 | Bacteria | 6779706 |
| 864 | 2970162254 | 2970156795 | Bacteria | 7168044 |
| 865 | 2970168264 | 2970164137 | Bacteria | 6861252 |
| 866 | 2970175941 | 2970170962 | Bacteria | 6876229 |
| 867 | 2970181116 | 2970177841 | Bacteria | 6768001 |
| 868 | 2970186233 | 2970184632 | Bacteria | 7054431 |
| 869 | 2970196160 | 2970191845 | Bacteria | 7032787 |
| 870 | 2970530670 | 2970524798 | Bacteria | 6840927 |
| 871 | 2977523297 | 2977516862 | Bacteria | 6940108 |
| 872 | 2977528092 | 2977523885 | Bacteria | 6960446 |
| 873 | 2977536404 | 2977530762 | Bacteria | 6951399 |
| 874 | 2977543348 | 2977537788 | Bacteria | 6929320 |
| 875 | 2977551745 | 2977544691 | Bacteria | 6875412 |
| 876 | 2977553014 | 2977551784 | Bacteria | 7125765 |
| 877 | 2977564147 | 2977558990 | Bacteria | 6863948 |
| 878 | 2977568810 | 2977565890 | Bacteria | 6901543 |
| 879 | 2977574098 | 2977572785 | Bacteria | 6763888 |
| 880 | 2977585956 | 2977579622 | Bacteria | 6772100 |
| 881 | 2977832025 | 2977828996 | Bacteria | 7007971 |
| 882 | 2987668885 | 2987666974 | Bacteria | 6509233 |
| 883 | 2989350178 | 2989349275 | Bacteria | 6349068 |
| 884 | 2989773304 | 2989771324 | Bacteria | 5605128 |
| 885 | 2996310623 | 2996310559 | Bacteria | 6357320 |
| 886 | 2996341078 | 2996336353 | Bacteria | 5511628 |
| 887 | 2996892532 | 2996887358 | Bacteria | 5795980 |
| 888 | 2996898046 | 2996893221 | Bacteria | 5823108 |
| 889 | 3002145395 | 3002141150 | Bacteria | 5254435 |
| 890 | 3003934644 | 3003930520 | Bacteria | 5667563 |
| 891 | 3005418817 | 3005416602 | Bacteria | 7064308 |
| 892 | 3005448824 | 3005445848 | Bacteria | 6906074 |
| 893 | 3005455049 | 3005452660 | Bacteria | 5889319 |
| 894 | 639649574 | 639633055 | Bacteria | 7751309 |
| 895 | 643826655 | 643692032 | Bacteria | 6891900 |
| 896 | 648739492 | 648276728 | Bacteria | 6968865 |
| 897 | 8003994430 | 8003992118 | Bacteria | 7266902 |
| 898 | 8004002132 | 8003999396 | Bacteria | 7063185 |
| 899 | 8005264841 | 8005258706 | Bacteria | 6184835 |
| 900 | 8005281645 | 8005275841 | Bacteria | 6929066 |
| 901 | 8005284393 | 8005282627 | Bacteria | 6675747 |
| 902 | 8005289650 | 8005289223 | Bacteria | 6634003 |
| 903 | 8005303553 | 8005301065 | Bacteria | 6614431 |
| 904 | 8005314069 | 8005307578 | Bacteria | 7395396 |
| 905 | 8005318291 | 8005314921 | Bacteria | 7072929 |
| 906 | 8005327059 | 8005321885 | Bacteria | 5795980 |
| 907 | 8005382689 | 8005376324 | Bacteria | 6590079 |
| 908 | 8005384651 | 8005382845 | Bacteria | 6732062 |
| 909 | 8005395679 | 8005395548 | Bacteria | 6806915 |
| 910 | 8005433915 | 8005430974 | Bacteria | 6689030 |
| 911 | 8005464215 | 8005460587 | Bacteria | 7157962 |
| 912 | 8005488826 | 8005484373 | Bacteria | 6297373 |
| 913 | 8005501319 | 8005497431 | Bacteria | 6477605 |
| 914 | 8005546050 | 8005542996 | Bacteria | 7077758 |
| 915 | 8005561628 | 8005556819 | Bacteria | 6908598 |
| 916 | 8005568403 | 8005563573 | Bacteria | 7153261 |
| 917 | 8005573055 | 8005570704 | Bacteria | 6957481 |
| 918 | 8005622681 | 8005619151 | Bacteria | 7030230 |
| 919 | 8005630198 | 8005626139 | Bacteria | 6534237 |
| 920 | 8005645797 | 8005645114 | Bacteria | 6950293 |
| 921 | 8005672738 | 8005668836 | Bacteria | 6953162 |
| 922 | 8005682520 | 8005682033 | Bacteria | 6726518 |
| 923 | 8005691669 | 8005688590 | Bacteria | 6610080 |
| 924 | 8005696799 | 8005695170 | Bacteria | 6912330 |
| 925 | 8018127560 | 8018127388 | Bacteria | 7351159 |
| 926 | 8018164157 | 8018163183 | Bacteria | 7277977 |
| 927 | 8018178951 | 8018176218 | Bacteria | 6896178 |
| 928 | 8023682760 | 8023680758 | Bacteria | 7729763 |
| 929 | 8024486116 | 8024479707 | Bacteria | 6954785 |
| 930 | 8024488426 | 8024486573 | Bacteria | 6540512 |
| 931 | 8024501194 | 8024501048 | Bacteria | 6427847 |
| 932 | 8046772641 | 8046767195 | Bacteria | 7547379 |
| 933 | 8054561875 | 8054558443 | Bacteria | 5204801 |
| 934 | 8056377012 | 8056375014 | Bacteria | 7006639 |
| 935 | 8056387333 | 8056382006 | Bacteria | 6408074 |
| 936 | 8057576898 | 8057575449 | Bacteria | 7367519 |
| 937 | 8057881930 | 8057874678 | Bacteria | 7494653 |
| 938 | Ga0207639_10274169 | |||
| 939 | JGI24740J21852_10004555 | |||
| 940 | JGI25162J39368_1000149 | |||
| 941 | JGI25162J39368_1000211 | |||
| 942 | JGI25152J39213_1000899 | |||
| 943 | JGI25152J39213_1003034 | |||
| 944 | JGI25159J45721_1000008 | |||
| 945 | JGI25159J45721_1006352 | |||
| 946 | JGI25151J46595_10000027 | |||
| 947 | JGI25151J46595_10001211 | |||
| 948 | JGI25151J46595_10008331 | |||
| 949 | JGI25151J46595_10014542 | |||
| 950 | JGI25151J46595_10022311 | |||
| 951 | JGI25165J46597_1000938 | |||
| 952 | JGI25165J46597_1001280 | |||
| 953 | JGI25165J46597_1004226 | |||
| 954 | JGI25153J46596_10000608 | |||
| 955 | JGI25153J46596_10003461 | |||
| 956 | JGI25153J46596_10007133 | |||
| 957 | rootL2_10007936 | |||
| 958 | rootH1_10025853 | |||
| 959 | rootH1_10025854 | |||
| 960 | rootH1_10148901 | |||
| 961 | JGI25160J50197_1000001 | |||
| 962 | JGI25160J50197_1000033 | |||
| 963 | JGI25160J50197_1001321 | |||
| 964 | JGI25160J50197_1001492 | |||
| 965 | JGI25161J50226_1000001 | |||
| 966 | JGI25161J50226_1000163 | |||
| 967 | JGI25161J50226_1002090 | |||
| 968 | Ga0055526_1001871 | |||
| 969 | Ga0055526_1002020 | |||
| 970 | Ga0055526_1002721 | |||
| 971 | Ga0055526_1025387 | |||
| 972 | Ga0055524_1001345 | |||
| 973 | Ga0055524_1012228 | |||
| 974 | Ga0055524_1023782 | |||
| 975 | Ga0055524_1043633 | |||
| 976 | Ga0055528_1000247 | |||
| 977 | Ga0055528_1003198 | |||
| 978 | Ga0055528_1008999 | |||
| 979 | Ga0055528_1026883 | |||
| 980 | Ga0055540_1000607 | |||
| 981 | Ga0055540_1001828 | |||
| 982 | Ga0055531_10030140 | |||
| 983 | Ga0055543_1000007 | |||
| 984 | Ga0055543_1000026 | |||
| 985 | Ga0055543_1000104 | |||
| 986 | Ga0055543_1000108 | |||
| 987 | Ga0065165_1000008 | |||
| 988 | Ga0065165_1000178 | |||
| 989 | Ga0065165_1010050 | |||
| 990 | Ga0065165_1033708 | |||
| 991 | Ga0070670_100001446 | |||
| 992 | Ga0070668_100483315 | |||
| 993 | Ga0070665_100146523 | |||
| 994 | Ga0070665_100169482 | |||
| 995 | Ga0070665_100326144 | |||
| 996 | Ga0068855_100100926 | |||
| 997 | Ga0068856_100039412 | |||
| 998 | Ga0068856_100053210 | |||
| 999 | Ga0068852_100312888 | |||
| 1000 | Ga0075365_10002133 | |||
| 1001 | Ga0075365_10083738 | |||
| 1002 | Ga0075365_10215109 | |||
| 1003 | Ga0075363_100127193 | |||
| 1004 | Ga0075362_10007089 | |||
| 1005 | Ga0075367_10002388 | |||
| 1006 | Ga0075369_10001117 | |||
| 1007 | Ga0075369_10097713 | |||
| 1008 | Ga0075370_10034712 | |||
| 1009 | Ga0079104_1005065 | |||
| 1010 | Ga0105244_10189625 | |||
| 1011 | Ga0105240_10000014 | |||
| 1012 | Ga0105237_10001161 | |||
| 1013 | Ga0105238_10566216 | |||
| 1014 | Ga0123341_1000018 | |||
| 1015 | Ga0123341_1078856 | |||
| 1016 | Ga0123341_1090639 | |||
| 1017 | Ga0123342_1009978 | |||
| 1018 | Ga0123342_1038664 | |||
| 1019 | Ga0105239_10005301 | |||
| 1020 | Ga0157373_10123453 | |||
| 1021 | Ga0157370_10000015 | |||
| 1022 | Ga0171463_1007 | |||
| 1023 | Ga0182008_10060340 | |||
| 1024 | Ga0182007_10000385 | |||
| 1025 | Ga0183363_1078 | |||
| 1026 | Ga0214542_1015589 | |||
| 1027 | Ga0214543_1000022 | |||
| 1028 | Ga0228711_1000017 | |||
| 1029 | Ga0228710_1000005 | |||
| 1030 | Ga0209436_100058 | |||
| 1031 | Ga0209436_101354 | |||
| 1032 | Ga0209437_100058 | |||
| 1033 | Ga0209437_100060 | |||
| 1034 | Ga0207425_1000043 | |||
| 1035 | Ga0207425_1000436 | |||
| 1036 | Ga0207425_1002033 | |||
| 1037 | Ga0209677_100289 | |||
| 1038 | Ga0209148_1003810 | |||
| 1039 | Ga0209129_1000072 | |||
| 1040 | Ga0209129_1000128 | |||
| 1041 | Ga0209129_1000765 | |||
| 1042 | Ga0209129_1001667 | |||
| 1043 | Ga0209129_1004976 | |||
| 1044 | Ga0209129_1006922 | |||
| 1045 | Ga0209129_1006924 | |||
| 1046 | Ga0209233_1000137 | |||
| 1047 | Ga0209233_1000149 | |||
| 1048 | Ga0209233_1000160 | |||
| 1049 | Ga0209233_1013152 | |||
| 1050 | Ga0209565_1030534 | |||
| 1051 | Ga0209673_1000025 | |||
| 1052 | Ga0209673_1000125 | |||
| 1053 | Ga0209673_1000256 | |||
| 1054 | Ga0209673_1001756 | |||
| 1055 | Ga0209673_1003121 | |||
| 1056 | Ga0209673_1004623 | |||
| 1057 | Ga0209673_1037816 | |||
| 1058 | Ga0209673_1053543 | |||
| 1059 | Ga0209130_1000003 | |||
| 1060 | Ga0209130_1000017 | |||
| 1061 | Ga0209130_1000023 | |||
| 1062 | Ga0209675_1028676 | |||
| 1063 | Ga0209676_1012015 | |||
| 1064 | Ga0209676_1034027 | |||
| 1065 | Ga0209025_1000120 | |||
| 1066 | Ga0209025_1000153 | |||
| 1067 | Ga0209025_1000451 | |||
| 1068 | Ga0209025_1000537 | |||
| 1069 | Ga0209025_1000545 | |||
| 1070 | Ga0209025_1008140 | |||
| 1071 | Ga0209025_1009023 | |||
| 1072 | Ga0209025_1076920 | |||
| 1073 | Ga0209564_1000013 | |||
| 1074 | Ga0209564_1000259 | |||
| 1075 | Ga0209564_1000841 | |||
| 1076 | Ga0209564_1002367 | |||
| 1077 | Ga0209564_1002386 | |||
| 1078 | Ga0209564_1010644 | |||
| 1079 | Ga0209564_1020991 | |||
| 1080 | Ga0209758_1000111 | |||
| 1081 | Ga0209758_1000254 | |||
| 1082 | Ga0209758_1000592 | |||
| 1083 | Ga0209758_1000678 | |||
| 1084 | Ga0209758_1003028 | |||
| 1085 | Ga0209758_1004877 | |||
| 1086 | Ga0209758_1032268 | |||
| 1087 | Ga0209758_1038456 | |||
| 1088 | Ga0209050_1009447 | |||
| 1089 | Ga0209050_1015458 | |||
| 1090 | Ga0209256_1000211 | |||
| 1091 | Ga0209256_1000283 | |||
| 1092 | Ga0209256_1000669 | |||
| 1093 | Ga0209256_1000885 | |||
| 1094 | Ga0209256_1002050 | |||
| 1095 | Ga0209256_1009263 | |||
| 1096 | Ga0209256_1024647 | |||
| 1097 | Ga0209256_1038223 | |||
| 1098 | Ga0207426_1000006 | |||
| 1099 | Ga0207426_1000011 | |||
| 1100 | Ga0207426_1000087 | |||
| 1101 | Ga0207426_1000208 | |||
| 1102 | Ga0207426_1000936 | |||
| 1103 | Ga0209051_1000176 | |||
| 1104 | Ga0209051_1003032 | |||
| 1105 | Ga0209051_1003066 | |||
| 1106 | Ga0209051_1021245 | |||
| 1107 | Ga0209051_1056082 | |||
| 1108 | Ga0209257_1004862 | |||
| 1109 | Ga0209257_1013370 | |||
| 1110 | Ga0207695_10000037 | |||
| 1111 | Ga0207671_10000080 | |||
| 1112 | Ga0207650_10000624 | |||
| 1113 | Ga0207644_10015740 | |||
| 1114 | Ga0207640_10319644 | |||
| 1115 | Ga0207702_10043016 | |||
| 1116 | Ga0207702_10045362 | |||
| 1117 | Ga0207698_10343433 | |||
| 1118 | Ga0209281_1000082 | |||
| 1119 | Ga0209281_1001180 | |||
| 1120 | Ga0209371_1002582 | |||
| 1121 | Ga0209282_1000006 | |||
| 1122 | Ga0268266_10097108 | |||
| 1123 | Ga0268266_10154083 | |||
| 1124 | Ga0268266_10265403 | |||
| 1125 | Ga0307515_10000017 | |||
| 1126 | Ga0307515_10005257 | |||
| 1127 | Ga0307515_10006504 | |||
| 1128 | Ga0268256_1003727 | |||
| 1129 | Ga0307513_10002736 | |||
| 1130 | Ga0307513_10004524 | |||
| 1131 | Ga0307408_100191993 | |||
| 1132 | Ga0307405_10001465 | |||
| 1133 | Ga0307410_10148222 | |||
| 1134 | Ga0307412_10001457 | |||
| 1135 | Ga0315914_1000003 | |||
| 1136 | Ga0315913_1000001 | |||
| 1137 | Ga0315915_1000008 | |||
| 1138 | Ga0395898_0076038 | |||
| 1139 | Ga0395901_0165628 | |||
| 1140 | Ga0439436_0002190 | |||
| 1141 | Ga0439466_0063380 | |||
| 1142 | Ga0439465_0005328 | |||
| 1143 | Ga0439465_0005625 | |||
| 1144 | Ga0439465_0006019 | |||
| 1145 | Ga0439465_0063530 | |||
| 1146 | Ga0439465_0066573 | |||
| 1147 | Ga0451807_0935891 | |||
| 1148 | Ga0451839_0542176 | |||
| 1149 | Ga0451841_0577157 | |||
| 1150 | Ga0451845_0517278 | |||
| 1151 | Ga0451845_0608757 | |||
| 1152 | Ga0451851_0417130 | |||
| 1153 | Ga0451855_0274722 | |||
| 1154 | Ga0451853_3019187 | |||
| 1155 | Ga0439431_0004203 | |||
| 1156 | Ga0439449_0009721 | |||
| 1157 | Ga0439449_0011947 | |||
| 1158 | Ga0439462_0002411 | |||
| 1159 | Ga0450910_003987 | |||
| 1160 | Ga0439434_0004579 | |||
| 1161 | Ga0450918_007282 | |||
| 1162 | Ga0466966_0108748 | |||
| 1163 | Ga0466963_0051153 | |||
| 1164 | Ga0466971_0067186 | |||
| 1165 | Ga0466970_0008960 | |||
| 1166 | Ga0466957_0121407 | |||
| 1167 | Ga0466958_0039723 | |||
| 1168 | Ga0495617_040351 | |||
| 1169 | Ga0495592_0231349 | |||
| 1170 | Ga0495629_0183097 | |||
| 1171 | Ga0495638_0000746 | |||
| 1172 | Ga0495650_0056795 | |||
| 1173 | Ga0495605_0001667 | |||
| 1174 | Ga0495585_0059643 | |||
| 1175 | Ga0495607_0029078 | |||
| 1176 | Ga0495607_0030837 | |||
| 1177 | Ga0495583_0014903 | |||
| 1178 | Ga0495606_0001297 | |||
| 1179 | Ga0495606_0037171 | |||
| 1180 | Ga0495610_0002186 | |||
| 1181 | Ga0495616_0009440 | |||
| 1182 | Ga0495618_0069806 | |||
| 1183 | Ga0495620_0022072 | |||
| 1184 | Ga0495620_0027186 | |||
| 1185 | Ga0495631_0000518 | |||
| 1186 | Ga0495632_0001449 | |||
| 1187 | Ga0495632_0006976 | |||
| 1188 | Ga0495632_0016788 | |||
| 1189 | Ga0495643_0005454 | |||
| 1190 | Ga0495643_0009985 | |||
| 1191 | Ga0495643_0058031 | |||
| 1192 | Ga0495648_0031474 | |||
| 1193 | Ga0495648_0153543 | |||
| 1194 | Ga0495652_0152990 | |||
| 1195 | Ga0495654_0086295 | |||
| 1196 | Ga0495587_0179067 | |||
| 1197 | Ga0495609_0009963 | |||
| 1198 | Ga0495609_0040304 | |||
| 1199 | Ga0495597_0056838 | |||
| 1200 | Ga0495622_0034388 | |||
| 1201 | Ga0495633_0023315 | |||
| 1202 | Ga0495633_0052680 | |||
| 1203 | Ga0495656_0014559 | |||
| 1204 | Ga0495656_0043844 | |||
| 1205 | Ga0495668_0004830 | |||
| 1206 | Ga0495611_0005153 | |||
| 1207 | Ga0495611_0019043 | |||
| 1208 | Ga0495625_0004688 | |||
| 1209 | Ga0495625_0036128 | |||
| 1210 | Ga0495625_0046542 | |||
| 1211 | Ga0495625_0051062 | |||
| 1212 | Ga0495625_0140658 | |||
| 1213 | Ga0495661_0076663 | |||
| 1214 | Ga0495588_0070613 | |||
| 1215 | Ga0495624_0079396 | |||
| 1216 | Ga0495670_0010277 | |||
| 1217 | Ga0495670_0127276 | |||
| 1218 | Ga0495671_0027098 | |||
| 1219 | Ga0495660_0048243 | |||
| 1220 | Ga0495660_0049810 | |||
| 1221 | Ga0495604_0037338 | |||
| 1222 | Ga0495636_0031727 | |||
| 1223 | Ga0495687_029489 | |||
| 1224 | Ga0495687_074926 | |||
| 1225 | Ga0495677_0152053 | |||
| 1226 | Ga0495673_0146266 | |||
| 1227 | Ga0495681_0035511 | |||
| 1228 | Ga0495681_0065139 | |||
| 1229 | Ga0495681_0094327 | |||
| 1230 | Ga0495686_0000418 | |||
| 1231 | Ga0495686_0002364 | |||
| 1232 | Ga0495686_0010867 | |||
| 1233 | Ga0495686_0057962 | |||
| 1234 | Ga0495686_0103574 | |||
| 1235 | Ga0496100_0003974 | |||
| 1236 | Ga0496101_0044657 | |||
| 1237 | Ga0496101_0257032 | |||
| 1238 | Ga0496102_0008867 | |||
| 1239 | Ga0496103_0010981 | |||
| 1240 | Ga0496103_0072928 | |||
| 1241 | Ga0496104_0340241 | |||
| 1242 | Ga0496105_0122365 | |||
| 1243 | Ga0496106_0052791 | |||
| 1244 | Ga0496106_0055929 | |||
| 1245 | Ga0496113_0454510 | |||
| 1246 | Ga0496114_0086478 | |||
| 1247 | Ga0496116_0012735 | |||
| 1248 | Ga0496116_0012821 | |||
| 1249 | Ga0496116_0032068 | |||
| 1250 | Ga0496116_0180844 | |||
| 1251 | Ga0496116_0216259 | |||
| 1252 | Ga0496117_0003887 | |||
| 1253 | Ga0496117_0005580 | |||
| 1254 | Ga0496117_0010882 | |||
| 1255 | Ga0496117_0073253 | |||
| 1256 | Ga0496117_0095863 | |||
| 1257 | Ga0496117_0109230 | |||
| 1258 | Ga0496118_0003614 | |||
| 1259 | Ga0496118_0004868 | |||
| 1260 | Ga0496118_0013710 | |||
| 1261 | Ga0496118_0036618 | |||
| 1262 | Ga0496118_0046256 | |||
| 1263 | Ga0496119_0046552 | |||
| 1264 | Ga0496119_0053932 | |||
| 1265 | Ga0496119_0104505 | |||
| 1266 | Ga0496120_0061450 | |||
| 1267 | Ga0496121_0005802 | |||
| 1268 | Ga0496121_0019161 | |||
| 1269 | Ga0496121_0057768 | |||
| 1270 | Ga0496121_0086372 | |||
| 1271 | Ga0496121_0293245 | |||
| 1272 | Ga0496121_0386265 | |||
| 1273 | Ga0496122_0002474 | |||
| 1274 | Ga0496122_0004381 | |||
| 1275 | Ga0496122_0028667 | |||
| 1276 | Ga0496122_0034028 | |||
| 1277 | Ga0496122_0036119 | |||
| 1278 | Ga0496122_0088694 | |||
| 1279 | Ga0496122_0101019 | |||
| 1280 | Ga0496122_0113907 | |||
| 1281 | Ga0496123_0000839 | |||
| 1282 | Ga0496123_0007514 | |||
| 1283 | Ga0496123_0034193 | |||
| 1284 | Ga0496123_0040913 | |||
| 1285 | Ga0496123_0117119 | |||
| 1286 | Ga0496123_0124912 | |||
| 1287 | Ga0496123_0215421 | |||
| 1288 | Ga0496124_0001743 | |||
| 1289 | Ga0496124_0005611 | |||
| 1290 | Ga0496124_0005719 | |||
| 1291 | Ga0496124_0010468 | |||
| 1292 | Ga0496124_0037267 | |||
| 1293 | Ga0496124_0082710 | |||
| 1294 | Ga0496124_0101101 | |||
| 1295 | Ga0496124_0135947 | |||
| 1296 | Ga0496124_0150465 | |||
| 1297 | Ga0496124_0411325 | |||
| 1298 | Ga0496125_0002475 | |||
| 1299 | Ga0496125_0004711 | |||
| 1300 | Ga0496125_0011734 | |||
| 1301 | Ga0496125_0080363 | |||
| 1302 | Ga0496125_0131158 | |||
| 1303 | Ga0496126_0000188 | |||
| 1304 | Ga0496126_0008731 | |||
| 1305 | Ga0496126_0066328 | |||
| 1306 | Ga0496126_0260269 | |||
| 1307 | Ga0501031_0000202 | |||
| 1308 | Ga0501032_0000443 | |||
| 1309 | Ga0501032_0105637 | |||
| 1310 | Ga0501032_0275438 | |||
| 1311 | Ga0501033_0000097 | |||
| 1312 | Ga0501033_0010825 | |||
| 1313 | Ga0501034_0000186 | |||
| 1314 | Ga0501034_0011544 | |||
| 1315 | Ga0501034_0041553 | |||
| 1316 | Ga0501034_0135186 | |||
| 1317 | Ga0501036_0000002 | |||
| 1318 | Ga0501036_0146379 | |||
| 1319 | Ga0501036_0249412 | |||
| 1320 | Ga0501036_0345260 | |||
| 1321 | Ga0501037_0000443 | |||
| 1322 | Ga0501038_0000867 | |||
| 1323 | Ga0501038_0036305 | |||
| 1324 | Ga0501039_0000002 | |||
| 1325 | Ga0501039_0069810 | |||
| 1326 | Ga0501040_0001925 | |||
| 1327 | Ga0501040_0014483 | |||
| 1328 | Ga0501043_0000543 | |||
| 1329 | Ga0501043_0037844 | |||
| 1330 | Ga0501043_0078405 | |||
| 1331 | Ga0501043_0143718 | |||
| 1332 | Ga0501047_0002364 | |||
| 1333 | Ga0501047_0157248 | |||
| 1334 | Ga0501047_0168987 | |||
| 1335 | Ga0501047_0172428 | |||
| 1336 | Ga0501067_0146215 | |||
| 1337 | Ga0501068_0169680 | |||
| 1338 | Ga0501070_0009430 | |||
| 1339 | Ga0501070_0169394 | |||
| 1340 | Ga0501070_0269910 | |||
| 1341 | Ga0501073_0271248 | |||
| 1342 | Ga0501080_0069209 | |||
| 1343 | Ga0501083_0099443 | |||
| 1344 | Ga0501083_0199315 | |||
| 1345 | Ga0501035_0000100 | |||
| 1346 | Ga0501035_0038128 | |||
| 1347 | Ga0501044_0000002 | |||
| 1348 | Ga0501044_0036127 | |||
| 1349 | Ga0501044_0101205 | |||
| 1350 | Ga0501044_0150409 | |||
| 1351 | Ga0501045_0334474 | |||
| 1352 | nmdc:mga0yw44_19685_c1 | |||
| 1353 | Ga0500578_0093222 | |||
| 1354 | Ga0500643_026321 | |||
| 1355 | Ga0500646_0007652 | |||
| 1356 | Ga0500651_0243042 | |||
| 1357 | Ga0500650_0028901 | |||
| 1358 | Ga0500556_0023251 | |||
| 1359 | Ga0500557_000282 | |||
| 1360 | Ga0500560_070174 | |||
| 1361 | Ga0500562_002778 | |||
| 1362 | Ga0500569_016074 | |||
| 1363 | Ga0500594_0000635 | |||
| 1364 | Ga0500618_006727 | |||
| 1365 | Ga0500618_006924 | |||
| 1366 | Ga0500658_0000880 | |||
| 1367 | Ga0500658_0005307 | |||
| 1368 | Ga0500568_0000629 | |||
| 1369 | Ga0500568_0002233 | |||
| 1370 | Ga0500590_000127 | |||
| 1371 | Ga0500604_0017296 | |||
| 1372 | Ga0500616_0005719 | |||
| 1373 | Ga0500616_0110610 | |||
| 1374 | Ga0500620_000852 | |||
| 1375 | Ga0500622_0001672 | |||
| 1376 | Ga0500627_0032004 | |||
| 1377 | Ga0500633_0016986 | |||
| 1378 | Ga0500633_0051404 | |||
| 1379 | Ga0500636_0097124 | |||
| 1380 | Ga0500645_015656 | |||
| 1381 | Ga0501082_0056138 | |||
| 1382 | 2501078086 | |||
| 1383 | 2509108047 | |||
| 1384 | 2509376774 | |||
| 1385 | 2509390175 | |||
| 1386 | 2509447535 | |||
| 1387 | 2510134359 | |||
| 1388 | 2510308320 | |||
| 1389 | 2510895792 | |||
| 1390 | 2511091957 | |||
| 1391 | 2511131929 | |||
| 1392 | 2511182654 | |||
| 1393 | 2511194915 | |||
| 1394 | 2511391278 | |||
| 1395 | 2511502503 | |||
| 1396 | 2512533878 | |||
| 1397 | 2512970367 | |||
| 1398 | 2513567521 | |||
| 1399 | 2513577857 | |||
| 1400 | 2513587465 | |||
| 1401 | 2513598404 | |||
| 1402 | 2513601431 | |||
| 1403 | 2513619558 | |||
| 1404 | 2513631996 | |||
| 1405 | 2513712530 | |||
| 1406 | 2513867916 | |||
| 1407 | 2513881809 | |||
| 1408 | 2513904953 | |||
| 1409 | 2513910648 | |||
| 1410 | 2513928093 | |||
| 1411 | 2513983629 | |||
| 1412 | 2513997574 | |||
| 1413 | 2514003122 | |||
| 1414 | 2514420214 | |||
| 1415 | 2514588972 | |||
| 1416 | 2515113530 | |||
| 1417 | 2515609292 | |||
| 1418 | 2515635243 | |||
| 1419 | 2515643850 | |||
| 1420 | 2515654938 | |||
| 1421 | 2515739884 | |||
| 1422 | 2516893878 | |||
| 1423 | 2517037142 | |||
| 1424 | 2517077483 | |||
| 1425 | 2517096249 | |||
| 1426 | 2517408107 | |||
| 1427 | 2517570595 | |||
| 1428 | 2520381948 | |||
| 1429 | 2524448298 | |||
| 1430 | 2524459012 | |||
| 1431 | 2530646387 | |||
| 1432 | 2535517230 | |||
| 1433 | 2551679615 | |||
| 1434 | 2551689446 | |||
| 1435 | 2551704732 | |||
| 1436 | 2551710591 | |||
| 1437 | 2551723158 | |||
| 1438 | 2551735560 | |||
| 1439 | 2551740098 | |||
| 1440 | 2558865869 | |||
| 1441 | 2585167553 | |||
| 1442 | 2585205102 | |||
| 1443 | 2585225255 | |||
| 1444 | 2585230680 | |||
| 1445 | 2585259115 | |||
| 1446 | 2585265780 | |||
| 1447 | 2585273969 | |||
| 1448 | 2585279430 | |||
| 1449 | 2585322910 | |||
| 1450 | 2585331078 | |||
| 1451 | 2585389027 | |||
| 1452 | 2585395173 | |||
| 1453 | 2585404602 | |||
| 1454 | 2585524910 | |||
| 1455 | 2585531086 | |||
| 1456 | 2585542783 | |||
| 1457 | 2585547811 | |||
| 1458 | 2585552993 | |||
| 1459 | 2585560420 | |||
| 1460 | 2585824861 | |||
| 1461 | 2585841425 | |||
| 1462 | 2585847703 | |||
| 1463 | 2585898614 | |||
| 1464 | 2585903798 | |||
| 1465 | 2587981083 | |||
| 1466 | 2597814374 | |||
| 1467 | 2599421102 | |||
| 1468 | 2600196076 | |||
| 1469 | 2616296660 | |||
| 1470 | 2616307003 | |||
| 1471 | 2616554616 | |||
| 1472 | 2617384883 | |||
| 1473 | 2643804384 | |||
| 1474 | 2644002914 | |||
| 1475 | 2644050103 | |||
| 1476 | 2644065155 | |||
| 1477 | 2644105446 | |||
| 1478 | 2644129083 | |||
| 1479 | 2644146449 | |||
| 1480 | 2644168758 | |||
| 1481 | 2644204837 | |||
| 1482 | 2644208696 | |||
| 1483 | 2644237894 | |||
| 1484 | 2644308197 | |||
| 1485 | 2644334021 | |||
| 1486 | 2644347307 | |||
| 1487 | 2644377564 | |||
| 1488 | 2644416827 | |||
| 1489 | 2644449867 | |||
| 1490 | 2644483024 | |||
| 1491 | 2644497692 | |||
| 1492 | 2644541618 | |||
| 1493 | 2644615479 | |||
| 1494 | 2644652226 | |||
| 1495 | 2644672780 | |||
| 1496 | 2644690001 | |||
| 1497 | 2644743308 | |||
| 1498 | 2671111861 | |||
| 1499 | 2719386834 | |||
| 1500 | 2719666574 | |||
| 1501 | 2720492994 | |||
| 1502 | 2720614470 | |||
| 1503 | 2720621246 | |||
| 1504 | 2720632572 | |||
| 1505 | 2720776294 | |||
| 1506 | 2721400557 | |||
| 1507 | 2723027886 | |||
| 1508 | 2723561514 | |||
| 1509 | 2723568144 | |||
| 1510 | 2723575730 | |||
| 1511 | 2724039370 | |||
| 1512 | 2724090901 | |||
| 1513 | 2724105409 | |||
| 1514 | 2724111232 | |||
| 1515 | 2725950239 | |||
| 1516 | 2730108822 | |||
| 1517 | 2738805420 | |||
| 1518 | 2739033235 | |||
| 1519 | 2765467210 | |||
| 1520 | 2766066279 | |||
| 1521 | 2770198806 | |||
| 1522 | 2776273014 | |||
| 1523 | 2776282143 | |||
| 1524 | 2778173383 | |||
| 1525 | 2792638784 | |||
| 1526 | 2793294020 | |||
| 1527 | 2793314305 | |||
| 1528 | 2793323790 | |||
| 1529 | 2793329696 | |||
| 1530 | 2793342297 | |||
| 1531 | 2793355317 | |||
| 1532 | 2793362967 | |||
| 1533 | 2793369879 | |||
| 1534 | 2802716724 | |||
| 1535 | 2802725535 | |||
| 1536 | 2802730373 | |||
| 1537 | 2802737656 | |||
| 1538 | 2802742955 | |||
| 1539 | 2802750379 | |||
| 1540 | 2805929534 | |||
| 1541 | 2805936838 | |||
| 1542 | 2806047523 | |||
| 1543 | 2806055127 | |||
| 1544 | 2806063063 | |||
| 1545 | 2806069798 | |||
| 1546 | 2806075727 | |||
| 1547 | 2819609927 | |||
| 1548 | 2819640037 | |||
| 1549 | 2838019937 | |||
| 1550 | 2838033238 | |||
| 1551 | 2838041465 | |||
| 1552 | 2838045609 | |||
| 1553 | 2838052747 | |||
| 1554 | 2838065004 | |||
| 1555 | 2838069729 | |||
| 1556 | 2838079678 | |||
| 1557 | 2838665857 | |||
| 1558 | 2838671765 | |||
| 1559 | 2838686639 | |||
| 1560 | 2838698026 | |||
| 1561 | 2838704444 | |||
| 1562 | 2838711141 | |||
| 1563 | 2838734881 | |||
| 1564 | 2838747496 | |||
| 1565 | 2839996428 | |||
| 1566 | 2840770364 | |||
| 1567 | 2841854468 | |||
| 1568 | 2841867387 | |||
| 1569 | 2842079316 | |||
| 1570 | 2842115578 | |||
| 1571 | 2842118173 | |||
| 1572 | 2842149662 | |||
| 1573 | 2842158513 | |||
| 1574 | 2842169043 | |||
| 1575 | 2842182127 | |||
| 1576 | 2842195635 | |||
| 1577 | 2842218360 | |||
| 1578 | 2842229873 | |||
| 1579 | 2842240087 | |||
| 1580 | 2842243762 | |||
| 1581 | 2842254171 | |||
| 1582 | 2842258153 | |||
| 1583 | 2842267656 | |||
| 1584 | 2842271823 | |||
| 1585 | 2842284406 | |||
| 1586 | 2842285192 | |||
| 1587 | 2842292978 | |||
| 1588 | 2842298364 | |||
| 1589 | 2842305434 | |||
| 1590 | 2842314158 | |||
| 1591 | 2842319961 | |||
| 1592 | 2842347643 | |||
| 1593 | 2842360376 | |||
| 1594 | 2842368705 | |||
| 1595 | 2842373660 | |||
| 1596 | 2842379375 | |||
| 1597 | 2842384684 | |||
| 1598 | 2842400587 | |||
| 1599 | 2842402550 | |||
| 1600 | 2842410079 | |||
| 1601 | 2842416727 | |||
| 1602 | 2842423343 | |||
| 1603 | 2842430300 | |||
| 1604 | 2842436888 | |||
| 1605 | 2842443270 | |||
| 1606 | 2842449135 | |||
| 1607 | 2842467172 | |||
| 1608 | 2842471242 | |||
| 1609 | 2842480097 | |||
| 1610 | 2842483709 | |||
| 1611 | 2842493499 | |||
| 1612 | 2842497649 | |||
| 1613 | 2842505118 | |||
| 1614 | 2842510380 | |||
| 1615 | 2842522183 | |||
| 1616 | 2842875729 | |||
| 1617 | 2844166360 | |||
| 1618 | 2844457937 | |||
| 1619 | 2847419761 | |||
| 1620 | 2848994778 | |||
| 1621 | 2850081776 | |||
| 1622 | 2852390795 | |||
| 1623 | 2855826604 | |||
| 1624 | 2855841994 | |||
| 1625 | 2855877277 | |||
| 1626 | 2857517014 | |||
| 1627 | 2858802668 | |||
| 1628 | 2871454819 | |||
| 1629 | 2882635620 | |||
| 1630 | 2889792368 | |||
| 1631 | 2889916997 | |||
| 1632 | 2891373701 | |||
| 1633 | 2894657084 | |||
| 1634 | 2896391211 | |||
| 1635 | 2904582563 | |||
| 1636 | 2915981135 | |||
| 1637 | 2915993233 | |||
| 1638 | 2915999039 | |||
| 1639 | 2916005045 | |||
| 1640 | 2916012711 | |||
| 1641 | 2916018961 | |||
| 1642 | 2916023016 | |||
| 1643 | 2916033855 | |||
| 1644 | 2916039364 | |||
| 1645 | 2916044373 | |||
| 1646 | 2916050421 | |||
| 1647 | 2916060333 | |||
| 1648 | 2916063323 | |||
| 1649 | 2916075751 | |||
| 1650 | 2916080471 | |||
| 1651 | 2919105589 | |||
| 1652 | 2919124043 | |||
| 1653 | 2919410361 | |||
| 1654 | 2919679727 | |||
| 1655 | 2920761186 | |||
| 1656 | 2920825622 | |||
| 1657 | 2921205763 | |||
| 1658 | 2921212556 | |||
| 1659 | 2921243988 | |||
| 1660 | 2921244487 | |||
| 1661 | 2921251644 | |||
| 1662 | 2921262655 | |||
| 1663 | 2921269413 | |||
| 1664 | 2921287130 | |||
| 1665 | 2921294122 | |||
| 1666 | 2921299564 | |||
| 1667 | 2923562262 | |||
| 1668 | 2924150320 | |||
| 1669 | 2924156528 | |||
| 1670 | 2924159883 | |||
| 1671 | 2924172253 | |||
| 1672 | 2924178431 | |||
| 1673 | 2924183502 | |||
| 1674 | 2924193087 | |||
| 1675 | 2924196437 | |||
| 1676 | 2924203887 | |||
| 1677 | 2924210798 | |||
| 1678 | 2924218396 | |||
| 1679 | 2924225632 | |||
| 1680 | 2924233274 | |||
| 1681 | 2924766773 | |||
| 1682 | 2928524837 | |||
| 1683 | 2933571241 | |||
| 1684 | 2933591993 | |||
| 1685 | 2933600536 | |||
| 1686 | 2935896590 | |||
| 1687 | 2935901485 | |||
| 1688 | 2936371628 | |||
| 1689 | 2936377001 | |||
| 1690 | 2936383409 | |||
| 1691 | 2937002755 | |||
| 1692 | 2937005319 | |||
| 1693 | 2937012854 | |||
| 1694 | 2937021880 | |||
| 1695 | 2937027330 | |||
| 1696 | 2937035626 | |||
| 1697 | 2937039659 | |||
| 1698 | 2937048470 | |||
| 1699 | 2937055575 | |||
| 1700 | 2937063786 | |||
| 1701 | 2937068700 | |||
| 1702 | 2937075923 | |||
| 1703 | 2937080688 | |||
| 1704 | 2937088885 | |||
| 1705 | 2937097441 | |||
| 1706 | 2937101156 | |||
| 1707 | 2937110207 | |||
| 1708 | 2937117687 | |||
| 1709 | 2937124520 | |||
| 1710 | 2937132284 | |||
| 1711 | 2941504612 | |||
| 1712 | 2954011203 | |||
| 1713 | 2957380699 | |||
| 1714 | 2957387273 | |||
| 1715 | 2957389513 | |||
| 1716 | 2957397247 | |||
| 1717 | 2957408310 | |||
| 1718 | 2957412934 | |||
| 1719 | 2957418932 | |||
| 1720 | 2957426302 | |||
| 1721 | 2957435828 | |||
| 1722 | 2957441148 | |||
| 1723 | 2957450232 | |||
| 1724 | 2957455769 | |||
| 1725 | 2957460461 | |||
| 1726 | 2957468809 | |||
| 1727 | 2957476639 | |||
| 1728 | 2957483159 | |||
| 1729 | 2957489189 | |||
| 1730 | 2957495143 | |||
| 1731 | 2957501681 | |||
| 1732 | 2957512313 | |||
| 1733 | 2960584875 | |||
| 1734 | 2960591801 | |||
| 1735 | 2960602116 | |||
| 1736 | 2960610261 | |||
| 1737 | 2960613109 | |||
| 1738 | 2960617986 | |||
| 1739 | 2960629770 | |||
| 1740 | 2960634002 | |||
| 1741 | 2960638332 | |||
| 1742 | 2960651103 | |||
| 1743 | 2960655048 | |||
| 1744 | 2960667080 | |||
| 1745 | 2960670716 | |||
| 1746 | 2960680535 | |||
| 1747 | 2960680815 | |||
| 1748 | 2960688193 | |||
| 1749 | 2960699591 | |||
| 1750 | 2964618167 | |||
| 1751 | 2964628044 | |||
| 1752 | 2964634216 | |||
| 1753 | 2964639153 | |||
| 1754 | 2964646239 | |||
| 1755 | 2964651258 | |||
| 1756 | 2964656951 | |||
| 1757 | 2964667675 | |||
| 1758 | 2964676580 | |||
| 1759 | 2964682675 | |||
| 1760 | 2964689230 | |||
| 1761 | 2964694794 | |||
| 1762 | 2964704512 | |||
| 1763 | 2964706509 | |||
| 1764 | 2964714774 | |||
| 1765 | 2964725795 | |||
| 1766 | 2967666776 | |||
| 1767 | 2967677774 | |||
| 1768 | 2967685813 | |||
| 1769 | 2967690051 | |||
| 1770 | 2967698648 | |||
| 1771 | 2967711430 | |||
| 1772 | 2967727231 | |||
| 1773 | 2967734117 | |||
| 1774 | 2967739853 | |||
| 1775 | 2967745101 | |||
| 1776 | 2967754213 | |||
| 1777 | 2967759661 | |||
| 1778 | 2967768454 | |||
| 1779 | 2967772692 | |||
| 1780 | 2967779401 | |||
| 1781 | 2970024328 | |||
| 1782 | 2970027593 | |||
| 1783 | 2970035971 | |||
| 1784 | 2970045211 | |||
| 1785 | 2970051475 | |||
| 1786 | 2970056215 | |||
| 1787 | 2970065490 | |||
| 1788 | 2970070980 | |||
| 1789 | 2970079410 | |||
| 1790 | 2970084621 | |||
| 1791 | 2970094322 | |||
| 1792 | 2970099960 | |||
| 1793 | 2970103978 | |||
| 1794 | 2970111906 | |||
| 1795 | 2970120548 | |||
| 1796 | 2970126320 | |||
| 1797 | 2970134686 | |||
| 1798 | 2970141774 | |||
| 1799 | 2970147122 | |||
| 1800 | 2970152445 | |||
| 1801 | 2970162254 | |||
| 1802 | 2970168264 | |||
| 1803 | 2970175941 | |||
| 1804 | 2970181116 | |||
| 1805 | 2970186233 | |||
| 1806 | 2970196160 | |||
| 1807 | 2970530670 | |||
| 1808 | 2977523297 | |||
| 1809 | 2977528092 | |||
| 1810 | 2977536404 | |||
| 1811 | 2977543348 | |||
| 1812 | 2977551745 | |||
| 1813 | 2977553014 | |||
| 1814 | 2977564147 | |||
| 1815 | 2977568810 | |||
| 1816 | 2977574098 | |||
| 1817 | 2977585956 | |||
| 1818 | 2977832025 | |||
| 1819 | 2987668885 | |||
| 1820 | 2989350178 | |||
| 1821 | 2989773304 | |||
| 1822 | 2996310623 | |||
| 1823 | 2996341078 | |||
| 1824 | 2996892532 | |||
| 1825 | 2996898046 | |||
| 1826 | 3002145395 | |||
| 1827 | 3003934644 | |||
| 1828 | 3005418817 | |||
| 1829 | 3005448824 | |||
| 1830 | 3005455049 | |||
| 1831 | 639649574 | |||
| 1832 | 643826655 | |||
| 1833 | 648739492 | |||
| 1834 | 8003994430 | |||
| 1835 | 8004002132 | |||
| 1836 | 8005264841 | |||
| 1837 | 8005281645 | |||
| 1838 | 8005284393 | |||
| 1839 | 8005289650 | |||
| 1840 | 8005303553 | |||
| 1841 | 8005314069 | |||
| 1842 | 8005318291 | |||
| 1843 | 8005327059 | |||
| 1844 | 8005382689 | |||
| 1845 | 8005384651 | |||
| 1846 | 8005395679 | |||
| 1847 | 8005433915 | |||
| 1848 | 8005464215 | |||
| 1849 | 8005488826 | |||
| 1850 | 8005501319 | |||
| 1851 | 8005546050 | |||
| 1852 | 8005561628 | |||
| 1853 | 8005568403 | |||
| 1854 | 8005573055 | |||
| 1855 | 8005622681 | |||
| 1856 | 8005630198 | |||
| 1857 | 8005645797 | |||
| 1858 | 8005672738 | |||
| 1859 | 8005682520 | |||
| 1860 | 8005691669 | |||
| 1861 | 8005696799 | |||
| 1862 | 8018127560 | |||
| 1863 | 8018164157 | |||
| 1864 | 8018178951 | |||
| 1865 | 8023682760 | |||
| 1866 | 8024486116 | |||
| 1867 | 8024488426 | |||
| 1868 | 8024501194 | |||
| 1869 | 8046772641 | |||
| 1870 | 8054561875 | |||
| 1871 | 8056377012 | |||
| 1872 | 8056387333 | |||
| 1873 | 8057576898 | |||
| 1874 | 8057881930 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qi9-assembly1.cif.gz_D | abc-transporter btucd in complex with its periplasmic binding protein btuf | 0.9387 | 2 | 243 |
| 4dbl-assembly1.cif.gz_C | crystal structure of e159q mutant of btucdf | 0.9376 | 2 | 243 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9285 | 2 | 237 |
| 1l7v-assembly1.cif.gz_D | bacterial abc transporter involved in b12 uptake | 0.9284 | 2 | 240 |
| 4r9u-assembly1.cif.gz_D | structure of vitamin b12 transporter btucd in a nucleotide-bound outward facing state | 0.9197 | 2 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G072_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9418 | 1 | 247 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9273 | 2 | 220 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9241 | 2 | 227 | 3.40.50.300 |
| 2qi9C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9215 | 1 | 239 | 3.40.50.300 |
| af_Q2FVG0_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9209 | 1 | 225 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q8NL85-F1-model_v4 | Iron ABC transporter | 0.986 | 1 | 263 |
GO:0005524
GO:0016887 |
| AF-A0A7W3ZHU8-F1-model_v4 | deleted | 0.9607 | 1 | 253 |
|
| AF-A0A7W6EYH3-F1-model_v4 | Iron complex transport system ATP-binding protein | 0.9607 | 2 | 239 |
GO:0005524
GO:0016887 |
| AF-A0A4V3JXG7-F1-model_v4 | Heme ABC transporter ATP-binding protein | 0.9587 | 2 | 248 |
GO:0005524
GO:0016887 |
| AF-A0A2M9LCL9-F1-model_v4 | Heme ABC transporter ATP-binding protein | 0.9549 | 1 | 237 |
GO:0005524
GO:0016887 |