F486222

General Info

Members Datasets Scaffolds Average Seq Length
937 714 1874 261

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10274169|Ga0207639_102741692
Length 312
Sequence MIDVSNLVVRLGGKAVVKEVSFAAEPGTLTAICGPNGSGKTTTMKAISGELAYQGSVHMNGSEIGSLQAWQLAEMRGVLPQASSISFPFTVREIVRMGLTTGRNSRPEQADRIAADALACVDLIGFEGRFYQELSGGEQQRVQLARVLCQISEPVIDGKPCWLLLDEPVSSLDISHQLTIMTLARQFCRRGGGVIAVMHDLNLTALFADQMVLLKEGQLRAAGPVREVLQDRHLQDIFGCNLRVNRIPADGVPFVLAHSALPWAPVVPDPEPAEVRPRVYRTRAALSVRLARIADAVAPRGWVPQHHTASSR

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
38 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
46 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
47 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
48 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
49 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
89 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
90 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
100 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
101 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
205 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
206 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
223 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
224 2509276019 Ensifer aridi TW10 Isolate Nodule
225 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
226 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
227 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
228 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
229 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
230 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
231 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
232 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
233 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
234 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
235 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
236 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
237 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
238 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
239 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
240 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
241 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
242 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
243 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
244 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
245 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
246 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
247 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
248 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
249 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
250 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
251 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
252 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
253 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
254 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
255 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
256 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
257 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
258 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
259 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
260 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
261 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
262 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
263 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
264 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
265 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
266 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
267 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
268 2519899620 Rhizobium sp. Pop5 Isolate Nodule
269 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
270 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
271 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
272 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
273 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
274 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
275 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
276 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
277 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
278 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
279 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
280 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
281 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
282 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
283 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
284 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
285 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
286 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
287 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
288 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
289 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
290 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
291 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
292 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
293 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
294 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
295 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
296 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
297 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
298 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
299 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
300 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
301 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
302 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
303 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
304 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
305 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
306 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
307 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
308 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
309 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
310 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
311 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
312 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
313 2643221557 Ensifer sp. Root558 Isolate Unclassified
314 2643221599 Rhizobium sp. Root708 Isolate Unclassified
315 2643221607 Rhizobium sp. Root73 Isolate Unclassified
316 2643221610 Ensifer sp. Root74 Isolate Unclassified
317 2643221618 Ensifer sp. Root231 Isolate Unclassified
318 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
319 2643221626 Ensifer sp. Root31 Isolate Unclassified
320 2643221629 Devosia sp. Root105 Isolate Unclassified
321 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
322 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
323 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
324 2643221655 Ensifer sp. Root1252 Isolate Unclassified
325 2643221659 Ensifer sp. Root127 Isolate Unclassified
326 2643221662 Devosia sp. Root413D1 Isolate Unclassified
327 2643221668 Ensifer sp. Root423 Isolate Unclassified
328 2643221675 Ensifer sp. Root1298 Isolate Unclassified
329 2643221680 Ensifer sp. Root1312 Isolate Unclassified
330 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
331 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
332 2643221698 Ensifer sp. Root142 Isolate Unclassified
333 2643221712 Ensifer sp. Root258 Isolate Unclassified
334 2643221718 Rhizobium sp. Root268 Isolate Unclassified
335 2643221723 Ensifer sp. Root278 Isolate Unclassified
336 2643221726 Ensifer sp. Root954 Isolate Unclassified
337 2643221736 Bosea sp. Root483D1 Isolate Unclassified
338 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
339 2718217927 Rhizobium sp. N324 Isolate Nodule
340 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
341 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
342 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
343 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
344 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
345 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
346 2718218423 Rhizobium sp. N941 Isolate Nodule
347 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
348 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
349 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
350 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
351 2721755809 Rhizobium sp. N541 Isolate Nodule
352 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
353 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
354 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
355 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
356 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
357 2738541293 Rhizobium sp. GV031 Isolate Unclassified
358 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
359 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
360 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
361 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
362 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
363 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
364 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
365 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
366 2791355256 Rhizobium sp. M10 Isolate Nodule
367 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
368 2791355260 Rhizobium sp. L9 Isolate Nodule
369 2791355261 Rhizobium sp. J15 Isolate Nodule
370 2791355263 Rhizobium chutanense C5 Isolate Nodule
371 2791355265 Rhizobium sp. H4 Isolate Nodule
372 2791355266 Rhizobium sp. L43 Isolate Nodule
373 2791355267 Rhizobium sp. L18 Isolate Nodule
374 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
375 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
376 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
377 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
378 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
379 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
380 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
381 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
382 2802429633 Rhizobium anhuiense J3 Isolate Nodule
383 2802429634 Rhizobium anhuiense S10 Isolate Nodule
384 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
385 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
386 2802429637 Rhizobium anhuiense C15 Isolate Nodule
387 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
388 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
389 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
390 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
391 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
392 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
393 2838048938 Rhizobium pisi 27/80 Isolate Nodule
394 2838061910 Rhizobium phaseoli L15 Isolate Nodule
395 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
396 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
397 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
398 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
399 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
400 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
401 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
402 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
403 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
404 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
405 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
406 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
407 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
408 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
409 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
410 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
411 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
412 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
413 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
414 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
415 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
416 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
417 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
418 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
419 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
420 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
421 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
422 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
423 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
424 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
425 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
426 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
427 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
428 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
429 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
430 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
431 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
432 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
433 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
434 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
435 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
436 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
437 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
438 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
439 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
440 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
441 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
442 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
443 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
444 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
445 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
446 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
447 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
448 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
449 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
450 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
451 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
452 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
453 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
454 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
455 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
456 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
457 2844163670 Ensifer sp. 1H6 Isolate Unclassified
458 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
459 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
460 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
461 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
462 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
463 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
464 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
465 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
466 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
467 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
468 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
469 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
470 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
471 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
472 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
473 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
474 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
475 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
476 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
477 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
478 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
479 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
480 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
481 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
482 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
483 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
484 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
485 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
486 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
487 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
488 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
489 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
490 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
491 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
492 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
493 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
494 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
495 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
496 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
497 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
498 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
499 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
500 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
501 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
502 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
503 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
504 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
505 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
506 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
507 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
508 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
509 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
510 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
511 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
512 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
513 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
514 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
515 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
516 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
517 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
518 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
519 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
520 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
521 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
522 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
523 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
524 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
525 2933599457 Rhizobium phaseoli M3 Isolate Nodule
526 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
527 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
528 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
529 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
530 2936381700 Rhizobium chutanense C16 Isolate Unclassified
531 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
532 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
533 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
534 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
535 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
536 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
537 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
538 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
539 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
540 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
541 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
542 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
543 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
544 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
545 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
546 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
547 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
548 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
549 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
550 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
551 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
552 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
553 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
554 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
555 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
556 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
557 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
558 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
559 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
560 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
561 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
562 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
563 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
564 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
565 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
566 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
567 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
568 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
569 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
570 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
571 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
572 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
573 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
574 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
575 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
576 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
577 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
578 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
579 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
580 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
581 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
582 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
583 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
584 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
585 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
586 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
587 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
588 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
589 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
590 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
591 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
592 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
593 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
594 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
595 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
596 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
597 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
598 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
599 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
600 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
601 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
602 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
603 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
604 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
605 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
606 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
607 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
608 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
609 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
610 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
611 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
612 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
613 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
614 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
615 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
616 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
617 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
618 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
619 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
620 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
621 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
622 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
623 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
624 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
625 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
626 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
627 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
628 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
629 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
630 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
631 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
632 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
633 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
634 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
635 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
636 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
637 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
638 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
639 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
640 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
641 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
642 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
643 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
644 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
645 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
646 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
647 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
648 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
649 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
650 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
651 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
652 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
653 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
654 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
655 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
656 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
657 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
658 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
659 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
660 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
661 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
662 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
663 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
664 2996887358 Rhizobium sp. R711 Isolate Nodule
665 2996893221 Rhizobium sp. R635 Isolate Nodule
666 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
667 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
668 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
669 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
670 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
671 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
672 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
673 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
674 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
675 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
676 8005258706 Rhizobium sp. R693 Isolate Nodule
677 8005275841 Rhizobium sp. N4311 Isolate Nodule
678 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
679 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
680 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
681 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
682 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
683 8005321885 Rhizobium sp. R72 Isolate Nodule
684 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
685 8005382845 Rhizobium sp. R634 Isolate Nodule
686 8005395548 Rhizobium sp. R339 Isolate Nodule
687 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
688 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
689 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
690 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
691 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
692 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
693 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
694 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
695 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
696 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
697 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
698 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
699 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
700 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
701 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
702 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
703 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
704 8018176218 Rhizobium sp. N122 Isolate Nodule
705 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
706 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
707 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
708 8024501048 Rhizobium sp. H4 Isolate Nodule
709 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
710 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
711 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
712 8056382006 Rhizobium croatiense 13T Isolate Nodule
713 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
714 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.39
Metatranscriptomes 0
Isolates 52.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.61
Nodule 41.52
Rhizoplane 1.81
Rhizosphere 23.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10274169 3300026041 Bacteria 1481
2 JGI24740J21852_10004555 3300001979 Bacteria 5963
3 JGI25162J39368_1000149 3300002737 Bacteria 76227
4 JGI25162J39368_1000211 3300002737 Bacteria 61063
5 JGI25152J39213_1000899 3300002773 Bacteria 14563
6 JGI25152J39213_1003034 3300002773 Bacteria 5924
7 JGI25159J45721_1000008 3300002987 Bacteria 172667
8 JGI25159J45721_1006352 3300002987 Bacteria 3547
9 JGI25151J46595_10000027 3300003187 Bacteria 208739
10 JGI25151J46595_10001211 3300003187 Bacteria 18438
11 JGI25151J46595_10008331 3300003187 Bacteria 4995
12 JGI25151J46595_10014542 3300003187 Bacteria 3502
13 JGI25151J46595_10022311 3300003187 Bacteria 2631
14 JGI25165J46597_1000938 3300003214 Bacteria 19980
15 JGI25165J46597_1001280 3300003214 Bacteria 14630
16 JGI25165J46597_1004226 3300003214 Bacteria 3165
17 JGI25153J46596_10000608 3300003215 Bacteria 21909
18 JGI25153J46596_10003461 3300003215 Bacteria 8839
19 JGI25153J46596_10007133 3300003215 Bacteria 5544
20 rootL2_10007936 3300003322 Bacteria 8791
21 rootH1_10025853 3300003323 Bacteria 1804
22 rootH1_10025854 3300003323 Bacteria 2122
23 rootH1_10148901 3300003323 Bacteria 1207
24 JGI25160J50197_1000001 3300003354 Bacteria 782301
25 JGI25160J50197_1000033 3300003354 Bacteria 172667
26 JGI25160J50197_1001321 3300003354 Bacteria 12519
27 JGI25160J50197_1001492 3300003354 Bacteria 11623
28 JGI25161J50226_1000001 3300003374 Bacteria 655036
29 JGI25161J50226_1000163 3300003374 Bacteria 46470
30 JGI25161J50226_1002090 3300003374 Bacteria 5397
31 Ga0055526_1001871 3300003771 Bacteria 14577
32 Ga0055526_1002020 3300003771 Bacteria 13960
33 Ga0055526_1002721 3300003771 Bacteria 11747
34 Ga0055526_1025387 3300003771 Bacteria 1903
35 Ga0055524_1001345 3300003775 Bacteria 14335
36 Ga0055524_1012228 3300003775 Bacteria 3305
37 Ga0055524_1023782 3300003775 Bacteria 1964
38 Ga0055524_1043633 3300003775 Bacteria 1100
39 Ga0055528_1000247 3300003790 Bacteria 45698
40 Ga0055528_1003198 3300003790 Bacteria 8371
41 Ga0055528_1008999 3300003790 Bacteria 4215
42 Ga0055528_1026883 3300003790 Bacteria 1638
43 Ga0055540_1000607 3300003792 Bacteria 25671
44 Ga0055540_1001828 3300003792 Bacteria 12035
45 Ga0055531_10030140 3300003794 Bacteria 1830
46 Ga0055543_1000007 3300004625 Bacteria 204042
47 Ga0055543_1000026 3300004625 Bacteria 136177
48 Ga0055543_1000104 3300004625 Bacteria 73576
49 Ga0055543_1000108 3300004625 Bacteria 71519
50 Ga0065165_1000008 3300005262 Bacteria 334429
51 Ga0065165_1000178 3300005262 Bacteria 113319
52 Ga0065165_1010050 3300005262 Bacteria 4155
53 Ga0065165_1033708 3300005262 Bacteria 1591
54 Ga0070670_100001446 3300005331 Bacteria 19064
55 Ga0070668_100483315 3300005347 Bacteria 1070
56 Ga0070665_100146523 3300005548 Bacteria 2364
57 Ga0070665_100169482 3300005548 Bacteria 2185
58 Ga0070665_100326144 3300005548 Bacteria 1539
59 Ga0068855_100100926 3300005563 Bacteria 3322
60 Ga0068856_100039412 3300005614 Bacteria 4639
61 Ga0068856_100053210 3300005614 Bacteria 3992
62 Ga0068852_100312888 3300005616 Bacteria 1523
63 Ga0075365_10002133 3300006038 Bacteria 9493
64 Ga0075365_10083738 3300006038 Bacteria 2164
65 Ga0075365_10215109 3300006038 Bacteria 1348
66 Ga0075363_100127193 3300006048 Bacteria 1427
67 Ga0075362_10007089 3300006177 Bacteria 4218
68 Ga0075367_10002388 3300006178 Bacteria 8556
69 Ga0075369_10001117 3300006186 Bacteria 9017
70 Ga0075369_10097713 3300006186 Bacteria 1315
71 Ga0075370_10034712 3300006353 Bacteria 2828
72 Ga0079104_1005065 3300006946 Bacteria 5372
73 Ga0105244_10189625 3300009036 Bacteria 973
74 Ga0105240_10000014 3300009093 Bacteria 482033
75 Ga0105237_10001161 3300009545 Bacteria 35234
76 Ga0105238_10566216 3300009551 Bacteria 1141
77 Ga0123341_1000018 3300009765 Bacteria 81421
78 Ga0123341_1078856 3300009765 Bacteria 1318
79 Ga0123341_1090639 3300009765 Bacteria 1099
80 Ga0123342_1009978 3300009766 Bacteria 11071
81 Ga0123342_1038664 3300009766 Bacteria 1848
82 Ga0105239_10005301 3300010375 Bacteria 15145
83 Ga0157373_10123453 3300013100 Bacteria 1820
84 Ga0157370_10000015 3300013104 Bacteria 185771
85 Ga0171463_1007 3300013249 Bacteria 301198
86 Ga0182008_10060340 3300014497 Bacteria 1870
87 Ga0182007_10000385 3300015262 Bacteria 27600
88 Ga0183363_1078 3300015690 Bacteria 29406
89 Ga0214542_1015589 3300021321 Bacteria 7832
90 Ga0214543_1000022 3300021327 Bacteria 241930
91 Ga0228711_1000017 3300022739 Bacteria 121084
92 Ga0228710_1000005 3300022740 Bacteria 233531
93 Ga0209436_100058 3300025208 Bacteria 60755
94 Ga0209436_101354 3300025208 Bacteria 8660
95 Ga0209437_100058 3300025233 Bacteria 357279
96 Ga0209437_100060 3300025233 Bacteria 355034
97 Ga0207425_1000043 3300025245 Bacteria 208791
98 Ga0207425_1000436 3300025245 Bacteria 27617
99 Ga0207425_1002033 3300025245 Bacteria 7534
100 Ga0209677_100289 3300025253 Bacteria 33302
101 Ga0209148_1003810 3300025254 Bacteria 3949
102 Ga0209129_1000072 3300025258 Bacteria 208805
103 Ga0209129_1000128 3300025258 Bacteria 130420
104 Ga0209129_1000765 3300025258 Bacteria 20447
105 Ga0209129_1001667 3300025258 Bacteria 12027
106 Ga0209129_1004976 3300025258 Bacteria 4912
107 Ga0209129_1006922 3300025258 Bacteria 3510
108 Ga0209129_1006924 3300025258 Bacteria 3509
109 Ga0209233_1000137 3300025261 Bacteria 200314
110 Ga0209233_1000149 3300025261 Bacteria 181183
111 Ga0209233_1000160 3300025261 Bacteria 159035
112 Ga0209233_1013152 3300025261 Bacteria 2370
113 Ga0209565_1030534 3300025263 Bacteria 1052
114 Ga0209673_1000025 3300025273 Bacteria 404572
115 Ga0209673_1000125 3300025273 Bacteria 168465
116 Ga0209673_1000256 3300025273 Bacteria 100514
117 Ga0209673_1001756 3300025273 Bacteria 18064
118 Ga0209673_1003121 3300025273 Bacteria 10126
119 Ga0209673_1004623 3300025273 Bacteria 7285
120 Ga0209673_1037816 3300025273 Bacteria 1413
121 Ga0209673_1053543 3300025273 Bacteria 1052
122 Ga0209130_1000003 3300025284 Bacteria 677988
123 Ga0209130_1000017 3300025284 Bacteria 388431
124 Ga0209130_1000023 3300025284 Bacteria 359355
125 Ga0209675_1028676 3300025291 Bacteria 1350
126 Ga0209676_1012015 3300025292 Bacteria 3442
127 Ga0209676_1034027 3300025292 Bacteria 1510
128 Ga0209025_1000120 3300025294 Bacteria 208791
129 Ga0209025_1000153 3300025294 Bacteria 170548
130 Ga0209025_1000451 3300025294 Bacteria 80470
131 Ga0209025_1000537 3300025294 Bacteria 71838
132 Ga0209025_1000545 3300025294 Bacteria 70608
133 Ga0209025_1008140 3300025294 Bacteria 7612
134 Ga0209025_1009023 3300025294 Bacteria 7037
135 Ga0209025_1076920 3300025294 Bacteria 1153
136 Ga0209564_1000013 3300025295 Bacteria 775755
137 Ga0209564_1000259 3300025295 Bacteria 112570
138 Ga0209564_1000841 3300025295 Bacteria 41363
139 Ga0209564_1002367 3300025295 Bacteria 15158
140 Ga0209564_1002386 3300025295 Bacteria 15044
141 Ga0209564_1010644 3300025295 Bacteria 4209
142 Ga0209564_1020991 3300025295 Bacteria 2370
143 Ga0209758_1000111 3300025297 Bacteria 208790
144 Ga0209758_1000254 3300025297 Bacteria 107330
145 Ga0209758_1000592 3300025297 Bacteria 56476
146 Ga0209758_1000678 3300025297 Bacteria 50806
147 Ga0209758_1003028 3300025297 Bacteria 16025
148 Ga0209758_1004877 3300025297 Bacteria 10795
149 Ga0209758_1032268 3300025297 Bacteria 2130
150 Ga0209758_1038456 3300025297 Bacteria 1835
151 Ga0209050_1009447 3300025298 Bacteria 4989
152 Ga0209050_1015458 3300025298 Bacteria 3203
153 Ga0209256_1000211 3300025299 Bacteria 110131
154 Ga0209256_1000283 3300025299 Bacteria 89387
155 Ga0209256_1000669 3300025299 Bacteria 46351
156 Ga0209256_1000885 3300025299 Bacteria 36961
157 Ga0209256_1002050 3300025299 Bacteria 17868
158 Ga0209256_1009263 3300025299 Bacteria 4349
159 Ga0209256_1024647 3300025299 Bacteria 1767
160 Ga0209256_1038223 3300025299 Bacteria 1245
161 Ga0207426_1000006 3300025302 Bacteria 1025969
162 Ga0207426_1000011 3300025302 Bacteria 791203
163 Ga0207426_1000087 3300025302 Bacteria 288870
164 Ga0207426_1000208 3300025302 Bacteria 140385
165 Ga0207426_1000936 3300025302 Bacteria 29086
166 Ga0209051_1000176 3300025303 Bacteria 115875
167 Ga0209051_1003032 3300025303 Bacteria 11372
168 Ga0209051_1003066 3300025303 Bacteria 11293
169 Ga0209051_1021245 3300025303 Bacteria 2770
170 Ga0209051_1056082 3300025303 Bacteria 1274
171 Ga0209257_1004862 3300025304 Bacteria 9928
172 Ga0209257_1013370 3300025304 Bacteria 3660
173 Ga0207695_10000037 3300025913 Bacteria 476303
174 Ga0207671_10000080 3300025914 Bacteria 148567
175 Ga0207650_10000624 3300025925 Bacteria 28219
176 Ga0207644_10015740 3300025931 Bacteria 5082
177 Ga0207640_10319644 3300025981 Bacteria 1235
178 Ga0207702_10043016 3300026078 Bacteria 3791
179 Ga0207702_10045362 3300026078 Bacteria 3698
180 Ga0207698_10343433 3300026142 Bacteria 1407
181 Ga0209281_1000082 3300027111 Bacteria 257684
182 Ga0209281_1001180 3300027111 Bacteria 18042
183 Ga0209371_1002582 3300027312 Bacteria 9967
184 Ga0209282_1000006 3300027666 Bacteria 276998
185 Ga0268266_10097108 3300028379 Bacteria 2591
186 Ga0268266_10154083 3300028379 Bacteria 2074
187 Ga0268266_10265403 3300028379 Bacteria 1592
188 Ga0307515_10000017 3300028794 Bacteria 550465
189 Ga0307515_10005257 3300028794 Bacteria 26313
190 Ga0307515_10006504 3300028794 Bacteria 23375
191 Ga0268256_1003727 3300030500 Bacteria 6704
192 Ga0307513_10002736 3300031456 Bacteria 24255
193 Ga0307513_10004524 3300031456 Bacteria 18536
194 Ga0307408_100191993 3300031548 Bacteria 1646
195 Ga0307405_10001465 3300031731 Bacteria 9949
196 Ga0307410_10148222 3300031852 Bacteria 1744
197 Ga0307412_10001457 3300031911 Bacteria 13166
198 Ga0315914_1000003 3300031967 Bacteria 314370
199 Ga0315913_1000001 3300033430 Bacteria 284459
200 Ga0315915_1000008 3300033464 Bacteria 258517
201 Ga0395898_0076038 3300037466 Bacteria 3243
202 Ga0395901_0165628 3300038443 Bacteria 2321
203 Ga0439436_0002190 3300041404 Bacteria 5843
204 Ga0439466_0063380 3300041411 Bacteria 1186
205 Ga0439465_0005328 3300041413 Bacteria 4109
206 Ga0439465_0005625 3300041413 Bacteria 3992
207 Ga0439465_0006019 3300041413 Bacteria 3856
208 Ga0439465_0063530 3300041413 Bacteria 1227
209 Ga0439465_0066573 3300041413 Bacteria 1201
210 Ga0451807_0935891 3300041486 Bacteria 983
211 Ga0451839_0542176 3300041496 Bacteria 3127
212 Ga0451841_0577157 3300041498 Bacteria 3073
213 Ga0451845_0517278 3300041501 Bacteria 1796
214 Ga0451845_0608757 3300041501 Bacteria 1321
215 Ga0451851_0417130 3300041507 Bacteria 3124
216 Ga0451855_0274722 3300041511 Bacteria 803
217 Ga0451853_3019187 3300041512 Bacteria 1536
218 Ga0439431_0004203 3300041997 Bacteria 3158
219 Ga0439449_0009721 3300042007 Bacteria 3639
220 Ga0439449_0011947 3300042007 Bacteria 3264
221 Ga0439462_0002411 3300042015 Bacteria 4341
222 Ga0450910_003987 3300042147 Bacteria 1982
223 Ga0439434_0004579 3300042435 Bacteria 4047
224 Ga0450918_007282 3300042531 Bacteria 1961
225 Ga0466966_0108748 3300044684 Bacteria 1710
226 Ga0466963_0051153 3300044694 Bacteria 2737
227 Ga0466971_0067186 3300044719 Bacteria 1625
228 Ga0466970_0008960 3300044765 Bacteria 5046
229 Ga0466957_0121407 3300044842 Bacteria 1666
230 Ga0466958_0039723 3300045836 Bacteria 2827
231 Ga0495617_040351 3300046452 Bacteria 1561
232 Ga0495592_0231349 3300046454 Bacteria 1230
233 Ga0495629_0183097 3300046459 Bacteria 1451
234 Ga0495638_0000746 3300046460 Bacteria 34841
235 Ga0495650_0056795 3300046471 Bacteria 1587
236 Ga0495605_0001667 3300046474 Bacteria 14285
237 Ga0495585_0059643 3300046492 Bacteria 2102
238 Ga0495607_0029078 3300046501 Bacteria 3404
239 Ga0495607_0030837 3300046501 Bacteria 3287
240 Ga0495583_0014903 3300046506 Bacteria 4256
241 Ga0495606_0001297 3300046507 Bacteria 34485
242 Ga0495606_0037171 3300046507 Bacteria 3308
243 Ga0495610_0002186 3300046512 Bacteria 16597
244 Ga0495616_0009440 3300046513 Bacteria 5706
245 Ga0495618_0069806 3300046514 Bacteria 2234
246 Ga0495620_0022072 3300046515 Bacteria 3075
247 Ga0495620_0027186 3300046515 Bacteria 2680
248 Ga0495631_0000518 3300046518 Bacteria 25896
249 Ga0495632_0001449 3300046519 Bacteria 19723
250 Ga0495632_0006976 3300046519 Bacteria 7171
251 Ga0495632_0016788 3300046519 Bacteria 4060
252 Ga0495643_0005454 3300046522 Bacteria 8602
253 Ga0495643_0009985 3300046522 Bacteria 5862
254 Ga0495643_0058031 3300046522 Bacteria 2061
255 Ga0495648_0031474 3300046524 Bacteria 3492
256 Ga0495648_0153543 3300046524 Bacteria 1198
257 Ga0495652_0152990 3300046529 Bacteria 1800
258 Ga0495654_0086295 3300046530 Bacteria 1463
259 Ga0495587_0179067 3300046536 Bacteria 1203
260 Ga0495609_0009963 3300046538 Bacteria 4577
261 Ga0495609_0040304 3300046538 Bacteria 2102
262 Ga0495597_0056838 3300046542 Bacteria 1713
263 Ga0495622_0034388 3300046557 Bacteria 2364
264 Ga0495633_0023315 3300046558 Bacteria 3067
265 Ga0495633_0052680 3300046558 Bacteria 1916
266 Ga0495656_0014559 3300046615 Bacteria 2951
267 Ga0495656_0043844 3300046615 Bacteria 1880
268 Ga0495668_0004830 3300046616 Bacteria 9377
269 Ga0495611_0005153 3300046648 Bacteria 5603
270 Ga0495611_0019043 3300046648 Bacteria 2948
271 Ga0495625_0004688 3300046660 Bacteria 12835
272 Ga0495625_0036128 3300046660 Bacteria 3634
273 Ga0495625_0046542 3300046660 Bacteria 3130
274 Ga0495625_0051062 3300046660 Bacteria 2966
275 Ga0495625_0140658 3300046660 Bacteria 1628
276 Ga0495661_0076663 3300046665 Bacteria 1939
277 Ga0495588_0070613 3300046674 Bacteria 1815
278 Ga0495624_0079396 3300046690 Bacteria 2035
279 Ga0495670_0010277 3300046691 Bacteria 4599
280 Ga0495670_0127276 3300046691 Bacteria 1326
281 Ga0495671_0027098 3300046692 Bacteria 2962
282 Ga0495660_0048243 3300046810 Bacteria 2329
283 Ga0495660_0049810 3300046810 Bacteria 2284
284 Ga0495604_0037338 3300047317 Bacteria 3826
285 Ga0495636_0031727 3300047318 Bacteria 2167
286 Ga0495687_029489 3300047443 Bacteria 2538
287 Ga0495687_074926 3300047443 Bacteria 1344
288 Ga0495677_0152053 3300047445 Bacteria 891
289 Ga0495673_0146266 3300047469 Bacteria 917
290 Ga0495681_0035511 3300047470 Bacteria 2474
291 Ga0495681_0065139 3300047470 Bacteria 1667
292 Ga0495681_0094327 3300047470 Bacteria 1317
293 Ga0495686_0000418 3300047472 Bacteria 67274
294 Ga0495686_0002364 3300047472 Bacteria 17981
295 Ga0495686_0010867 3300047472 Bacteria 6447
296 Ga0495686_0057962 3300047472 Bacteria 2416
297 Ga0495686_0103574 3300047472 Bacteria 1714
298 Ga0496100_0003974 3300048903 Bacteria 7772
299 Ga0496101_0044657 3300048904 Bacteria 3171
300 Ga0496101_0257032 3300048904 Bacteria 1362
301 Ga0496102_0008867 3300048905 Bacteria 8630
302 Ga0496103_0010981 3300048906 Bacteria 5360
303 Ga0496103_0072928 3300048906 Bacteria 2151
304 Ga0496104_0340241 3300048907 Bacteria 1413
305 Ga0496105_0122365 3300048908 Bacteria 2145
306 Ga0496106_0052791 3300048909 Bacteria 3068
307 Ga0496106_0055929 3300048909 Bacteria 2983
308 Ga0496113_0454510 3300048916 Bacteria 1029
309 Ga0496114_0086478 3300048917 Bacteria 2657
310 Ga0496116_0012735 3300048919 Bacteria 6841
311 Ga0496116_0012821 3300048919 Bacteria 6811
312 Ga0496116_0032068 3300048919 Bacteria 3750
313 Ga0496116_0180844 3300048919 Bacteria 1129
314 Ga0496116_0216259 3300048919 Bacteria 987
315 Ga0496117_0003887 3300048920 Bacteria 16943
316 Ga0496117_0005580 3300048920 Bacteria 13167
317 Ga0496117_0010882 3300048920 Bacteria 8206
318 Ga0496117_0073253 3300048920 Bacteria 2286
319 Ga0496117_0095863 3300048920 Bacteria 1894
320 Ga0496117_0109230 3300048920 Bacteria 1727
321 Ga0496118_0003614 3300048921 Bacteria 19207
322 Ga0496118_0004868 3300048921 Bacteria 15633
323 Ga0496118_0013710 3300048921 Bacteria 7647
324 Ga0496118_0036618 3300048921 Bacteria 3963
325 Ga0496118_0046256 3300048921 Bacteria 3388
326 Ga0496119_0046552 3300048922 Bacteria 2708
327 Ga0496119_0053932 3300048922 Bacteria 2451
328 Ga0496119_0104505 3300048922 Bacteria 1584
329 Ga0496120_0061450 3300048923 Bacteria 2096
330 Ga0496121_0005802 3300048924 Bacteria 15658
331 Ga0496121_0019161 3300048924 Bacteria 6857
332 Ga0496121_0057768 3300048924 Bacteria 3213
333 Ga0496121_0086372 3300048924 Bacteria 2465
334 Ga0496121_0293245 3300048924 Bacteria 1107
335 Ga0496121_0386265 3300048924 Bacteria 921
336 Ga0496122_0002474 3300048925 Bacteria 26122
337 Ga0496122_0004381 3300048925 Bacteria 17581
338 Ga0496122_0028667 3300048925 Bacteria 4716
339 Ga0496122_0034028 3300048925 Bacteria 4178
340 Ga0496122_0036119 3300048925 Bacteria 4004
341 Ga0496122_0088694 3300048925 Bacteria 2118
342 Ga0496122_0101019 3300048925 Bacteria 1928
343 Ga0496122_0113907 3300048925 Bacteria 1765
344 Ga0496123_0000839 3300048926 Bacteria 49128
345 Ga0496123_0007514 3300048926 Bacteria 10229
346 Ga0496123_0034193 3300048926 Bacteria 3645
347 Ga0496123_0040913 3300048926 Bacteria 3220
348 Ga0496123_0117119 3300048926 Bacteria 1507
349 Ga0496123_0124912 3300048926 Bacteria 1438
350 Ga0496123_0215421 3300048926 Bacteria 972
351 Ga0496124_0001743 3300048927 Bacteria 30475
352 Ga0496124_0005611 3300048927 Bacteria 14038
353 Ga0496124_0005719 3300048927 Bacteria 13853
354 Ga0496124_0010468 3300048927 Bacteria 9389
355 Ga0496124_0037267 3300048927 Bacteria 4231
356 Ga0496124_0082710 3300048927 Bacteria 2635
357 Ga0496124_0101101 3300048927 Bacteria 2336
358 Ga0496124_0135947 3300048927 Bacteria 1946
359 Ga0496124_0150465 3300048927 Bacteria 1826
360 Ga0496124_0411325 3300048927 Bacteria 935
361 Ga0496125_0002475 3300048928 Bacteria 23966
362 Ga0496125_0004711 3300048928 Bacteria 15545
363 Ga0496125_0011734 3300048928 Bacteria 8733
364 Ga0496125_0080363 3300048928 Bacteria 2495
365 Ga0496125_0131158 3300048928 Bacteria 1764
366 Ga0496126_0000188 3300048929 Bacteria 139625
367 Ga0496126_0008731 3300048929 Bacteria 10883
368 Ga0496126_0066328 3300048929 Bacteria 3227
369 Ga0496126_0260269 3300048929 Bacteria 1443
370 Ga0501031_0000202 3300049568 Bacteria 33947
371 Ga0501032_0000443 3300049569 Bacteria 33947
372 Ga0501032_0105637 3300049569 Bacteria 1865
373 Ga0501032_0275438 3300049569 Bacteria 1090
374 Ga0501033_0000097 3300049570 Bacteria 83228
375 Ga0501033_0010825 3300049570 Bacteria 6995
376 Ga0501034_0000186 3300049571 Bacteria 116500
377 Ga0501034_0011544 3300049571 Bacteria 9150
378 Ga0501034_0041553 3300049571 Bacteria 4653
379 Ga0501034_0135186 3300049571 Bacteria 2446
380 Ga0501036_0000002 3300049572 Bacteria 293106
381 Ga0501036_0146379 3300049572 Bacteria 1993
382 Ga0501036_0249412 3300049572 Bacteria 1488
383 Ga0501036_0345260 3300049572 Bacteria 1243
384 Ga0501037_0000443 3300049573 Bacteria 33927
385 Ga0501038_0000867 3300049574 Bacteria 26767
386 Ga0501038_0036305 3300049574 Bacteria 4326
387 Ga0501039_0000002 3300049575 Bacteria 375152
388 Ga0501039_0069810 3300049575 Bacteria 2729
389 Ga0501040_0001925 3300049576 Bacteria 13348
390 Ga0501040_0014483 3300049576 Bacteria 5197
391 Ga0501043_0000543 3300049579 Bacteria 33914
392 Ga0501043_0037844 3300049579 Bacteria 3795
393 Ga0501043_0078405 3300049579 Bacteria 2595
394 Ga0501043_0143718 3300049579 Bacteria 1868
395 Ga0501047_0002364 3300049581 Bacteria 18037
396 Ga0501047_0157248 3300049581 Bacteria 2146
397 Ga0501047_0168987 3300049581 Bacteria 2056
398 Ga0501047_0172428 3300049581 Bacteria 2032
399 Ga0501067_0146215 3300049583 Bacteria 1317
400 Ga0501068_0169680 3300049584 Bacteria 1377
401 Ga0501070_0009430 3300049586 Bacteria 8251
402 Ga0501070_0169394 3300049586 Bacteria 1799
403 Ga0501070_0269910 3300049586 Bacteria 1389
404 Ga0501073_0271248 3300049589 Bacteria 1171
405 Ga0501080_0069209 3300049742 Bacteria 3282
406 Ga0501083_0099443 3300049744 Bacteria 1918
407 Ga0501083_0199315 3300049744 Bacteria 1306
408 Ga0501035_0000100 3300049822 Bacteria 107321
409 Ga0501035_0038128 3300049822 Bacteria 4352
410 Ga0501044_0000002 3300049823 Bacteria 375152
411 Ga0501044_0036127 3300049823 Bacteria 5169
412 Ga0501044_0101205 3300049823 Bacteria 2899
413 Ga0501044_0150409 3300049823 Bacteria 2311
414 Ga0501045_0334474 3300049824 Bacteria 1127
415 nmdc:mga0yw44_19685_c1 3300050492 Bacteria 3727
416 Ga0500578_0093222 3300053086 Bacteria 1910
417 Ga0500643_026321 3300053087 Bacteria 1823
418 Ga0500646_0007652 3300053090 Bacteria 2761
419 Ga0500651_0243042 3300053093 Bacteria 1049
420 Ga0500650_0028901 3300053098 Bacteria 2507
421 Ga0500556_0023251 3300053104 Bacteria 2023
422 Ga0500557_000282 3300053105 Bacteria 6913
423 Ga0500560_070174 3300053107 Bacteria 1154
424 Ga0500562_002778 3300053108 Bacteria 4356
425 Ga0500569_016074 3300053109 Bacteria 1888
426 Ga0500594_0000635 3300053118 Bacteria 7500
427 Ga0500618_006727 3300053125 Bacteria 3347
428 Ga0500618_006924 3300053125 Bacteria 3280
429 Ga0500658_0000880 3300053134 Bacteria 12318
430 Ga0500658_0005307 3300053134 Bacteria 4790
431 Ga0500568_0000629 3300053139 Bacteria 25351
432 Ga0500568_0002233 3300053139 Bacteria 11604
433 Ga0500590_000127 3300053148 Bacteria 21175
434 Ga0500604_0017296 3300053151 Bacteria 1994
435 Ga0500616_0005719 3300053153 Bacteria 8370
436 Ga0500616_0110610 3300053153 Bacteria 1327
437 Ga0500620_000852 3300053155 Bacteria 5300
438 Ga0500622_0001672 3300053156 Bacteria 17312
439 Ga0500627_0032004 3300053158 Bacteria 2214
440 Ga0500633_0016986 3300053160 Bacteria 2125
441 Ga0500633_0051404 3300053160 Bacteria 1423
442 Ga0500636_0097124 3300053177 Bacteria 1680
443 Ga0500645_015656 3300053730 Bacteria 2400
444 Ga0501082_0056138 3300060353 Bacteria 3392
445 2501078086 2501025502 Bacteria 9641094
446 2509108047 2508501122 Bacteria 6292184
447 2509376774 2509276019 Bacteria 6802256
448 2509390175 2509276021 Bacteria 7634384
449 2509447535 2509276033 Bacteria 7180565
450 2510134359 2510065019 Bacteria 6903379
451 2510308320 2510065057 Bacteria 6649661
452 2510895792 2510461076 Bacteria 8618824
453 2511091957 2510917013 Bacteria 9951648
454 2511131929 2510917022 Bacteria 6504556
455 2511182654 2510917028 Bacteria 6185411
456 2511194915 2510917030 Bacteria 7460662
457 2511391278 2511231027 Bacteria 5013807
458 2511502503 2511231052 Bacteria 6974333
459 2512533878 2512047086 Bacteria 6850303
460 2512970367 2512875026 Bacteria 6861065
461 2513567521 2513237084 Bacteria 7231967
462 2513577857 2513237085 Bacteria 7695351
463 2513587465 2513237086 Bacteria 7265287
464 2513598404 2513237088 Bacteria 6927906
465 2513601431 2513237089 Bacteria 6553624
466 2513619558 2513237091 Bacteria 6900273
467 2513631996 2513237093 Bacteria 7545552
468 2513712530 2513237103 Bacteria 7647401
469 2513867916 2513237138 Bacteria 7368160
470 2513881809 2513237140 Bacteria 7076289
471 2513904953 2513237143 Bacteria 6664116
472 2513910648 2513237144 Bacteria 7530820
473 2513928093 2513237146 Bacteria 7166346
474 2513983629 2513237156 Bacteria 6402557
475 2513997574 2513237159 Bacteria 6810126
476 2514003122 2513237160 Bacteria 6650282
477 2514420214 2513237305 Bacteria 7293571
478 2514588972 2513237351 Bacteria 6968952
479 2515113530 2515075009 Bacteria 7288508
480 2515609292 2515154107 Bacteria 6795637
481 2515635243 2515154113 Bacteria 7807172
482 2515643850 2515154114 Bacteria 7848616
483 2515654938 2515154116 Bacteria 7552979
484 2515739884 2515154134 Bacteria 7220242
485 2516893878 2516653046 Bacteria 6989037
486 2517037142 2516653077 Bacteria 7555578
487 2517077483 2516653085 Bacteria 7346596
488 2517096249 2517093000 Bacteria 7412387
489 2517408107 2517287029 Bacteria 6905599
490 2517570595 2517487022 Bacteria 7227575
491 2520381948 2519899620 Bacteria 6499161
492 2524448298 2524023207 Bacteria 6813453
493 2524459012 2524023209 Bacteria 6679728
494 2530646387 2529292951 Bacteria 6916614
495 2535517230 2534681796 Bacteria 7146037
496 2551679615 2551306084 Bacteria 8942552
497 2551689446 2551306085 Bacteria 7347181
498 2551704732 2551306087 Bacteria 7351905
499 2551710591 2551306089 Bacteria 7162724
500 2551723158 2551306090 Bacteria 7953713
501 2551735560 2551306092 Bacteria 6992595
502 2551740098 2551306093 Bacteria 7064773
503 2558865869 2558860100 Bacteria 8458965
504 2585167553 2582581283 Bacteria 6030556
505 2585205102 2582581294 Bacteria 6626667
506 2585225255 2582581298 Bacteria 7315509
507 2585230680 2582581299 Bacteria 6518058
508 2585259115 2582581304 Bacteria 5831370
509 2585265780 2582581306 Bacteria 6450535
510 2585273969 2582581307 Bacteria 6597605
511 2585279430 2582581308 Bacteria 7413247
512 2585322910 2582581315 Bacteria 7318924
513 2585331078 2582581316 Bacteria 7774528
514 2585389027 2582581865 Bacteria 6644329
515 2585395173 2582581866 Bacteria 6859583
516 2585404602 2582581867 Bacteria 7184437
517 2585524910 2585427526 Bacteria 7258840
518 2585531086 2585427527 Bacteria 7273426
519 2585542783 2585427528 Bacteria 6842387
520 2585547811 2585427529 Bacteria 7395659
521 2585552993 2585427530 Bacteria 7383882
522 2585560420 2585427531 Bacteria 6992870
523 2585824861 2585427590 Bacteria 6824633
524 2585841425 2585427593 Bacteria 7141551
525 2585847703 2585427594 Bacteria 6180594
526 2585898614 2585427608 Bacteria 6544331
527 2585903798 2585427609 Bacteria 6667127
528 2587981083 2585428125 Bacteria 6662905
529 2597814374 2597489875 Bacteria 7010078
530 2599421102 2599185170 Bacteria 7295545
531 2600196076 2599185352 Bacteria 7228948
532 2616296660 2615840624 Bacteria 6557588
533 2616307003 2615840626 Bacteria 7921970
534 2616554616 2615840698 Bacteria 7319877
535 2617384883 2617270742 Bacteria 6808054
536 2643804384 2643221557 Bacteria 7184309
537 2644002914 2643221599 Bacteria 6292121
538 2644050103 2643221607 Bacteria 6314006
539 2644065155 2643221610 Bacteria 7480339
540 2644105446 2643221618 Bacteria 7717186
541 2644129083 2643221623 Bacteria 5239945
542 2644146449 2643221626 Bacteria 8069654
543 2644168758 2643221629 Bacteria 5850260
544 2644204837 2643221636 Bacteria 6583769
545 2644208696 2643221637 Bacteria 5345260
546 2644237894 2643221643 Bacteria 5749658
547 2644308197 2643221655 Bacteria 7722067
548 2644334021 2643221659 Bacteria 7890716
549 2644347307 2643221662 Bacteria 5851492
550 2644377564 2643221668 Bacteria 7306521
551 2644416827 2643221675 Bacteria 7473456
552 2644449867 2643221680 Bacteria 7473610
553 2644483024 2643221686 Bacteria 6310811
554 2644497692 2643221689 Bacteria 6042950
555 2644541618 2643221698 Bacteria 7756764
556 2644615479 2643221712 Bacteria 7729434
557 2644652226 2643221718 Bacteria 5345506
558 2644672780 2643221723 Bacteria 7095460
559 2644690001 2643221726 Bacteria 7455827
560 2644743308 2643221736 Bacteria 6608466
561 2671111861 2667528174 Bacteria 6435400
562 2719386834 2718217927 Bacteria 6972593
563 2719666574 2718217997 Bacteria 6740740
564 2720492994 2718218199 Bacteria 6740745
565 2720614470 2718218232 Bacteria 6720332
566 2720621246 2718218233 Bacteria 6662049
567 2720632572 2718218235 Bacteria 6630699
568 2720776294 2718218269 Bacteria 6906114
569 2721400557 2718218423 Bacteria 6438183
570 2723027886 2721755556 Bacteria 6745503
571 2723561514 2721755684 Bacteria 6859907
572 2723568144 2721755685 Bacteria 6704835
573 2723575730 2721755686 Bacteria 7343952
574 2724039370 2721755809 Bacteria 6438790
575 2724090901 2721755819 Bacteria 6906405
576 2724105409 2721755822 Bacteria 6726041
577 2724111232 2721755823 Bacteria 6752556
578 2725950239 2724679232 Bacteria 7646494
579 2730108822 2728369352 Bacteria 6745171
580 2738805420 2738541293 Bacteria 7065685
581 2739033235 2738541333 Bacteria 7106503
582 2765467210 2765235802 Bacteria 5618596
583 2766066279 2765235942 Bacteria 7445910
584 2770198806 2767802442 Bacteria 5747986
585 2776273014 2775506902 Bacteria 6208009
586 2776282143 2775506904 Bacteria 5954060
587 2778173383 2775507266 Bacteria 7392367
588 2792638784 2791355094 Bacteria 7011481
589 2793294020 2791355256 Bacteria 6798008
590 2793314305 2791355259 Bacteria 7254731
591 2793323790 2791355260 Bacteria 6598818
592 2793329696 2791355261 Bacteria 6661293
593 2793342297 2791355263 Bacteria 6872478
594 2793355317 2791355265 Bacteria 6539969
595 2793362967 2791355266 Bacteria 7116587
596 2793369879 2791355267 Bacteria 7222458
597 2802716724 2802428858 Bacteria 6636079
598 2802725535 2802428859 Bacteria 6667919
599 2802730373 2802428860 Bacteria 6525526
600 2802737656 2802428861 Bacteria 6534206
601 2802742955 2802428862 Bacteria 6633353
602 2802750379 2802428863 Bacteria 6410669
603 2805929534 2802429605 Bacteria 6875453
604 2805936838 2802429606 Bacteria 6346811
605 2806047523 2802429633 Bacteria 7341974
606 2806055127 2802429634 Bacteria 7083200
607 2806063063 2802429635 Bacteria 7650140
608 2806069798 2802429636 Bacteria 7597525
609 2806075727 2802429637 Bacteria 7067217
610 2819609927 2818991448 Bacteria 6772224
611 2819640037 2818991453 Bacteria 7181617
612 2838019937 2838016132 Bacteria 6577831
613 2838033238 2838029111 Bacteria 6603031
614 2838041465 2838035591 Bacteria 7166484
615 2838045609 2838042994 Bacteria 6046894
616 2838052747 2838048938 Bacteria 6044578
617 2838065004 2838061910 Bacteria 6794874
618 2838069729 2838068647 Bacteria 6208656
619 2838079678 2838074704 Bacteria 6785777
620 2838665857 2838661181 Bacteria 7385261
621 2838671765 2838668709 Bacteria 6671819
622 2838686639 2838686498 Bacteria 7807632
623 2838698026 2838694306 Bacteria 6853137
624 2838704444 2838701080 Bacteria 6669771
625 2838711141 2838707686 Bacteria 6619912
626 2838734881 2838729681 Bacteria 7400765
627 2838747496 2838742623 Bacteria 7396178
628 2839996428 2839993093 Bacteria 5512535
629 2840770364 2840764183 Bacteria 6358399
630 2841854468 2841851746 Bacteria 7532261
631 2841867387 2841864319 Bacteria 6742987
632 2842079316 2842077413 Bacteria 6508645
633 2842115578 2842110456 Bacteria 7656360
634 2842118173 2842118031 Bacteria 7033875
635 2842149662 2842146304 Bacteria 5957337
636 2842158513 2842156927 Bacteria 6894975
637 2842169043 2842163707 Bacteria 6916235
638 2842182127 2842180545 Bacteria 6888678
639 2842195635 2842192696 Bacteria 6147454
640 2842218360 2842217011 Bacteria 7497767
641 2842229873 2842229732 Bacteria 7475766
642 2842240087 2842237096 Bacteria 6620661
643 2842243762 2842243621 Bacteria 7421798
644 2842254171 2842250916 Bacteria 6579627
645 2842258153 2842257432 Bacteria 7401195
646 2842267656 2842264693 Bacteria 6472963
647 2842271823 2842271015 Bacteria 7807131
648 2842284406 2842278818 Bacteria 6340002
649 2842285192 2842285085 Bacteria 6011953
650 2842292978 2842291075 Bacteria 7076806
651 2842298364 2842298080 Bacteria 6123127
652 2842305434 2842304105 Bacteria 7023636
653 2842314158 2842311132 Bacteria 6616990
654 2842319961 2842317721 Bacteria 6793725
655 2842347643 2842341865 Bacteria 7003929
656 2842360376 2842357229 Bacteria 6485165
657 2842368705 2842363717 Bacteria 6844742
658 2842373660 2842370503 Bacteria 7038661
659 2842379375 2842377471 Bacteria 7140707
660 2842384684 2842384541 Bacteria 7057858
661 2842400587 2842395702 Bacteria 6780583
662 2842402550 2842402390 Bacteria 6681310
663 2842410079 2842409023 Bacteria 6687331
664 2842416727 2842415677 Bacteria 6596907
665 2842423343 2842422224 Bacteria 6239196
666 2842430300 2842428310 Bacteria 6767288
667 2842436888 2842434925 Bacteria 6502746
668 2842443270 2842441272 Bacteria 6769273
669 2842449135 2842447887 Bacteria 6754142
670 2842467172 2842462802 Bacteria 6588055
671 2842471242 2842469257 Bacteria 6752936
672 2842480097 2842475841 Bacteria 6603183
673 2842483709 2842482326 Bacteria 7212537
674 2842493499 2842489311 Bacteria 6620893
675 2842497649 2842495871 Bacteria 6820686
676 2842505118 2842502639 Bacteria 6604161
677 2842510380 2842509118 Bacteria 6850950
678 2842522183 2842521101 Bacteria 6569494
679 2842875729 2842871566 Bacteria 4827117
680 2844166360 2844163670 Bacteria 7266046
681 2844457937 2844454524 Bacteria 7952546
682 2847419761 2847417321 Bacteria 6913799
683 2848994778 2848992105 Bacteria 6810864
684 2850081776 2850079185 Bacteria 6848280
685 2852390795 2852387548 Bacteria 8025568
686 2855826604 2855825444 Bacteria 6785811
687 2855841994 2855839649 Bacteria 7135830
688 2855877277 2855872281 Bacteria 6964271
689 2857517014 2857516855 Bacteria 7787325
690 2858802668 2858800743 Bacteria 6603254
691 2871454819 2871451962 Bacteria 7336357
692 2882635620 2882632389 Bacteria 8154593
693 2889792368 2889790730 Bacteria 5689708
694 2889916997 2889914905 Bacteria 5702301
695 2891373701 2891373044 Bacteria 5202277
696 2894657084 2894652903 Bacteria 4587256
697 2896391211 2896384573 Bacteria 7700774
698 2904582563 2904578770 Bacteria 5302906
699 2915981135 2915980308 Bacteria 6624279
700 2915993233 2915986958 Bacteria 6739310
701 2915999039 2915993759 Bacteria 7016183
702 2916005045 2916000859 Bacteria 6865702
703 2916012711 2916007675 Bacteria 6898660
704 2916018961 2916014648 Bacteria 6946486
705 2916023016 2916021584 Bacteria 6854472
706 2916033855 2916028427 Bacteria 6748433
707 2916039364 2916035215 Bacteria 6755766
708 2916044373 2916041962 Bacteria 6820487
709 2916050421 2916048683 Bacteria 6543552
710 2916060333 2916055098 Bacteria 6758838
711 2916063323 2916061851 Bacteria 6737736
712 2916075751 2916068649 Bacteria 6943657
713 2916080471 2916076590 Bacteria 6596108
714 2919105589 2919100787 Bacteria 7710546
715 2919124043 2919119836 Bacteria 5208557
716 2919410361 2919408235 Bacteria 6149349
717 2919679727 2919679072 Bacteria 4629602
718 2920761186 2920760137 Bacteria 7427611
719 2920825622 2920822456 Bacteria 6897201
720 2921205763 2921201388 Bacteria 6926299
721 2921212556 2921208531 Bacteria 6745326
722 2921243988 2921237296 Bacteria 6876710
723 2921244487 2921244191 Bacteria 6568419
724 2921251644 2921250672 Bacteria 6677771
725 2921262655 2921257292 Bacteria 6808382
726 2921269413 2921263974 Bacteria 6864552
727 2921287130 2921282425 Bacteria 6826397
728 2921294122 2921289301 Bacteria 7316391
729 2921299564 2921296804 Bacteria 7176999
730 2923562262 2923556063 Bacteria 6793593
731 2924150320 2924144063 Bacteria 6883928
732 2924156528 2924150972 Bacteria 7169444
733 2924159883 2924158325 Bacteria 7188855
734 2924172253 2924165586 Bacteria 7260590
735 2924178431 2924172951 Bacteria 6749356
736 2924183502 2924179722 Bacteria 6843264
737 2924193087 2924186466 Bacteria 6876637
738 2924196437 2924193448 Bacteria 6955718
739 2924203887 2924200457 Bacteria 6757188
740 2924210798 2924207177 Bacteria 6917007
741 2924218396 2924214083 Bacteria 7080103
742 2924225632 2924221636 Bacteria 7113495
743 2924233274 2924228884 Bacteria 6633132
744 2924766773 2924762789 Bacteria 6561353
745 2928524837 2928521798 Bacteria 4960112
746 2933571241 2933570622 Bacteria 7023390
747 2933591993 2933586486 Bacteria 7667493
748 2933600536 2933599457 Bacteria 5858799
749 2935896590 2935894831 Bacteria 6620579
750 2935901485 2935901341 Bacteria 7341747
751 2936371628 2936367885 Bacteria 7324495
752 2936377001 2936375103 Bacteria 6652732
753 2936383409 2936381700 Bacteria 7006523
754 2937002755 2936996657 Bacteria 6298727
755 2937005319 2937002841 Bacteria 6934057
756 2937012854 2937009748 Bacteria 6746052
757 2937021880 2937016420 Bacteria 6782579
758 2937027330 2937023124 Bacteria 6815156
759 2937035626 2937029754 Bacteria 6424026
760 2937039659 2937036028 Bacteria 6846469
761 2937048470 2937042894 Bacteria 6741576
762 2937055575 2937049772 Bacteria 6757901
763 2937063786 2937056579 Bacteria 7107896
764 2937068700 2937063883 Bacteria 7199456
765 2937075923 2937071275 Bacteria 6984483
766 2937080688 2937078374 Bacteria 6610289
767 2937088885 2937084907 Bacteria 6618516
768 2937097441 2937091812 Bacteria 6979387
769 2937101156 2937098957 Bacteria 7249374
770 2937110207 2937106411 Bacteria 6947143
771 2937117687 2937113482 Bacteria 6505872
772 2937124520 2937119839 Bacteria 6597547
773 2937132284 2937126314 Bacteria 6771275
774 2941504612 2941499720 Bacteria 7599444
775 2954011203 2954011201 Bacteria 4762601
776 2957380699 2957375807 Bacteria 6425588
777 2957387273 2957382221 Bacteria 6737050
778 2957389513 2957388812 Bacteria 6778072
779 2957397247 2957395598 Bacteria 6822399
780 2957408310 2957402308 Bacteria 6741770
781 2957412934 2957408893 Bacteria 6558585
782 2957418932 2957415311 Bacteria 6991633
783 2957426302 2957422303 Bacteria 7172205
784 2957435828 2957430029 Bacteria 7022557
785 2957441148 2957437181 Bacteria 6568994
786 2957450232 2957443900 Bacteria 6869977
787 2957455769 2957450854 Bacteria 6765715
788 2957460461 2957457609 Bacteria 6967680
789 2957468809 2957464669 Bacteria 6568877
790 2957476639 2957471148 Bacteria 6797643
791 2957483159 2957478035 Bacteria 6756658
792 2957489189 2957484790 Bacteria 6703082
793 2957495143 2957491536 Bacteria 6695180
794 2957501681 2957498199 Bacteria 7126688
795 2957512313 2957505466 Bacteria 7253085
796 2960584875 2960584000 Bacteria 6864594
797 2960591801 2960591022 Bacteria 6622873
798 2960602116 2960597568 Bacteria 6550735
799 2960610261 2960603979 Bacteria 6898737
800 2960613109 2960610863 Bacteria 6691244
801 2960617986 2960617483 Bacteria 6727748
802 2960629770 2960624210 Bacteria 6875384
803 2960634002 2960631154 Bacteria 6732508
804 2960638332 2960637947 Bacteria 7296468
805 2960651103 2960645483 Bacteria 7211087
806 2960655048 2960652885 Bacteria 7083688
807 2960667080 2960660292 Bacteria 7041660
808 2960670716 2960667422 Bacteria 6763020
809 2960680535 2960674078 Bacteria 6609048
810 2960680815 2960680706 Bacteria 6624464
811 2960688193 2960687367 Bacteria 6535474
812 2960699591 2960693952 Bacteria 6749742
813 2964618167 2964615318 Bacteria 6809089
814 2964628044 2964621998 Bacteria 6834995
815 2964634216 2964628898 Bacteria 7083044
816 2964639153 2964636051 Bacteria 7091832
817 2964646239 2964643177 Bacteria 6820887
818 2964651258 2964649959 Bacteria 6675118
819 2964656951 2964656573 Bacteria 7100150
820 2964667675 2964663802 Bacteria 7019362
821 2964676580 2964670856 Bacteria 6851364
822 2964682675 2964678106 Bacteria 6792020
823 2964689230 2964685014 Bacteria 6839111
824 2964694794 2964691889 Bacteria 6802758
825 2964704512 2964698721 Bacteria 6765331
826 2964706509 2964705432 Bacteria 7114648
827 2964714774 2964712639 Bacteria 6695970
828 2964725795 2964719344 Bacteria 7286602
829 2967666776 2967664464 Bacteria 6948836
830 2967677774 2967671571 Bacteria 7021409
831 2967685813 2967678726 Bacteria 7264382
832 2967690051 2967686174 Bacteria 6678622
833 2967698648 2967693043 Bacteria 6804451
834 2967711430 2967706974 Bacteria 7186053
835 2967727231 2967721400 Bacteria 7073753
836 2967734117 2967728569 Bacteria 6641507
837 2967739853 2967735183 Bacteria 6827012
838 2967745101 2967742019 Bacteria 6794534
839 2967754213 2967748971 Bacteria 6733771
840 2967759661 2967755722 Bacteria 6814706
841 2967768454 2967762386 Bacteria 6923502
842 2967772692 2967769361 Bacteria 6587838
843 2967779401 2967775926 Bacteria 6738189
844 2970024328 2970019648 Bacteria 7072033
845 2970027593 2970026789 Bacteria 6785236
846 2970035971 2970033650 Bacteria 7118744
847 2970045211 2970040964 Bacteria 6731123
848 2970051475 2970047711 Bacteria 7088379
849 2970056215 2970054988 Bacteria 6611507
850 2970065490 2970061556 Bacteria 7099761
851 2970070980 2970068827 Bacteria 7123112
852 2970079410 2970076120 Bacteria 6697332
853 2970084621 2970082768 Bacteria 6183754
854 2970094322 2970088815 Bacteria 6933825
855 2970099960 2970095765 Bacteria 6936963
856 2970103978 2970102677 Bacteria 6812532
857 2970111906 2970109326 Bacteria 6863976
858 2970120548 2970116247 Bacteria 6501857
859 2970126320 2970122695 Bacteria 6625855
860 2970134686 2970129317 Bacteria 6806560
861 2970141774 2970136068 Bacteria 7207982
862 2970147122 2970143518 Bacteria 6446480
863 2970152445 2970149975 Bacteria 6779706
864 2970162254 2970156795 Bacteria 7168044
865 2970168264 2970164137 Bacteria 6861252
866 2970175941 2970170962 Bacteria 6876229
867 2970181116 2970177841 Bacteria 6768001
868 2970186233 2970184632 Bacteria 7054431
869 2970196160 2970191845 Bacteria 7032787
870 2970530670 2970524798 Bacteria 6840927
871 2977523297 2977516862 Bacteria 6940108
872 2977528092 2977523885 Bacteria 6960446
873 2977536404 2977530762 Bacteria 6951399
874 2977543348 2977537788 Bacteria 6929320
875 2977551745 2977544691 Bacteria 6875412
876 2977553014 2977551784 Bacteria 7125765
877 2977564147 2977558990 Bacteria 6863948
878 2977568810 2977565890 Bacteria 6901543
879 2977574098 2977572785 Bacteria 6763888
880 2977585956 2977579622 Bacteria 6772100
881 2977832025 2977828996 Bacteria 7007971
882 2987668885 2987666974 Bacteria 6509233
883 2989350178 2989349275 Bacteria 6349068
884 2989773304 2989771324 Bacteria 5605128
885 2996310623 2996310559 Bacteria 6357320
886 2996341078 2996336353 Bacteria 5511628
887 2996892532 2996887358 Bacteria 5795980
888 2996898046 2996893221 Bacteria 5823108
889 3002145395 3002141150 Bacteria 5254435
890 3003934644 3003930520 Bacteria 5667563
891 3005418817 3005416602 Bacteria 7064308
892 3005448824 3005445848 Bacteria 6906074
893 3005455049 3005452660 Bacteria 5889319
894 639649574 639633055 Bacteria 7751309
895 643826655 643692032 Bacteria 6891900
896 648739492 648276728 Bacteria 6968865
897 8003994430 8003992118 Bacteria 7266902
898 8004002132 8003999396 Bacteria 7063185
899 8005264841 8005258706 Bacteria 6184835
900 8005281645 8005275841 Bacteria 6929066
901 8005284393 8005282627 Bacteria 6675747
902 8005289650 8005289223 Bacteria 6634003
903 8005303553 8005301065 Bacteria 6614431
904 8005314069 8005307578 Bacteria 7395396
905 8005318291 8005314921 Bacteria 7072929
906 8005327059 8005321885 Bacteria 5795980
907 8005382689 8005376324 Bacteria 6590079
908 8005384651 8005382845 Bacteria 6732062
909 8005395679 8005395548 Bacteria 6806915
910 8005433915 8005430974 Bacteria 6689030
911 8005464215 8005460587 Bacteria 7157962
912 8005488826 8005484373 Bacteria 6297373
913 8005501319 8005497431 Bacteria 6477605
914 8005546050 8005542996 Bacteria 7077758
915 8005561628 8005556819 Bacteria 6908598
916 8005568403 8005563573 Bacteria 7153261
917 8005573055 8005570704 Bacteria 6957481
918 8005622681 8005619151 Bacteria 7030230
919 8005630198 8005626139 Bacteria 6534237
920 8005645797 8005645114 Bacteria 6950293
921 8005672738 8005668836 Bacteria 6953162
922 8005682520 8005682033 Bacteria 6726518
923 8005691669 8005688590 Bacteria 6610080
924 8005696799 8005695170 Bacteria 6912330
925 8018127560 8018127388 Bacteria 7351159
926 8018164157 8018163183 Bacteria 7277977
927 8018178951 8018176218 Bacteria 6896178
928 8023682760 8023680758 Bacteria 7729763
929 8024486116 8024479707 Bacteria 6954785
930 8024488426 8024486573 Bacteria 6540512
931 8024501194 8024501048 Bacteria 6427847
932 8046772641 8046767195 Bacteria 7547379
933 8054561875 8054558443 Bacteria 5204801
934 8056377012 8056375014 Bacteria 7006639
935 8056387333 8056382006 Bacteria 6408074
936 8057576898 8057575449 Bacteria 7367519
937 8057881930 8057874678 Bacteria 7494653
938 Ga0207639_10274169
939 JGI24740J21852_10004555
940 JGI25162J39368_1000149
941 JGI25162J39368_1000211
942 JGI25152J39213_1000899
943 JGI25152J39213_1003034
944 JGI25159J45721_1000008
945 JGI25159J45721_1006352
946 JGI25151J46595_10000027
947 JGI25151J46595_10001211
948 JGI25151J46595_10008331
949 JGI25151J46595_10014542
950 JGI25151J46595_10022311
951 JGI25165J46597_1000938
952 JGI25165J46597_1001280
953 JGI25165J46597_1004226
954 JGI25153J46596_10000608
955 JGI25153J46596_10003461
956 JGI25153J46596_10007133
957 rootL2_10007936
958 rootH1_10025853
959 rootH1_10025854
960 rootH1_10148901
961 JGI25160J50197_1000001
962 JGI25160J50197_1000033
963 JGI25160J50197_1001321
964 JGI25160J50197_1001492
965 JGI25161J50226_1000001
966 JGI25161J50226_1000163
967 JGI25161J50226_1002090
968 Ga0055526_1001871
969 Ga0055526_1002020
970 Ga0055526_1002721
971 Ga0055526_1025387
972 Ga0055524_1001345
973 Ga0055524_1012228
974 Ga0055524_1023782
975 Ga0055524_1043633
976 Ga0055528_1000247
977 Ga0055528_1003198
978 Ga0055528_1008999
979 Ga0055528_1026883
980 Ga0055540_1000607
981 Ga0055540_1001828
982 Ga0055531_10030140
983 Ga0055543_1000007
984 Ga0055543_1000026
985 Ga0055543_1000104
986 Ga0055543_1000108
987 Ga0065165_1000008
988 Ga0065165_1000178
989 Ga0065165_1010050
990 Ga0065165_1033708
991 Ga0070670_100001446
992 Ga0070668_100483315
993 Ga0070665_100146523
994 Ga0070665_100169482
995 Ga0070665_100326144
996 Ga0068855_100100926
997 Ga0068856_100039412
998 Ga0068856_100053210
999 Ga0068852_100312888
1000 Ga0075365_10002133
1001 Ga0075365_10083738
1002 Ga0075365_10215109
1003 Ga0075363_100127193
1004 Ga0075362_10007089
1005 Ga0075367_10002388
1006 Ga0075369_10001117
1007 Ga0075369_10097713
1008 Ga0075370_10034712
1009 Ga0079104_1005065
1010 Ga0105244_10189625
1011 Ga0105240_10000014
1012 Ga0105237_10001161
1013 Ga0105238_10566216
1014 Ga0123341_1000018
1015 Ga0123341_1078856
1016 Ga0123341_1090639
1017 Ga0123342_1009978
1018 Ga0123342_1038664
1019 Ga0105239_10005301
1020 Ga0157373_10123453
1021 Ga0157370_10000015
1022 Ga0171463_1007
1023 Ga0182008_10060340
1024 Ga0182007_10000385
1025 Ga0183363_1078
1026 Ga0214542_1015589
1027 Ga0214543_1000022
1028 Ga0228711_1000017
1029 Ga0228710_1000005
1030 Ga0209436_100058
1031 Ga0209436_101354
1032 Ga0209437_100058
1033 Ga0209437_100060
1034 Ga0207425_1000043
1035 Ga0207425_1000436
1036 Ga0207425_1002033
1037 Ga0209677_100289
1038 Ga0209148_1003810
1039 Ga0209129_1000072
1040 Ga0209129_1000128
1041 Ga0209129_1000765
1042 Ga0209129_1001667
1043 Ga0209129_1004976
1044 Ga0209129_1006922
1045 Ga0209129_1006924
1046 Ga0209233_1000137
1047 Ga0209233_1000149
1048 Ga0209233_1000160
1049 Ga0209233_1013152
1050 Ga0209565_1030534
1051 Ga0209673_1000025
1052 Ga0209673_1000125
1053 Ga0209673_1000256
1054 Ga0209673_1001756
1055 Ga0209673_1003121
1056 Ga0209673_1004623
1057 Ga0209673_1037816
1058 Ga0209673_1053543
1059 Ga0209130_1000003
1060 Ga0209130_1000017
1061 Ga0209130_1000023
1062 Ga0209675_1028676
1063 Ga0209676_1012015
1064 Ga0209676_1034027
1065 Ga0209025_1000120
1066 Ga0209025_1000153
1067 Ga0209025_1000451
1068 Ga0209025_1000537
1069 Ga0209025_1000545
1070 Ga0209025_1008140
1071 Ga0209025_1009023
1072 Ga0209025_1076920
1073 Ga0209564_1000013
1074 Ga0209564_1000259
1075 Ga0209564_1000841
1076 Ga0209564_1002367
1077 Ga0209564_1002386
1078 Ga0209564_1010644
1079 Ga0209564_1020991
1080 Ga0209758_1000111
1081 Ga0209758_1000254
1082 Ga0209758_1000592
1083 Ga0209758_1000678
1084 Ga0209758_1003028
1085 Ga0209758_1004877
1086 Ga0209758_1032268
1087 Ga0209758_1038456
1088 Ga0209050_1009447
1089 Ga0209050_1015458
1090 Ga0209256_1000211
1091 Ga0209256_1000283
1092 Ga0209256_1000669
1093 Ga0209256_1000885
1094 Ga0209256_1002050
1095 Ga0209256_1009263
1096 Ga0209256_1024647
1097 Ga0209256_1038223
1098 Ga0207426_1000006
1099 Ga0207426_1000011
1100 Ga0207426_1000087
1101 Ga0207426_1000208
1102 Ga0207426_1000936
1103 Ga0209051_1000176
1104 Ga0209051_1003032
1105 Ga0209051_1003066
1106 Ga0209051_1021245
1107 Ga0209051_1056082
1108 Ga0209257_1004862
1109 Ga0209257_1013370
1110 Ga0207695_10000037
1111 Ga0207671_10000080
1112 Ga0207650_10000624
1113 Ga0207644_10015740
1114 Ga0207640_10319644
1115 Ga0207702_10043016
1116 Ga0207702_10045362
1117 Ga0207698_10343433
1118 Ga0209281_1000082
1119 Ga0209281_1001180
1120 Ga0209371_1002582
1121 Ga0209282_1000006
1122 Ga0268266_10097108
1123 Ga0268266_10154083
1124 Ga0268266_10265403
1125 Ga0307515_10000017
1126 Ga0307515_10005257
1127 Ga0307515_10006504
1128 Ga0268256_1003727
1129 Ga0307513_10002736
1130 Ga0307513_10004524
1131 Ga0307408_100191993
1132 Ga0307405_10001465
1133 Ga0307410_10148222
1134 Ga0307412_10001457
1135 Ga0315914_1000003
1136 Ga0315913_1000001
1137 Ga0315915_1000008
1138 Ga0395898_0076038
1139 Ga0395901_0165628
1140 Ga0439436_0002190
1141 Ga0439466_0063380
1142 Ga0439465_0005328
1143 Ga0439465_0005625
1144 Ga0439465_0006019
1145 Ga0439465_0063530
1146 Ga0439465_0066573
1147 Ga0451807_0935891
1148 Ga0451839_0542176
1149 Ga0451841_0577157
1150 Ga0451845_0517278
1151 Ga0451845_0608757
1152 Ga0451851_0417130
1153 Ga0451855_0274722
1154 Ga0451853_3019187
1155 Ga0439431_0004203
1156 Ga0439449_0009721
1157 Ga0439449_0011947
1158 Ga0439462_0002411
1159 Ga0450910_003987
1160 Ga0439434_0004579
1161 Ga0450918_007282
1162 Ga0466966_0108748
1163 Ga0466963_0051153
1164 Ga0466971_0067186
1165 Ga0466970_0008960
1166 Ga0466957_0121407
1167 Ga0466958_0039723
1168 Ga0495617_040351
1169 Ga0495592_0231349
1170 Ga0495629_0183097
1171 Ga0495638_0000746
1172 Ga0495650_0056795
1173 Ga0495605_0001667
1174 Ga0495585_0059643
1175 Ga0495607_0029078
1176 Ga0495607_0030837
1177 Ga0495583_0014903
1178 Ga0495606_0001297
1179 Ga0495606_0037171
1180 Ga0495610_0002186
1181 Ga0495616_0009440
1182 Ga0495618_0069806
1183 Ga0495620_0022072
1184 Ga0495620_0027186
1185 Ga0495631_0000518
1186 Ga0495632_0001449
1187 Ga0495632_0006976
1188 Ga0495632_0016788
1189 Ga0495643_0005454
1190 Ga0495643_0009985
1191 Ga0495643_0058031
1192 Ga0495648_0031474
1193 Ga0495648_0153543
1194 Ga0495652_0152990
1195 Ga0495654_0086295
1196 Ga0495587_0179067
1197 Ga0495609_0009963
1198 Ga0495609_0040304
1199 Ga0495597_0056838
1200 Ga0495622_0034388
1201 Ga0495633_0023315
1202 Ga0495633_0052680
1203 Ga0495656_0014559
1204 Ga0495656_0043844
1205 Ga0495668_0004830
1206 Ga0495611_0005153
1207 Ga0495611_0019043
1208 Ga0495625_0004688
1209 Ga0495625_0036128
1210 Ga0495625_0046542
1211 Ga0495625_0051062
1212 Ga0495625_0140658
1213 Ga0495661_0076663
1214 Ga0495588_0070613
1215 Ga0495624_0079396
1216 Ga0495670_0010277
1217 Ga0495670_0127276
1218 Ga0495671_0027098
1219 Ga0495660_0048243
1220 Ga0495660_0049810
1221 Ga0495604_0037338
1222 Ga0495636_0031727
1223 Ga0495687_029489
1224 Ga0495687_074926
1225 Ga0495677_0152053
1226 Ga0495673_0146266
1227 Ga0495681_0035511
1228 Ga0495681_0065139
1229 Ga0495681_0094327
1230 Ga0495686_0000418
1231 Ga0495686_0002364
1232 Ga0495686_0010867
1233 Ga0495686_0057962
1234 Ga0495686_0103574
1235 Ga0496100_0003974
1236 Ga0496101_0044657
1237 Ga0496101_0257032
1238 Ga0496102_0008867
1239 Ga0496103_0010981
1240 Ga0496103_0072928
1241 Ga0496104_0340241
1242 Ga0496105_0122365
1243 Ga0496106_0052791
1244 Ga0496106_0055929
1245 Ga0496113_0454510
1246 Ga0496114_0086478
1247 Ga0496116_0012735
1248 Ga0496116_0012821
1249 Ga0496116_0032068
1250 Ga0496116_0180844
1251 Ga0496116_0216259
1252 Ga0496117_0003887
1253 Ga0496117_0005580
1254 Ga0496117_0010882
1255 Ga0496117_0073253
1256 Ga0496117_0095863
1257 Ga0496117_0109230
1258 Ga0496118_0003614
1259 Ga0496118_0004868
1260 Ga0496118_0013710
1261 Ga0496118_0036618
1262 Ga0496118_0046256
1263 Ga0496119_0046552
1264 Ga0496119_0053932
1265 Ga0496119_0104505
1266 Ga0496120_0061450
1267 Ga0496121_0005802
1268 Ga0496121_0019161
1269 Ga0496121_0057768
1270 Ga0496121_0086372
1271 Ga0496121_0293245
1272 Ga0496121_0386265
1273 Ga0496122_0002474
1274 Ga0496122_0004381
1275 Ga0496122_0028667
1276 Ga0496122_0034028
1277 Ga0496122_0036119
1278 Ga0496122_0088694
1279 Ga0496122_0101019
1280 Ga0496122_0113907
1281 Ga0496123_0000839
1282 Ga0496123_0007514
1283 Ga0496123_0034193
1284 Ga0496123_0040913
1285 Ga0496123_0117119
1286 Ga0496123_0124912
1287 Ga0496123_0215421
1288 Ga0496124_0001743
1289 Ga0496124_0005611
1290 Ga0496124_0005719
1291 Ga0496124_0010468
1292 Ga0496124_0037267
1293 Ga0496124_0082710
1294 Ga0496124_0101101
1295 Ga0496124_0135947
1296 Ga0496124_0150465
1297 Ga0496124_0411325
1298 Ga0496125_0002475
1299 Ga0496125_0004711
1300 Ga0496125_0011734
1301 Ga0496125_0080363
1302 Ga0496125_0131158
1303 Ga0496126_0000188
1304 Ga0496126_0008731
1305 Ga0496126_0066328
1306 Ga0496126_0260269
1307 Ga0501031_0000202
1308 Ga0501032_0000443
1309 Ga0501032_0105637
1310 Ga0501032_0275438
1311 Ga0501033_0000097
1312 Ga0501033_0010825
1313 Ga0501034_0000186
1314 Ga0501034_0011544
1315 Ga0501034_0041553
1316 Ga0501034_0135186
1317 Ga0501036_0000002
1318 Ga0501036_0146379
1319 Ga0501036_0249412
1320 Ga0501036_0345260
1321 Ga0501037_0000443
1322 Ga0501038_0000867
1323 Ga0501038_0036305
1324 Ga0501039_0000002
1325 Ga0501039_0069810
1326 Ga0501040_0001925
1327 Ga0501040_0014483
1328 Ga0501043_0000543
1329 Ga0501043_0037844
1330 Ga0501043_0078405
1331 Ga0501043_0143718
1332 Ga0501047_0002364
1333 Ga0501047_0157248
1334 Ga0501047_0168987
1335 Ga0501047_0172428
1336 Ga0501067_0146215
1337 Ga0501068_0169680
1338 Ga0501070_0009430
1339 Ga0501070_0169394
1340 Ga0501070_0269910
1341 Ga0501073_0271248
1342 Ga0501080_0069209
1343 Ga0501083_0099443
1344 Ga0501083_0199315
1345 Ga0501035_0000100
1346 Ga0501035_0038128
1347 Ga0501044_0000002
1348 Ga0501044_0036127
1349 Ga0501044_0101205
1350 Ga0501044_0150409
1351 Ga0501045_0334474
1352 nmdc:mga0yw44_19685_c1
1353 Ga0500578_0093222
1354 Ga0500643_026321
1355 Ga0500646_0007652
1356 Ga0500651_0243042
1357 Ga0500650_0028901
1358 Ga0500556_0023251
1359 Ga0500557_000282
1360 Ga0500560_070174
1361 Ga0500562_002778
1362 Ga0500569_016074
1363 Ga0500594_0000635
1364 Ga0500618_006727
1365 Ga0500618_006924
1366 Ga0500658_0000880
1367 Ga0500658_0005307
1368 Ga0500568_0000629
1369 Ga0500568_0002233
1370 Ga0500590_000127
1371 Ga0500604_0017296
1372 Ga0500616_0005719
1373 Ga0500616_0110610
1374 Ga0500620_000852
1375 Ga0500622_0001672
1376 Ga0500627_0032004
1377 Ga0500633_0016986
1378 Ga0500633_0051404
1379 Ga0500636_0097124
1380 Ga0500645_015656
1381 Ga0501082_0056138
1382 2501078086
1383 2509108047
1384 2509376774
1385 2509390175
1386 2509447535
1387 2510134359
1388 2510308320
1389 2510895792
1390 2511091957
1391 2511131929
1392 2511182654
1393 2511194915
1394 2511391278
1395 2511502503
1396 2512533878
1397 2512970367
1398 2513567521
1399 2513577857
1400 2513587465
1401 2513598404
1402 2513601431
1403 2513619558
1404 2513631996
1405 2513712530
1406 2513867916
1407 2513881809
1408 2513904953
1409 2513910648
1410 2513928093
1411 2513983629
1412 2513997574
1413 2514003122
1414 2514420214
1415 2514588972
1416 2515113530
1417 2515609292
1418 2515635243
1419 2515643850
1420 2515654938
1421 2515739884
1422 2516893878
1423 2517037142
1424 2517077483
1425 2517096249
1426 2517408107
1427 2517570595
1428 2520381948
1429 2524448298
1430 2524459012
1431 2530646387
1432 2535517230
1433 2551679615
1434 2551689446
1435 2551704732
1436 2551710591
1437 2551723158
1438 2551735560
1439 2551740098
1440 2558865869
1441 2585167553
1442 2585205102
1443 2585225255
1444 2585230680
1445 2585259115
1446 2585265780
1447 2585273969
1448 2585279430
1449 2585322910
1450 2585331078
1451 2585389027
1452 2585395173
1453 2585404602
1454 2585524910
1455 2585531086
1456 2585542783
1457 2585547811
1458 2585552993
1459 2585560420
1460 2585824861
1461 2585841425
1462 2585847703
1463 2585898614
1464 2585903798
1465 2587981083
1466 2597814374
1467 2599421102
1468 2600196076
1469 2616296660
1470 2616307003
1471 2616554616
1472 2617384883
1473 2643804384
1474 2644002914
1475 2644050103
1476 2644065155
1477 2644105446
1478 2644129083
1479 2644146449
1480 2644168758
1481 2644204837
1482 2644208696
1483 2644237894
1484 2644308197
1485 2644334021
1486 2644347307
1487 2644377564
1488 2644416827
1489 2644449867
1490 2644483024
1491 2644497692
1492 2644541618
1493 2644615479
1494 2644652226
1495 2644672780
1496 2644690001
1497 2644743308
1498 2671111861
1499 2719386834
1500 2719666574
1501 2720492994
1502 2720614470
1503 2720621246
1504 2720632572
1505 2720776294
1506 2721400557
1507 2723027886
1508 2723561514
1509 2723568144
1510 2723575730
1511 2724039370
1512 2724090901
1513 2724105409
1514 2724111232
1515 2725950239
1516 2730108822
1517 2738805420
1518 2739033235
1519 2765467210
1520 2766066279
1521 2770198806
1522 2776273014
1523 2776282143
1524 2778173383
1525 2792638784
1526 2793294020
1527 2793314305
1528 2793323790
1529 2793329696
1530 2793342297
1531 2793355317
1532 2793362967
1533 2793369879
1534 2802716724
1535 2802725535
1536 2802730373
1537 2802737656
1538 2802742955
1539 2802750379
1540 2805929534
1541 2805936838
1542 2806047523
1543 2806055127
1544 2806063063
1545 2806069798
1546 2806075727
1547 2819609927
1548 2819640037
1549 2838019937
1550 2838033238
1551 2838041465
1552 2838045609
1553 2838052747
1554 2838065004
1555 2838069729
1556 2838079678
1557 2838665857
1558 2838671765
1559 2838686639
1560 2838698026
1561 2838704444
1562 2838711141
1563 2838734881
1564 2838747496
1565 2839996428
1566 2840770364
1567 2841854468
1568 2841867387
1569 2842079316
1570 2842115578
1571 2842118173
1572 2842149662
1573 2842158513
1574 2842169043
1575 2842182127
1576 2842195635
1577 2842218360
1578 2842229873
1579 2842240087
1580 2842243762
1581 2842254171
1582 2842258153
1583 2842267656
1584 2842271823
1585 2842284406
1586 2842285192
1587 2842292978
1588 2842298364
1589 2842305434
1590 2842314158
1591 2842319961
1592 2842347643
1593 2842360376
1594 2842368705
1595 2842373660
1596 2842379375
1597 2842384684
1598 2842400587
1599 2842402550
1600 2842410079
1601 2842416727
1602 2842423343
1603 2842430300
1604 2842436888
1605 2842443270
1606 2842449135
1607 2842467172
1608 2842471242
1609 2842480097
1610 2842483709
1611 2842493499
1612 2842497649
1613 2842505118
1614 2842510380
1615 2842522183
1616 2842875729
1617 2844166360
1618 2844457937
1619 2847419761
1620 2848994778
1621 2850081776
1622 2852390795
1623 2855826604
1624 2855841994
1625 2855877277
1626 2857517014
1627 2858802668
1628 2871454819
1629 2882635620
1630 2889792368
1631 2889916997
1632 2891373701
1633 2894657084
1634 2896391211
1635 2904582563
1636 2915981135
1637 2915993233
1638 2915999039
1639 2916005045
1640 2916012711
1641 2916018961
1642 2916023016
1643 2916033855
1644 2916039364
1645 2916044373
1646 2916050421
1647 2916060333
1648 2916063323
1649 2916075751
1650 2916080471
1651 2919105589
1652 2919124043
1653 2919410361
1654 2919679727
1655 2920761186
1656 2920825622
1657 2921205763
1658 2921212556
1659 2921243988
1660 2921244487
1661 2921251644
1662 2921262655
1663 2921269413
1664 2921287130
1665 2921294122
1666 2921299564
1667 2923562262
1668 2924150320
1669 2924156528
1670 2924159883
1671 2924172253
1672 2924178431
1673 2924183502
1674 2924193087
1675 2924196437
1676 2924203887
1677 2924210798
1678 2924218396
1679 2924225632
1680 2924233274
1681 2924766773
1682 2928524837
1683 2933571241
1684 2933591993
1685 2933600536
1686 2935896590
1687 2935901485
1688 2936371628
1689 2936377001
1690 2936383409
1691 2937002755
1692 2937005319
1693 2937012854
1694 2937021880
1695 2937027330
1696 2937035626
1697 2937039659
1698 2937048470
1699 2937055575
1700 2937063786
1701 2937068700
1702 2937075923
1703 2937080688
1704 2937088885
1705 2937097441
1706 2937101156
1707 2937110207
1708 2937117687
1709 2937124520
1710 2937132284
1711 2941504612
1712 2954011203
1713 2957380699
1714 2957387273
1715 2957389513
1716 2957397247
1717 2957408310
1718 2957412934
1719 2957418932
1720 2957426302
1721 2957435828
1722 2957441148
1723 2957450232
1724 2957455769
1725 2957460461
1726 2957468809
1727 2957476639
1728 2957483159
1729 2957489189
1730 2957495143
1731 2957501681
1732 2957512313
1733 2960584875
1734 2960591801
1735 2960602116
1736 2960610261
1737 2960613109
1738 2960617986
1739 2960629770
1740 2960634002
1741 2960638332
1742 2960651103
1743 2960655048
1744 2960667080
1745 2960670716
1746 2960680535
1747 2960680815
1748 2960688193
1749 2960699591
1750 2964618167
1751 2964628044
1752 2964634216
1753 2964639153
1754 2964646239
1755 2964651258
1756 2964656951
1757 2964667675
1758 2964676580
1759 2964682675
1760 2964689230
1761 2964694794
1762 2964704512
1763 2964706509
1764 2964714774
1765 2964725795
1766 2967666776
1767 2967677774
1768 2967685813
1769 2967690051
1770 2967698648
1771 2967711430
1772 2967727231
1773 2967734117
1774 2967739853
1775 2967745101
1776 2967754213
1777 2967759661
1778 2967768454
1779 2967772692
1780 2967779401
1781 2970024328
1782 2970027593
1783 2970035971
1784 2970045211
1785 2970051475
1786 2970056215
1787 2970065490
1788 2970070980
1789 2970079410
1790 2970084621
1791 2970094322
1792 2970099960
1793 2970103978
1794 2970111906
1795 2970120548
1796 2970126320
1797 2970134686
1798 2970141774
1799 2970147122
1800 2970152445
1801 2970162254
1802 2970168264
1803 2970175941
1804 2970181116
1805 2970186233
1806 2970196160
1807 2970530670
1808 2977523297
1809 2977528092
1810 2977536404
1811 2977543348
1812 2977551745
1813 2977553014
1814 2977564147
1815 2977568810
1816 2977574098
1817 2977585956
1818 2977832025
1819 2987668885
1820 2989350178
1821 2989773304
1822 2996310623
1823 2996341078
1824 2996892532
1825 2996898046
1826 3002145395
1827 3003934644
1828 3005418817
1829 3005448824
1830 3005455049
1831 639649574
1832 643826655
1833 648739492
1834 8003994430
1835 8004002132
1836 8005264841
1837 8005281645
1838 8005284393
1839 8005289650
1840 8005303553
1841 8005314069
1842 8005318291
1843 8005327059
1844 8005382689
1845 8005384651
1846 8005395679
1847 8005433915
1848 8005464215
1849 8005488826
1850 8005501319
1851 8005546050
1852 8005561628
1853 8005568403
1854 8005573055
1855 8005622681
1856 8005630198
1857 8005645797
1858 8005672738
1859 8005682520
1860 8005691669
1861 8005696799
1862 8018127560
1863 8018164157
1864 8018178951
1865 8023682760
1866 8024486116
1867 8024488426
1868 8024501194
1869 8046772641
1870 8054561875
1871 8056377012
1872 8056387333
1873 8057576898
1874 8057881930

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

170

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qi9-assembly1.cif.gz_D abc-transporter btucd in complex with its periplasmic binding protein btuf 0.9387 2 243
4dbl-assembly1.cif.gz_C crystal structure of e159q mutant of btucdf 0.9376 2 243
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9285 2 237
1l7v-assembly1.cif.gz_D bacterial abc transporter involved in b12 uptake 0.9284 2 240
4r9u-assembly1.cif.gz_D structure of vitamin b12 transporter btucd in a nucleotide-bound outward facing state 0.9197 2 245
ID Description Score Start End Superfamily
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 1 247 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 2 220 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 2 227 3.40.50.300
2qi9C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9215 1 239 3.40.50.300
af_Q2FVG0_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9209 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q8NL85-F1-model_v4 Iron ABC transporter 0.986 1 263 GO:0005524
GO:0016887
AF-A0A7W3ZHU8-F1-model_v4 deleted 0.9607 1 253
AF-A0A7W6EYH3-F1-model_v4 Iron complex transport system ATP-binding protein 0.9607 2 239 GO:0005524
GO:0016887
AF-A0A4V3JXG7-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9587 2 248 GO:0005524
GO:0016887
AF-A0A2M9LCL9-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9549 1 237 GO:0005524
GO:0016887

Map