F486223

General Info

Members Datasets Scaffolds Average Seq Length
937 223 1874 211

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10183167|Ga0307410_101831672
Length 195
Sequence MDFASLITPEAVAAFVEIILIDIVLAGDNAIVVGALAAGLPPEQRKRVIMIGVLAALVLRIIFALIVTQLLQIVGLVLAGGLLLLWVAWRMYRELRQKDECSPGSEEIIGDEHSGLRAAKSFTSAAWGVALADVSMSLDNVLAVAGAAREHPWVLVFGLVRWIAWVGLLVILWVALKMIYEGAGHVAPVIAPFVG

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.63
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10183167 3300031852 Bacteria 1587
2 JGI24736J21556_1001761 3300001904 Bacteria 3902
3 JGI24741J21665_1007010 3300001915 Bacteria 2215
4 JGI24741J21665_1008951 3300001915 Bacteria 1863
5 JGI24740J21852_10008870 3300001979 Bacteria 3981
6 JGI24740J21852_10010728 3300001979 Bacteria 3513
7 JGI24740J21852_10011657 3300001979 Bacteria 3341
8 JGI24740J21852_10014558 3300001979 Bacteria 2896
9 JGI24740J21852_10049411 3300001979 Bacteria 1215
10 JGI24739J22299_10003668 3300001989 Bacteria 5860
11 JGI24739J22299_10026139 3300001989 Bacteria 2050
12 JGI24737J22298_10000027 3300001990 Bacteria 43503
13 JGI24737J22298_10002717 3300001990 Bacteria 6253
14 JGI24737J22298_10009047 3300001990 Bacteria 3320
15 JGI24737J22298_10015505 3300001990 Bacteria 2467
16 JGI24737J22298_10043043 3300001990 Bacteria 1383
17 JGI24735J21928_10013682 3300002067 Bacteria 2547
18 JGI24735J21928_10068611 3300002067 Bacteria 1017
19 JGI24735J21928_10077855 3300002067 Bacteria 950
20 JGI24748J21848_1005841 3300002074 Bacteria 1431
21 JGI24738J21930_10000290 3300002075 Bacteria 13746
22 JGI24738J21930_10000704 3300002075 Bacteria 9639
23 JGI24034J26672_10020372 3300002239 Bacteria 1039
24 JGI24742J22300_10020331 3300002244 Bacteria 1131
25 Ga0065714_10031798 3300005288 Bacteria 996
26 Ga0065712_10183480 3300005290 Bacteria 1181
27 Ga0065712_10215761 3300005290 Bacteria 1057
28 Ga0070658_10000177 3300005327 Bacteria 56043
29 Ga0070658_10000256 3300005327 Bacteria 46854
30 Ga0070658_10020304 3300005327 Bacteria 5323
31 Ga0070658_10022765 3300005327 Bacteria 5029
32 Ga0070658_10162922 3300005327 Bacteria 1871
33 Ga0070658_10429013 3300005327 Bacteria 1137
34 Ga0070658_10973881 3300005327 Bacteria 738
35 Ga0070676_10021238 3300005328 Bacteria 3633
36 Ga0070676_10141676 3300005328 Bacteria 1531
37 Ga0070676_10666096 3300005328 Bacteria 757
38 Ga0070683_100000686 3300005329 Bacteria 24502
39 Ga0070683_100003873 3300005329 Bacteria 12237
40 Ga0070683_100050239 3300005329 Bacteria 3859
41 Ga0070683_100072541 3300005329 Bacteria 3213
42 Ga0070683_100234693 3300005329 Bacteria 1744
43 Ga0070683_100316563 3300005329 Bacteria 1485
44 Ga0070683_100374073 3300005329 Bacteria 1357
45 Ga0070683_100955734 3300005329 Bacteria 822
46 Ga0070690_100027952 3300005330 Bacteria 3490
47 Ga0070690_100044875 3300005330 Bacteria 2807
48 Ga0070670_100016168 3300005331 Bacteria 6404
49 Ga0070670_100018943 3300005331 Bacteria 5903
50 Ga0070670_100062322 3300005331 Bacteria 3202
51 Ga0070670_100163395 3300005331 Bacteria 1930
52 Ga0070670_100177462 3300005331 Bacteria 1849
53 Ga0070670_100269695 3300005331 Bacteria 1485
54 Ga0070670_100489360 3300005331 Bacteria 1093
55 Ga0070677_10070847 3300005333 Bacteria 1466
56 Ga0068869_100000085 3300005334 Bacteria 42599
57 Ga0070666_10002604 3300005335 Bacteria 10888
58 Ga0070666_10003935 3300005335 Bacteria 9019
59 Ga0070666_10038740 3300005335 Bacteria 3173
60 Ga0070666_10076658 3300005335 Bacteria 2281
61 Ga0070666_10180548 3300005335 Bacteria 1480
62 Ga0070666_10374340 3300005335 Bacteria 1022
63 Ga0070680_100000105 3300005336 Bacteria 48515
64 Ga0070680_100000468 3300005336 Bacteria 27588
65 Ga0070680_100028233 3300005336 Bacteria 4499
66 Ga0070680_100229266 3300005336 Bacteria 1568
67 Ga0070680_100316445 3300005336 Bacteria 1325
68 Ga0070682_100077142 3300005337 Bacteria 2146
69 Ga0070682_100096718 3300005337 Bacteria 1942
70 Ga0070682_100282225 3300005337 Bacteria 1211
71 Ga0068868_100002300 3300005338 Bacteria 13214
72 Ga0068868_100048116 3300005338 Bacteria 3344
73 Ga0068868_100060350 3300005338 Bacteria 3003
74 Ga0068868_100116361 3300005338 Bacteria 2177
75 Ga0068868_100321585 3300005338 Bacteria 1318
76 Ga0068868_100851844 3300005338 Bacteria 826
77 Ga0070660_100000064 3300005339 Bacteria 62554
78 Ga0070660_100000065 3300005339 Bacteria 61999
79 Ga0070660_100000881 3300005339 Bacteria 20070
80 Ga0070660_100023060 3300005339 Bacteria 4608
81 Ga0070660_100035333 3300005339 Bacteria 3782
82 Ga0070660_100042976 3300005339 Bacteria 3452
83 Ga0070660_100062476 3300005339 Bacteria 2893
84 Ga0070660_100065454 3300005339 Bacteria 2829
85 Ga0070660_100073471 3300005339 Bacteria 2674
86 Ga0070660_100083678 3300005339 Bacteria 2507
87 Ga0070660_100121670 3300005339 Bacteria 2083
88 Ga0070660_100144466 3300005339 Bacteria 1910
89 Ga0070660_100151365 3300005339 Bacteria 1865
90 Ga0070660_100167216 3300005339 Bacteria 1775
91 Ga0070660_100175796 3300005339 Bacteria 1731
92 Ga0070660_100219532 3300005339 Bacteria 1545
93 Ga0070660_100392196 3300005339 Bacteria 1147
94 Ga0070689_100096115 3300005340 Bacteria 2341
95 Ga0070689_100847327 3300005340 Bacteria 806
96 Ga0070687_100211280 3300005343 Bacteria 1182
97 Ga0070661_100000084 3300005344 Bacteria 74971
98 Ga0070661_100013397 3300005344 Bacteria 5755
99 Ga0070661_100026745 3300005344 Bacteria 4151
100 Ga0070661_100109120 3300005344 Bacteria 2065
101 Ga0070661_100185953 3300005344 Bacteria 1583
102 Ga0070661_100220098 3300005344 Bacteria 1456
103 Ga0070661_100276485 3300005344 Bacteria 1302
104 Ga0070661_100285762 3300005344 Bacteria 1281
105 Ga0070661_100339304 3300005344 Bacteria 1177
106 Ga0070661_100455738 3300005344 Bacteria 1018
107 Ga0070692_10006763 3300005345 Bacteria 5001
108 Ga0070692_10050515 3300005345 Bacteria 2160
109 Ga0070668_100017746 3300005347 Bacteria 5336
110 Ga0070668_100128357 3300005347 Bacteria 2033
111 Ga0070669_100000693 3300005353 Bacteria 24733
112 Ga0070669_100021053 3300005353 Bacteria 4659
113 Ga0070669_100108014 3300005353 Bacteria 2108
114 Ga0070669_100172090 3300005353 Bacteria 1689
115 Ga0070669_100341331 3300005353 Bacteria 1214
116 Ga0070675_100007745 3300005354 Bacteria 8312
117 Ga0070675_100068433 3300005354 Bacteria 2940
118 Ga0070675_100468954 3300005354 Bacteria 1131
119 Ga0070671_100002311 3300005355 Bacteria 14714
120 Ga0070671_100019717 3300005355 Bacteria 5491
121 Ga0070671_100036716 3300005355 Bacteria 4064
122 Ga0070671_100053853 3300005355 Bacteria 3344
123 Ga0070671_100103405 3300005355 Bacteria 2390
124 Ga0070671_100298758 3300005355 Bacteria 1371
125 Ga0070671_100825410 3300005355 Bacteria 808
126 Ga0070674_100061388 3300005356 Bacteria 2623
127 Ga0070674_100080724 3300005356 Bacteria 2323
128 Ga0070674_100402059 3300005356 Bacteria 1119
129 Ga0070673_100000376 3300005364 Bacteria 23364
130 Ga0070673_100000450 3300005364 Bacteria 21787
131 Ga0070673_100196773 3300005364 Bacteria 1734
132 Ga0070673_100236826 3300005364 Bacteria 1585
133 Ga0070688_100718488 3300005365 Bacteria 775
134 Ga0070659_100000525 3300005366 Bacteria 28016
135 Ga0070659_100001520 3300005366 Bacteria 16726
136 Ga0070659_100006328 3300005366 Bacteria 8549
137 Ga0070659_100008959 3300005366 Bacteria 7337
138 Ga0070659_100014437 3300005366 Bacteria 5902
139 Ga0070659_100017555 3300005366 Bacteria 5390
140 Ga0070659_100020517 3300005366 Bacteria 5021
141 Ga0070659_100035708 3300005366 Bacteria 3872
142 Ga0070659_100079644 3300005366 Bacteria 2615
143 Ga0070659_100123586 3300005366 Bacteria 2098
144 Ga0070659_100146692 3300005366 Bacteria 1923
145 Ga0070659_100175757 3300005366 Bacteria 1756
146 Ga0070659_100935084 3300005366 Bacteria 759
147 Ga0070659_100995614 3300005366 Bacteria 736
148 Ga0070667_100003791 3300005367 Bacteria 12860
149 Ga0070667_100004748 3300005367 Bacteria 11387
150 Ga0070667_100009183 3300005367 Bacteria 8185
151 Ga0070667_100016562 3300005367 Bacteria 6100
152 Ga0070667_100022180 3300005367 Bacteria 5268
153 Ga0070667_100028643 3300005367 Bacteria 4638
154 Ga0070667_100263609 3300005367 Bacteria 1543
155 Ga0070701_10176659 3300005438 Bacteria 1247
156 Ga0070663_100000033 3300005455 Bacteria 71453
157 Ga0070663_100000701 3300005455 Bacteria 18072
158 Ga0070663_100020653 3300005455 Bacteria 4363
159 Ga0070663_100047532 3300005455 Bacteria 3040
160 Ga0070663_100049110 3300005455 Bacteria 2995
161 Ga0070663_100228312 3300005455 Bacteria 1465
162 Ga0070663_100363311 3300005455 Bacteria 1175
163 Ga0070678_100021253 3300005456 Bacteria 4276
164 Ga0070662_100000017 3300005457 Bacteria 105478
165 Ga0070662_100000337 3300005457 Bacteria 28132
166 Ga0070662_100002326 3300005457 Bacteria 11684
167 Ga0070662_100007419 3300005457 Bacteria 7111
168 Ga0070662_100052969 3300005457 Bacteria 2936
169 Ga0070662_100057399 3300005457 Bacteria 2829
170 Ga0070662_100121293 3300005457 Bacteria 2004
171 Ga0070662_100158648 3300005457 Bacteria 1768
172 Ga0070662_100178251 3300005457 Bacteria 1674
173 Ga0070662_100239726 3300005457 Bacteria 1454
174 Ga0070662_100405224 3300005457 Bacteria 1126
175 Ga0070662_100619845 3300005457 Bacteria 911
176 Ga0070681_10147488 3300005458 Bacteria 2281
177 Ga0070681_10158073 3300005458 Bacteria 2191
178 Ga0070681_10187293 3300005458 Bacteria 1990
179 Ga0070681_10330725 3300005458 Bacteria 1433
180 Ga0070681_10335655 3300005458 Bacteria 1421
181 Ga0070681_10496321 3300005458 Bacteria 1134
182 Ga0068867_100000661 3300005459 Bacteria 22832
183 Ga0068867_100017629 3300005459 Bacteria 5070
184 Ga0068867_100120327 3300005459 Bacteria 2028
185 Ga0068867_100775382 3300005459 Bacteria 853
186 Ga0070685_10187435 3300005466 Bacteria 1336
187 Ga0070685_10670710 3300005466 Bacteria 753
188 Ga0070679_100000125 3300005530 Bacteria 61348
189 Ga0070679_100160520 3300005530 Bacteria 2222
190 Ga0070679_100210860 3300005530 Bacteria 1906
191 Ga0070679_100295648 3300005530 Bacteria 1571
192 Ga0070679_100327552 3300005530 Bacteria 1480
193 Ga0070684_100014356 3300005535 Bacteria 6413
194 Ga0070684_100032578 3300005535 Bacteria 4442
195 Ga0070684_100048674 3300005535 Bacteria 3677
196 Ga0070684_100229098 3300005535 Bacteria 1696
197 Ga0070684_100308102 3300005535 Bacteria 1454
198 Ga0070684_100317512 3300005535 Bacteria 1431
199 Ga0068853_100000703 3300005539 Bacteria 23188
200 Ga0068853_100002455 3300005539 Bacteria 13872
201 Ga0068853_100019401 3300005539 Bacteria 5636
202 Ga0068853_100092375 3300005539 Bacteria 2662
203 Ga0068853_100130212 3300005539 Bacteria 2252
204 Ga0068853_100156838 3300005539 Bacteria 2051
205 Ga0068853_100181917 3300005539 Bacteria 1906
206 Ga0068853_100198190 3300005539 Bacteria 1826
207 Ga0068853_100206360 3300005539 Bacteria 1790
208 Ga0068853_100234696 3300005539 Bacteria 1679
209 Ga0068853_100258667 3300005539 Bacteria 1599
210 Ga0068853_100333860 3300005539 Bacteria 1407
211 Ga0068853_100668853 3300005539 Bacteria 989
212 Ga0068853_100695352 3300005539 Bacteria 970
213 Ga0070672_100000476 3300005543 Bacteria 23318
214 Ga0070672_100008105 3300005543 Bacteria 7178
215 Ga0070672_100026712 3300005543 Bacteria 4301
216 Ga0070672_100120656 3300005543 Bacteria 2145
217 Ga0070672_100132807 3300005543 Bacteria 2048
218 Ga0070672_100151181 3300005543 Bacteria 1920
219 Ga0070672_100822963 3300005543 Bacteria 818
220 Ga0070686_100024287 3300005544 Bacteria 3631
221 Ga0070693_100001690 3300005547 Bacteria 10011
222 Ga0070693_100077317 3300005547 Bacteria 1975
223 Ga0070693_100122132 3300005547 Bacteria 1617
224 Ga0070693_100146278 3300005547 Bacteria 1493
225 Ga0070665_100001860 3300005548 Bacteria 23948
226 Ga0070665_100008788 3300005548 Bacteria 10223
227 Ga0070665_100039045 3300005548 Bacteria 4774
228 Ga0070665_100042584 3300005548 Bacteria 4564
229 Ga0070665_100240903 3300005548 Bacteria 1809
230 Ga0070665_100927814 3300005548 Bacteria 883
231 Ga0068855_100000194 3300005563 Bacteria 78505
232 Ga0068855_100001289 3300005563 Bacteria 31088
233 Ga0068855_100003759 3300005563 Bacteria 18557
234 Ga0068855_100024723 3300005563 Bacteria 7186
235 Ga0070664_100000098 3300005564 Bacteria 55907
236 Ga0070664_100006436 3300005564 Bacteria 9475
237 Ga0070664_100019681 3300005564 Bacteria 5554
238 Ga0070664_100022986 3300005564 Bacteria 5144
239 Ga0070664_100056039 3300005564 Bacteria 3349
240 Ga0070664_100123321 3300005564 Bacteria 2270
241 Ga0070664_100132675 3300005564 Bacteria 2188
242 Ga0070664_100174574 3300005564 Bacteria 1907
243 Ga0070664_100238337 3300005564 Bacteria 1632
244 Ga0070664_100275604 3300005564 Bacteria 1516
245 Ga0070664_100646734 3300005564 Bacteria 982
246 Ga0070664_101015498 3300005564 Bacteria 780
247 Ga0068857_100000665 3300005577 Bacteria 25438
248 Ga0068857_100007380 3300005577 Bacteria 9466
249 Ga0068857_100016423 3300005577 Bacteria 6486
250 Ga0068857_100033361 3300005577 Bacteria 4552
251 Ga0068857_100037630 3300005577 Bacteria 4287
252 Ga0068857_100055046 3300005577 Bacteria 3531
253 Ga0068857_100153538 3300005577 Bacteria 2087
254 Ga0068857_100201847 3300005577 Bacteria 1813
255 Ga0068857_100273227 3300005577 Bacteria 1553
256 Ga0068857_100388447 3300005577 Bacteria 1297
257 Ga0068857_100548396 3300005577 Bacteria 1089
258 Ga0068857_100664959 3300005577 Bacteria 988
259 Ga0068854_100000173 3300005578 Bacteria 43694
260 Ga0068854_100005007 3300005578 Bacteria 8354
261 Ga0068854_100006044 3300005578 Bacteria 7672
262 Ga0068854_100014434 3300005578 Bacteria 5208
263 Ga0068854_100031998 3300005578 Bacteria 3657
264 Ga0068854_100074884 3300005578 Bacteria 2484
265 Ga0068854_100090666 3300005578 Bacteria 2274
266 Ga0068856_100000098 3300005614 Bacteria 83221
267 Ga0068856_100079659 3300005614 Bacteria 3248
268 Ga0068856_100143854 3300005614 Bacteria 2392
269 Ga0068856_100445962 3300005614 Bacteria 1315
270 Ga0068852_100000305 3300005616 Bacteria 33064
271 Ga0068852_100000440 3300005616 Bacteria 27519
272 Ga0068852_100001638 3300005616 Bacteria 15290
273 Ga0068852_100015427 3300005616 Bacteria 5926
274 Ga0068852_100023774 3300005616 Bacteria 4940
275 Ga0068852_100061550 3300005616 Bacteria 3263
276 Ga0068852_100115465 3300005616 Bacteria 2448
277 Ga0068852_100132658 3300005616 Bacteria 2296
278 Ga0068852_100314935 3300005616 Bacteria 1518
279 Ga0068852_100421902 3300005616 Bacteria 1316
280 Ga0068852_100450744 3300005616 Bacteria 1274
281 Ga0068859_100001231 3300005617 Bacteria 26157
282 Ga0068859_100006954 3300005617 Bacteria 11490
283 Ga0068859_100013585 3300005617 Bacteria 8163
284 Ga0068859_100016998 3300005617 Bacteria 7302
285 Ga0068859_100150356 3300005617 Bacteria 2404
286 Ga0068859_100155998 3300005617 Bacteria 2360
287 Ga0068859_100320839 3300005617 Bacteria 1643
288 Ga0068864_100000953 3300005618 Bacteria 24235
289 Ga0068864_100005001 3300005618 Bacteria 10862
290 Ga0068864_100007173 3300005618 Bacteria 9152
291 Ga0068864_100041313 3300005618 Bacteria 3944
292 Ga0068864_100049155 3300005618 Bacteria 3628
293 Ga0068864_100495632 3300005618 Bacteria 1174
294 Ga0068866_10062715 3300005718 Bacteria 1935
295 Ga0068866_10461201 3300005718 Bacteria 833
296 Ga0068861_100745590 3300005719 Bacteria 914
297 Ga0068851_10001580 3300005834 Bacteria 9997
298 Ga0068851_10011809 3300005834 Bacteria 4103
299 Ga0068851_10032269 3300005834 Bacteria 2606
300 Ga0068851_10074576 3300005834 Bacteria 1761
301 Ga0068863_100001401 3300005841 Bacteria 23908
302 Ga0068863_100003718 3300005841 Bacteria 15092
303 Ga0068863_100004123 3300005841 Bacteria 14367
304 Ga0068863_100041431 3300005841 Bacteria 4379
305 Ga0068863_100108956 3300005841 Bacteria 2636
306 Ga0068863_100200401 3300005841 Bacteria 1920
307 Ga0068858_100000695 3300005842 Bacteria 35157
308 Ga0068858_100001052 3300005842 Bacteria 28522
309 Ga0068858_100018849 3300005842 Bacteria 6457
310 Ga0068858_100028003 3300005842 Bacteria 5236
311 Ga0068858_100045545 3300005842 Bacteria 4065
312 Ga0068858_100068509 3300005842 Bacteria 3288
313 Ga0068860_100005142 3300005843 Bacteria 13302
314 Ga0068860_100005163 3300005843 Bacteria 13271
315 Ga0068860_100007383 3300005843 Bacteria 10991
316 Ga0068860_100013811 3300005843 Bacteria 7916
317 Ga0068860_100095372 3300005843 Bacteria 2836
318 Ga0068860_100129719 3300005843 Bacteria 2418
319 Ga0068860_100443975 3300005843 Bacteria 1289
320 Ga0068860_100562506 3300005843 Bacteria 1143
321 Ga0068860_100595960 3300005843 Bacteria 1110
322 Ga0068860_100669708 3300005843 Bacteria 1046
323 Ga0068860_101110481 3300005843 Bacteria 810
324 Ga0068862_100011824 3300005844 Bacteria 7208
325 Ga0068862_100024286 3300005844 Bacteria 5085
326 Ga0068862_100040300 3300005844 Bacteria 3970
327 Ga0068862_100128353 3300005844 Bacteria 2241
328 Ga0068862_100145331 3300005844 Bacteria 2107
329 Ga0070712_100377463 3300006175 Bacteria 1166
330 Ga0097621_100021272 3300006237 Bacteria 5014
331 Ga0097621_100052581 3300006237 Bacteria 3319
332 Ga0097621_100108662 3300006237 Bacteria 2342
333 Ga0097621_100304904 3300006237 Bacteria 1407
334 Ga0097621_100416499 3300006237 Bacteria 1205
335 Ga0097621_100496959 3300006237 Bacteria 1104
336 Ga0068871_100055253 3300006358 Bacteria 3223
337 Ga0068871_100067514 3300006358 Bacteria 2934
338 Ga0068871_100134859 3300006358 Bacteria 2096
339 Ga0068871_100471397 3300006358 Bacteria 1128
340 Ga0068865_100000263 3300006881 Bacteria 28940
341 Ga0068865_100068775 3300006881 Bacteria 2504
342 Ga0068865_100533465 3300006881 Bacteria 983
343 Ga0097620_100001231 3300006931 Bacteria 26157
344 Ga0097620_100006954 3300006931 Bacteria 11490
345 Ga0097620_100013585 3300006931 Bacteria 8163
346 Ga0097620_100016999 3300006931 Bacteria 7302
347 Ga0097620_100150354 3300006931 Bacteria 2404
348 Ga0097620_100155996 3300006931 Bacteria 2360
349 Ga0097620_100320832 3300006931 Bacteria 1643
350 Ga0105250_10085987 3300009092 Bacteria 1277
351 Ga0105240_10024667 3300009093 Bacteria 7921
352 Ga0105240_10349346 3300009093 Bacteria 1678
353 Ga0111539_10500823 3300009094 Bacteria 1415
354 Ga0105245_10000170 3300009098 Bacteria 61721
355 Ga0105245_10022139 3300009098 Bacteria 5580
356 Ga0105245_10046821 3300009098 Bacteria 3864
357 Ga0105247_10025079 3300009101 Bacteria 3598
358 Ga0105241_10101665 3300009174 Bacteria 2286
359 Ga0105242_10111248 3300009176 Bacteria 2335
360 Ga0105242_10279764 3300009176 Bacteria 1515
361 Ga0105242_10292092 3300009176 Bacteria 1485
362 Ga0105242_10362549 3300009176 Bacteria 1342
363 Ga0105248_10000184 3300009177 Bacteria 72728
364 Ga0105248_10000444 3300009177 Bacteria 47003
365 Ga0105248_10001388 3300009177 Bacteria 26986
366 Ga0105248_10002857 3300009177 Bacteria 19171
367 Ga0105248_10009540 3300009177 Bacteria 10681
368 Ga0105248_10013149 3300009177 Bacteria 9113
369 Ga0105248_10233904 3300009177 Bacteria 2069
370 Ga0105248_10241736 3300009177 Bacteria 2032
371 Ga0105248_10244152 3300009177 Bacteria 2021
372 Ga0105237_10087792 3300009545 Bacteria 3099
373 Ga0105237_10436089 3300009545 Bacteria 1316
374 Ga0105238_10011487 3300009551 Bacteria 8922
375 Ga0105238_10093095 3300009551 Bacteria 3002
376 Ga0105238_10189951 3300009551 Bacteria 2030
377 Ga0105238_10424693 3300009551 Bacteria 1324
378 Ga0105249_10028703 3300009553 Bacteria 5021
379 Ga0105249_10039995 3300009553 Bacteria 4258
380 Ga0105239_10030847 3300010375 Bacteria 5897
381 Ga0105239_10310956 3300010375 Bacteria 1776
382 Ga0105239_10482562 3300010375 Bacteria 1408
383 Ga0105246_10367803 3300011119 Bacteria 1184
384 Ga0157373_10050961 3300013100 Bacteria 2948
385 Ga0157373_10094845 3300013100 Bacteria 2100
386 Ga0157373_10105014 3300013100 Bacteria 1987
387 Ga0157373_10136155 3300013100 Bacteria 1727
388 Ga0157373_10138979 3300013100 Bacteria 1708
389 Ga0157373_10160085 3300013100 Bacteria 1584
390 Ga0157373_10196779 3300013100 Bacteria 1421
391 Ga0157373_10270299 3300013100 Bacteria 1203
392 Ga0157373_10342205 3300013100 Bacteria 1066
393 Ga0157373_10502457 3300013100 Bacteria 876
394 Ga0157371_10002003 3300013102 Bacteria 20140
395 Ga0157371_10002538 3300013102 Bacteria 17347
396 Ga0157371_10032813 3300013102 Bacteria 3734
397 Ga0157371_10039501 3300013102 Bacteria 3374
398 Ga0157371_10082625 3300013102 Bacteria 2274
399 Ga0157371_10098819 3300013102 Bacteria 2070
400 Ga0157371_10129211 3300013102 Bacteria 1797
401 Ga0157371_10130394 3300013102 Bacteria 1788
402 Ga0157371_10174748 3300013102 Bacteria 1535
403 Ga0157371_10218009 3300013102 Bacteria 1370
404 Ga0157371_10646112 3300013102 Bacteria 789
405 Ga0157370_10004682 3300013104 Bacteria 15607
406 Ga0157370_10063558 3300013104 Bacteria 3496
407 Ga0157370_10112848 3300013104 Bacteria 2540
408 Ga0157370_10140342 3300013104 Bacteria 2251
409 Ga0157370_10148643 3300013104 Bacteria 2181
410 Ga0157370_10296106 3300013104 Bacteria 1494
411 Ga0157370_10676888 3300013104 Bacteria 942
412 Ga0157369_10014436 3300013105 Bacteria 8918
413 Ga0157369_10022235 3300013105 Bacteria 7082
414 Ga0157369_10068568 3300013105 Bacteria 3811
415 Ga0157369_10130390 3300013105 Bacteria 2665
416 Ga0157369_10221357 3300013105 Bacteria 1981
417 Ga0157369_10283109 3300013105 Bacteria 1726
418 Ga0157369_10653184 3300013105 Bacteria 1084
419 Ga0157369_10716822 3300013105 Bacteria 1030
420 Ga0157374_10005952 3300013296 Bacteria 10312
421 Ga0157374_10087130 3300013296 Bacteria 2972
422 Ga0157374_10107210 3300013296 Bacteria 2685
423 Ga0157374_10217092 3300013296 Bacteria 1876
424 Ga0157378_10009672 3300013297 Bacteria 8397
425 Ga0157378_10173240 3300013297 Bacteria 2025
426 Ga0157378_10273959 3300013297 Bacteria 1624
427 Ga0163162_10011236 3300013306 Bacteria 8729
428 Ga0163162_10107529 3300013306 Bacteria 2885
429 Ga0163162_10331223 3300013306 Bacteria 1655
430 Ga0157372_10046340 3300013307 Bacteria 4826
431 Ga0157372_10055484 3300013307 Bacteria 4425
432 Ga0157372_10182810 3300013307 Bacteria 2427
433 Ga0157372_10303303 3300013307 Bacteria 1858
434 Ga0157372_10418841 3300013307 Bacteria 1561
435 Ga0157372_10449933 3300013307 Bacteria 1501
436 Ga0157372_10715489 3300013307 Bacteria 1165
437 Ga0157372_10951373 3300013307 Bacteria 996
438 Ga0157372_11182920 3300013307 Bacteria 884
439 Ga0157375_10040452 3300013308 Bacteria 4494
440 Ga0157375_10276648 3300013308 Bacteria 1841
441 Ga0157375_10607234 3300013308 Bacteria 1253
442 Ga0157375_10838577 3300013308 Bacteria 1066
443 Ga0163163_10000131 3300014325 Bacteria 76809
444 Ga0163163_10000169 3300014325 Bacteria 68481
445 Ga0163163_10036317 3300014325 Bacteria 4786
446 Ga0163163_10042057 3300014325 Bacteria 4472
447 Ga0163163_10269310 3300014325 Bacteria 1754
448 Ga0157377_10428421 3300014745 Bacteria 908
449 Ga0157379_10042496 3300014968 Bacteria 4058
450 Ga0157379_10204579 3300014968 Bacteria 1786
451 Ga0157379_10225141 3300014968 Bacteria 1700
452 Ga0157379_10300492 3300014968 Bacteria 1463
453 Ga0157376_10137819 3300014969 Bacteria 2185
454 Ga0163161_10145893 3300017792 Bacteria 1795
455 Ga0163161_10451479 3300017792 Bacteria 1039
456 Ga0207697_10000072 3300025315 Bacteria 43473
457 Ga0207697_10028127 3300025315 Bacteria 2299
458 Ga0207697_10077848 3300025315 Bacteria 1395
459 Ga0207697_10224559 3300025315 Bacteria 829
460 Ga0207697_10287325 3300025315 Bacteria 729
461 Ga0207656_10007053 3300025321 Bacteria 4079
462 Ga0207656_10020820 3300025321 Bacteria 2611
463 Ga0207656_10024253 3300025321 Bacteria 2451
464 Ga0207656_10070331 3300025321 Bacteria 1554
465 Ga0207682_10088368 3300025893 Bacteria 1340
466 Ga0207688_10000289 3300025901 Bacteria 22999
467 Ga0207688_10083390 3300025901 Bacteria 1828
468 Ga0207680_10001493 3300025903 Bacteria 11049
469 Ga0207680_10013727 3300025903 Bacteria 4169
470 Ga0207680_10016032 3300025903 Bacteria 3924
471 Ga0207680_10032903 3300025903 Bacteria 2952
472 Ga0207680_10080524 3300025903 Bacteria 2045
473 Ga0207680_10408662 3300025903 Bacteria 960
474 Ga0207647_10000629 3300025904 Bacteria 27446
475 Ga0207647_10004742 3300025904 Bacteria 10072
476 Ga0207647_10010118 3300025904 Bacteria 6669
477 Ga0207647_10014936 3300025904 Bacteria 5336
478 Ga0207647_10015139 3300025904 Bacteria 5299
479 Ga0207647_10069756 3300025904 Bacteria 2124
480 Ga0207647_10078945 3300025904 Bacteria 1977
481 Ga0207647_10110058 3300025904 Bacteria 1629
482 Ga0207647_10126097 3300025904 Bacteria 1506
483 Ga0207645_10024315 3300025907 Bacteria 3929
484 Ga0207643_10058305 3300025908 Bacteria 2200
485 Ga0207705_10000067 3300025909 Bacteria 136004
486 Ga0207705_10000137 3300025909 Bacteria 79174
487 Ga0207705_10008145 3300025909 Bacteria 7674
488 Ga0207705_10012457 3300025909 Bacteria 6143
489 Ga0207705_10018700 3300025909 Bacteria 4957
490 Ga0207705_10023057 3300025909 Bacteria 4439
491 Ga0207705_10085422 3300025909 Bacteria 2305
492 Ga0207705_10294239 3300025909 Bacteria 1244
493 Ga0207705_10364222 3300025909 Bacteria 1115
494 Ga0207705_10622304 3300025909 Bacteria 839
495 Ga0207654_10048771 3300025911 Bacteria 2425
496 Ga0207707_10065005 3300025912 Bacteria 3177
497 Ga0207707_10099796 3300025912 Bacteria 2537
498 Ga0207707_10105866 3300025912 Bacteria 2459
499 Ga0207707_10121426 3300025912 Bacteria 2284
500 Ga0207707_10340502 3300025912 Bacteria 1293
501 Ga0207695_10024864 3300025913 Bacteria 6722
502 Ga0207695_10442583 3300025913 Bacteria 1183
503 Ga0207671_10025318 3300025914 Bacteria 4457
504 Ga0207671_10296825 3300025914 Bacteria 1276
505 Ga0207660_10000099 3300025917 Bacteria 48138
506 Ga0207660_10127812 3300025917 Bacteria 1931
507 Ga0207660_10156072 3300025917 Bacteria 1757
508 Ga0207660_10194690 3300025917 Bacteria 1580
509 Ga0207660_10196431 3300025917 Bacteria 1574
510 Ga0207660_10372422 3300025917 Bacteria 1147
511 Ga0207660_10711174 3300025917 Bacteria 819
512 Ga0207662_10218004 3300025918 Bacteria 1241
513 Ga0207657_10000508 3300025919 Bacteria 41139
514 Ga0207657_10000552 3300025919 Bacteria 39920
515 Ga0207657_10001819 3300025919 Bacteria 23001
516 Ga0207657_10008540 3300025919 Bacteria 10388
517 Ga0207657_10009745 3300025919 Bacteria 9631
518 Ga0207657_10018598 3300025919 Bacteria 6623
519 Ga0207657_10036840 3300025919 Bacteria 4375
520 Ga0207657_10039000 3300025919 Bacteria 4223
521 Ga0207657_10077648 3300025919 Bacteria 2798
522 Ga0207657_10080529 3300025919 Bacteria 2737
523 Ga0207657_10086457 3300025919 Bacteria 2624
524 Ga0207657_10096165 3300025919 Bacteria 2464
525 Ga0207657_10144270 3300025919 Bacteria 1943
526 Ga0207657_10157112 3300025919 Bacteria 1849
527 Ga0207657_10275821 3300025919 Bacteria 1336
528 Ga0207649_10000186 3300025920 Bacteria 50868
529 Ga0207649_10017380 3300025920 Bacteria 4076
530 Ga0207649_10025411 3300025920 Bacteria 3453
531 Ga0207649_10048894 3300025920 Bacteria 2609
532 Ga0207649_10060825 3300025920 Bacteria 2375
533 Ga0207649_10106586 3300025920 Bacteria 1864
534 Ga0207649_10123308 3300025920 Bacteria 1750
535 Ga0207649_10161326 3300025920 Bacteria 1554
536 Ga0207649_10178690 3300025920 Bacteria 1484
537 Ga0207652_10000058 3300025921 Bacteria 113620
538 Ga0207652_10149277 3300025921 Bacteria 2092
539 Ga0207652_10659449 3300025921 Bacteria 935
540 Ga0207652_11124571 3300025921 Bacteria 686
541 Ga0207681_10003676 3300025923 Bacteria 9535
542 Ga0207681_10168461 3300025923 Bacteria 1658
543 Ga0207681_10381350 3300025923 Bacteria 1135
544 Ga0207694_10013561 3300025924 Bacteria 6140
545 Ga0207694_10111512 3300025924 Bacteria 2176
546 Ga0207694_10410137 3300025924 Bacteria 1127
547 Ga0207650_10005248 3300025925 Bacteria 8836
548 Ga0207650_10016618 3300025925 Bacteria 5145
549 Ga0207650_10032998 3300025925 Bacteria 3747
550 Ga0207650_10047175 3300025925 Bacteria 3174
551 Ga0207650_10076066 3300025925 Bacteria 2535
552 Ga0207650_10078090 3300025925 Bacteria 2504
553 Ga0207650_10453360 3300025925 Bacteria 1068
554 Ga0207659_10004404 3300025926 Bacteria 8511
555 Ga0207659_10113213 3300025926 Bacteria 2066
556 Ga0207659_10362559 3300025926 Bacteria 1205
557 Ga0207687_10001079 3300025927 Bacteria 18514
558 Ga0207687_10028175 3300025927 Bacteria 3773
559 Ga0207687_10054164 3300025927 Bacteria 2805
560 Ga0207644_10024289 3300025931 Bacteria 4159
561 Ga0207644_10032888 3300025931 Bacteria 3621
562 Ga0207644_10048157 3300025931 Bacteria 3045
563 Ga0207644_10049168 3300025931 Bacteria 3017
564 Ga0207644_10050244 3300025931 Bacteria 2988
565 Ga0207644_10175027 3300025931 Bacteria 1678
566 Ga0207644_10219889 3300025931 Bacteria 1505
567 Ga0207690_10000108 3300025932 Bacteria 67599
568 Ga0207690_10002964 3300025932 Bacteria 10222
569 Ga0207690_10004142 3300025932 Bacteria 8569
570 Ga0207690_10017516 3300025932 Bacteria 4375
571 Ga0207690_10025999 3300025932 Bacteria 3684
572 Ga0207690_10043676 3300025932 Bacteria 2951
573 Ga0207690_10051311 3300025932 Bacteria 2758
574 Ga0207690_10103270 3300025932 Bacteria 2040
575 Ga0207690_10121128 3300025932 Bacteria 1901
576 Ga0207690_10245231 3300025932 Bacteria 1381
577 Ga0207690_10245252 3300025932 Bacteria 1381
578 Ga0207690_10258735 3300025932 Bacteria 1348
579 Ga0207690_10263120 3300025932 Bacteria 1337
580 Ga0207690_10312198 3300025932 Bacteria 1233
581 Ga0207690_10624911 3300025932 Bacteria 881
582 Ga0207706_10000514 3300025933 Bacteria 41167
583 Ga0207706_10000816 3300025933 Bacteria 32338
584 Ga0207706_10001018 3300025933 Bacteria 28609
585 Ga0207706_10008582 3300025933 Bacteria 9414
586 Ga0207706_10026502 3300025933 Bacteria 5188
587 Ga0207706_10037007 3300025933 Bacteria 4334
588 Ga0207706_10049706 3300025933 Bacteria 3705
589 Ga0207706_10079281 3300025933 Bacteria 2888
590 Ga0207706_10134521 3300025933 Bacteria 2174
591 Ga0207706_10188857 3300025933 Bacteria 1809
592 Ga0207706_10193587 3300025933 Bacteria 1784
593 Ga0207706_10269405 3300025933 Bacteria 1486
594 Ga0207706_10408409 3300025933 Bacteria 1177
595 Ga0207706_10513710 3300025933 Bacteria 1033
596 Ga0207706_10652043 3300025933 Bacteria 902
597 Ga0207706_10698757 3300025933 Bacteria 866
598 Ga0207706_10791461 3300025933 Bacteria 806
599 Ga0207686_10094114 3300025934 Bacteria 1986
600 Ga0207709_10010054 3300025935 Bacteria 5213
601 Ga0207670_10056018 3300025936 Bacteria 2667
602 Ga0207669_10002756 3300025937 Bacteria 7537
603 Ga0207669_10077021 3300025937 Bacteria 2119
604 Ga0207704_10064883 3300025938 Bacteria 2284
605 Ga0207704_10340243 3300025938 Bacteria 1164
606 Ga0207691_10001562 3300025940 Bacteria 22738
607 Ga0207691_10002265 3300025940 Bacteria 18850
608 Ga0207691_10087413 3300025940 Bacteria 2796
609 Ga0207691_10136207 3300025940 Bacteria 2166
610 Ga0207691_10192153 3300025940 Bacteria 1780
611 Ga0207691_10196229 3300025940 Bacteria 1759
612 Ga0207691_10409686 3300025940 Bacteria 1156
613 Ga0207711_10000105 3300025941 Bacteria 90036
614 Ga0207711_10002153 3300025941 Bacteria 17733
615 Ga0207711_10005548 3300025941 Bacteria 10667
616 Ga0207711_10006893 3300025941 Bacteria 9542
617 Ga0207711_10026581 3300025941 Bacteria 4856
618 Ga0207711_10039957 3300025941 Bacteria 3990
619 Ga0207711_10074999 3300025941 Bacteria 2943
620 Ga0207711_10174168 3300025941 Bacteria 1954
621 Ga0207711_10467986 3300025941 Bacteria 1174
622 Ga0207689_10000051 3300025942 Bacteria 88480
623 Ga0207661_10005828 3300025944 Bacteria 8689
624 Ga0207661_10006577 3300025944 Bacteria 8219
625 Ga0207661_10073023 3300025944 Bacteria 2808
626 Ga0207661_10254276 3300025944 Bacteria 1563
627 Ga0207661_10336113 3300025944 Bacteria 1360
628 Ga0207661_10489905 3300025944 Bacteria 1123
629 Ga0207661_10562013 3300025944 Bacteria 1046
630 Ga0207661_11121525 3300025944 Bacteria 724
631 Ga0207679_10000114 3300025945 Bacteria 64628
632 Ga0207679_10035150 3300025945 Bacteria 3542
633 Ga0207679_10067743 3300025945 Bacteria 2679
634 Ga0207679_10195598 3300025945 Bacteria 1685
635 Ga0207679_10256136 3300025945 Bacteria 1490
636 Ga0207679_10294993 3300025945 Bacteria 1395
637 Ga0207679_10466339 3300025945 Bacteria 1122
638 Ga0207679_10652224 3300025945 Bacteria 952
639 Ga0207679_10919939 3300025945 Bacteria 800
640 Ga0207667_10000828 3300025949 Bacteria 39983
641 Ga0207667_10024815 3300025949 Bacteria 6574
642 Ga0207667_10030403 3300025949 Bacteria 5843
643 Ga0207667_10075674 3300025949 Bacteria 3495
644 Ga0207667_10143406 3300025949 Bacteria 2459
645 Ga0207667_10362401 3300025949 Bacteria 1478
646 Ga0207651_10005577 3300025960 Bacteria 6480
647 Ga0207651_10013218 3300025960 Bacteria 4712
648 Ga0207651_10071298 3300025960 Bacteria 2462
649 Ga0207651_10089315 3300025960 Bacteria 2249
650 Ga0207651_10130041 3300025960 Bacteria 1925
651 Ga0207712_10043521 3300025961 Bacteria 3098
652 Ga0207640_10000999 3300025981 Bacteria 15663
653 Ga0207640_10004989 3300025981 Bacteria 7214
654 Ga0207640_10006687 3300025981 Bacteria 6333
655 Ga0207640_10009679 3300025981 Bacteria 5405
656 Ga0207640_10017692 3300025981 Bacteria 4175
657 Ga0207640_10257824 3300025981 Bacteria 1357
658 Ga0207640_10263407 3300025981 Bacteria 1345
659 Ga0207640_11134713 3300025981 Bacteria 693
660 Ga0207658_10002159 3300025986 Bacteria 14623
661 Ga0207658_10002297 3300025986 Bacteria 14112
662 Ga0207658_10004192 3300025986 Bacteria 10047
663 Ga0207658_10005799 3300025986 Bacteria 8453
664 Ga0207658_10017839 3300025986 Bacteria 4891
665 Ga0207658_10046761 3300025986 Bacteria 3162
666 Ga0207658_10669092 3300025986 Bacteria 937
667 Ga0207658_10986883 3300025986 Bacteria 768
668 Ga0207677_10001693 3300026023 Bacteria 11664
669 Ga0207677_10005567 3300026023 Bacteria 6840
670 Ga0207677_10128788 3300026023 Bacteria 1918
671 Ga0207677_10154050 3300026023 Bacteria 1777
672 Ga0207677_10666791 3300026023 Bacteria 920
673 Ga0207703_10005297 3300026035 Bacteria 10395
674 Ga0207703_10005508 3300026035 Bacteria 10174
675 Ga0207703_10006841 3300026035 Bacteria 9082
676 Ga0207703_10015590 3300026035 Bacteria 5928
677 Ga0207703_10030088 3300026035 Bacteria 4289
678 Ga0207703_10067103 3300026035 Bacteria 2952
679 Ga0207703_10443738 3300026035 Bacteria 1211
680 Ga0207639_10000139 3300026041 Bacteria 54240
681 Ga0207639_10001476 3300026041 Bacteria 15830
682 Ga0207639_10002396 3300026041 Bacteria 12576
683 Ga0207639_10110209 3300026041 Bacteria 2242
684 Ga0207639_10235074 3300026041 Bacteria 1591
685 Ga0207639_10461931 3300026041 Bacteria 1154
686 Ga0207639_11061659 3300026041 Bacteria 759
687 Ga0207678_10000278 3300026067 Bacteria 46335
688 Ga0207678_10000321 3300026067 Bacteria 43233
689 Ga0207678_10002094 3300026067 Bacteria 18070
690 Ga0207678_10018288 3300026067 Bacteria 6154
691 Ga0207678_10029027 3300026067 Bacteria 4827
692 Ga0207678_10062145 3300026067 Bacteria 3211
693 Ga0207678_10102127 3300026067 Bacteria 2448
694 Ga0207678_10235738 3300026067 Bacteria 1567
695 Ga0207678_10779964 3300026067 Bacteria 843
696 Ga0207702_10001266 3300026078 Bacteria 25382
697 Ga0207702_10028183 3300026078 Bacteria 4666
698 Ga0207702_10133484 3300026078 Bacteria 2237
699 Ga0207702_10140961 3300026078 Bacteria 2181
700 Ga0207702_10188818 3300026078 Bacteria 1902
701 Ga0207702_10248851 3300026078 Bacteria 1668
702 Ga0207702_11420818 3300026078 Bacteria 688
703 Ga0207641_10000172 3300026088 Bacteria 90549
704 Ga0207641_10025141 3300026088 Bacteria 4909
705 Ga0207641_10031805 3300026088 Bacteria 4378
706 Ga0207641_10047185 3300026088 Bacteria 3631
707 Ga0207641_10053288 3300026088 Bacteria 3428
708 Ga0207641_10078400 3300026088 Bacteria 2861
709 Ga0207641_10188055 3300026088 Bacteria 1896
710 Ga0207641_10319328 3300026088 Bacteria 1472
711 Ga0207648_10000221 3300026089 Bacteria 61280
712 Ga0207648_10005512 3300026089 Bacteria 12759
713 Ga0207676_10000898 3300026095 Bacteria 23098
714 Ga0207676_10002758 3300026095 Bacteria 12490
715 Ga0207676_10008169 3300026095 Bacteria 7443
716 Ga0207676_10068951 3300026095 Bacteria 2830
717 Ga0207676_10191109 3300026095 Bacteria 1801
718 Ga0207676_10535911 3300026095 Bacteria 1116
719 Ga0207674_10001223 3300026116 Bacteria 33472
720 Ga0207674_10005246 3300026116 Bacteria 15422
721 Ga0207674_10005279 3300026116 Bacteria 15376
722 Ga0207674_10020585 3300026116 Bacteria 7123
723 Ga0207674_10021077 3300026116 Bacteria 7029
724 Ga0207674_10028871 3300026116 Bacteria 5847
725 Ga0207674_10043317 3300026116 Bacteria 4642
726 Ga0207674_10123007 3300026116 Bacteria 2560
727 Ga0207674_10145224 3300026116 Bacteria 2331
728 Ga0207674_10199898 3300026116 Bacteria 1948
729 Ga0207674_10219461 3300026116 Bacteria 1849
730 Ga0207674_10416532 3300026116 Bacteria 1298
731 Ga0207674_10524517 3300026116 Bacteria 1144
732 Ga0207683_10009875 3300026121 Bacteria 8141
733 Ga0207683_10040016 3300026121 Bacteria 4089
734 Ga0207683_10160104 3300026121 Bacteria 2034
735 Ga0207683_10388645 3300026121 Bacteria 1283
736 Ga0207698_10000598 3300026142 Bacteria 21116
737 Ga0207698_10008526 3300026142 Bacteria 6493
738 Ga0207698_10019756 3300026142 Bacteria 4620
739 Ga0207698_10036328 3300026142 Bacteria 3615
740 Ga0207698_10037937 3300026142 Bacteria 3554
741 Ga0207698_10040743 3300026142 Bacteria 3455
742 Ga0207698_10055984 3300026142 Bacteria 3043
743 Ga0207698_10294109 3300026142 Bacteria 1509
744 Ga0207698_10376815 3300026142 Bacteria 1349
745 Ga0209974_10003135 3300027876 Bacteria 5986
746 Ga0268266_10000200 3300028379 Bacteria 104456
747 Ga0268266_10021481 3300028379 Bacteria 5498
748 Ga0268266_10229813 3300028379 Bacteria 1708
749 Ga0268266_11203420 3300028379 Bacteria 733
750 Ga0268265_10007828 3300028380 Bacteria 7211
751 Ga0268265_10040913 3300028380 Bacteria 3425
752 Ga0268265_10095317 3300028380 Bacteria 2389
753 Ga0268265_10108363 3300028380 Bacteria 2261
754 Ga0268265_10115816 3300028380 Bacteria 2198
755 Ga0268265_10417391 3300028380 Bacteria 1245
756 Ga0268264_10001019 3300028381 Bacteria 28201
757 Ga0268264_10023910 3300028381 Bacteria 4984
758 Ga0268264_10040961 3300028381 Bacteria 3829
759 Ga0268264_10055223 3300028381 Bacteria 3318
760 Ga0268264_10389472 3300028381 Bacteria 1336
761 Ga0307515_10571179 3300028794 Bacteria 741
762 Ga0307513_10078700 3300031456 Bacteria 3409
763 Ga0307408_100119559 3300031548 Bacteria 2039
764 Ga0307405_10305177 3300031731 Bacteria 1209
765 Ga0307405_10397325 3300031731 Bacteria 1078
766 Ga0307413_10061476 3300031824 Bacteria 2318
767 Ga0307413_10240180 3300031824 Bacteria 1337
768 Ga0307413_10655646 3300031824 Bacteria 866
769 Ga0307406_10177515 3300031901 Bacteria 1547
770 Ga0307412_10182381 3300031911 Bacteria 1580
771 Ga0307409_100311476 3300031995 Bacteria 1469
772 Ga0307416_100286682 3300032002 Bacteria 1627
773 Ga0307416_100340645 3300032002 Bacteria 1512
774 Ga0307416_100685970 3300032002 Bacteria 1112
775 Ga0307416_101073528 3300032002 Bacteria 909
776 Ga0307414_10703437 3300032004 Bacteria 915
777 Ga0307415_100155951 3300032126 Bacteria 1763
778 Ga0373930_0042321 3300034816 Bacteria 974
779 Ga0373961_0077501 3300035241 Bacteria 1040
780 Ga0373931_0012293 3300035691 Bacteria 4144
781 Ga0373931_0187973 3300035691 Bacteria 1227
782 Ga0373931_0204536 3300035691 Bacteria 1181
783 Ga0373937_0163968 3300036401 Bacteria 2084
784 Ga0373937_0959469 3300036401 Bacteria 804
785 Ga0395899_0000157 3300037312 Bacteria 103574
786 Ga0395899_0002294 3300037312 Bacteria 15602
787 Ga0395899_0004063 3300037312 Bacteria 11532
788 Ga0395899_0039306 3300037312 Bacteria 3541
789 Ga0395899_0097215 3300037312 Bacteria 2129
790 Ga0395899_0102041 3300037312 Bacteria 2070
791 Ga0395899_0141461 3300037312 Bacteria 1711
792 Ga0395899_0165267 3300037312 Bacteria 1561
793 Ga0395900_0000296 3300037418 Bacteria 74995
794 Ga0395900_0004777 3300037418 Bacteria 14277
795 Ga0395900_0006847 3300037418 Bacteria 11827
796 Ga0395900_0008602 3300037418 Bacteria 10487
797 Ga0395900_0020243 3300037418 Bacteria 6790
798 Ga0395900_0024324 3300037418 Bacteria 6201
799 Ga0395900_0030776 3300037418 Bacteria 5511
800 Ga0395900_0047847 3300037418 Bacteria 4405
801 Ga0395900_0049032 3300037418 Bacteria 4350
802 Ga0395900_0051556 3300037418 Bacteria 4238
803 Ga0395900_0138822 3300037418 Bacteria 2490
804 Ga0395900_0230242 3300037418 Bacteria 1864
805 Ga0395900_0330047 3300037418 Bacteria 1504
806 Ga0395900_0390515 3300037418 Bacteria 1358
807 Ga0395900_0423124 3300037418 Bacteria 1292
808 Ga0395898_0000054 3300037466 Bacteria 279561
809 Ga0395898_0002796 3300037466 Bacteria 20008
810 Ga0395898_0014959 3300037466 Bacteria 7967
811 Ga0395898_0074159 3300037466 Bacteria 3287
812 Ga0395898_0079240 3300037466 Bacteria 3169
813 Ga0395898_0087368 3300037466 Bacteria 3003
814 Ga0395898_0244412 3300037466 Bacteria 1711
815 Ga0395898_0315879 3300037466 Bacteria 1490
816 Ga0395905_0000046 3300037471 Bacteria 240463
817 Ga0395905_0000232 3300037471 Bacteria 84233
818 Ga0395905_0007745 3300037471 Bacteria 10651
819 Ga0395905_0019500 3300037471 Bacteria 6427
820 Ga0395905_0034124 3300037471 Bacteria 4777
821 Ga0395905_0043209 3300037471 Bacteria 4228
822 Ga0395905_0061256 3300037471 Bacteria 3520
823 Ga0395905_0097840 3300037471 Bacteria 2755
824 Ga0395905_0097888 3300037471 Bacteria 2754
825 Ga0395905_0115344 3300037471 Bacteria 2524
826 Ga0395905_0160705 3300037471 Bacteria 2111
827 Ga0395905_0169728 3300037471 Bacteria 2049
828 Ga0395905_0339351 3300037471 Bacteria 1393
829 Ga0395905_0357881 3300037471 Bacteria 1352
830 Ga0395905_0385178 3300037471 Bacteria 1296
831 Ga0395905_0454476 3300037471 Bacteria 1179
832 Ga0395901_0000086 3300038443 Bacteria 125359
833 Ga0395901_0000102 3300038443 Bacteria 115611
834 Ga0395901_0001796 3300038443 Bacteria 22137
835 Ga0395901_0003125 3300038443 Bacteria 16632
836 Ga0395901_0008693 3300038443 Bacteria 10262
837 Ga0395901_0026965 3300038443 Bacteria 5899
838 Ga0395901_0045169 3300038443 Bacteria 4570
839 Ga0395901_0079721 3300038443 Bacteria 3419
840 Ga0395901_0183524 3300038443 Bacteria 2194
841 Ga0395901_0422872 3300038443 Bacteria 1366
842 Ga0395901_0477825 3300038443 Bacteria 1271
843 Ga0395901_0596953 3300038443 Bacteria 1114
844 Ga0395901_1234943 3300038443 Bacteria 712
845 Ga0436365_1846725 3300039437 Bacteria 6360
846 Ga0439448_0002775 3300042005 Bacteria 4790
847 Ga0439458_0000023 3300042157 Bacteria 23385
848 Ga0466969_0053298 3300044656 Bacteria 1985
849 Ga0466972_0051383 3300044658 Bacteria 1989
850 Ga0466965_0248390 3300044683 Bacteria 954
851 Ga0466966_0052874 3300044684 Bacteria 2578
852 Ga0466966_0409481 3300044684 Bacteria 815
853 Ga0466963_0007060 3300044694 Bacteria 6687
854 Ga0466963_0037968 3300044694 Bacteria 3148
855 Ga0466963_0137362 3300044694 Bacteria 1692
856 Ga0466963_0142550 3300044694 Bacteria 1661
857 Ga0466963_0152580 3300044694 Bacteria 1605
858 Ga0466963_0417294 3300044694 Bacteria 947
859 Ga0466964_0053968 3300044706 Bacteria 1656
860 Ga0466970_0234235 3300044765 Bacteria 1027
861 Ga0466957_0096277 3300044842 Bacteria 1860
862 Ga0466957_0108806 3300044842 Bacteria 1756
863 Ga0466957_0627291 3300044842 Bacteria 754
864 Ga0466960_0040970 3300044901 Bacteria 2192
865 Ga0466960_0412356 3300044901 Bacteria 780
866 Ga0466959_0022141 3300045049 Bacteria 4695
867 Ga0466967_0010597 3300045976 Bacteria 6925
868 Ga0466967_0010807 3300045976 Bacteria 6870
869 Ga0466967_0014326 3300045976 Bacteria 6171
870 Ga0466967_0085183 3300045976 Bacteria 2861
871 Ga0466967_0114551 3300045976 Bacteria 2482
872 Ga0466967_0295069 3300045976 Bacteria 1558
873 Ga0466967_0659384 3300045976 Bacteria 1035
874 Ga0466967_0666754 3300045976 Bacteria 1029
875 Ga0495582_0269561 3300046473 Bacteria 977
876 Ga0495663_0018269 3300046525 Bacteria 1996
877 Ga0495642_0051683 3300046528 Bacteria 1691
878 Ga0495598_0000366 3300046537 Bacteria 8101
879 Ga0495621_0000027 3300046539 Bacteria 28040
880 Ga0495633_0104951 3300046558 Bacteria 1311
881 Ga0495668_0033384 3300046616 Bacteria 2891
882 Ga0495668_0315711 3300046616 Bacteria 857
883 Ga0495625_0291827 3300046660 Bacteria 1046
884 Ga0495647_0043213 3300046681 Bacteria 1724
885 Ga0495669_0000648 3300046684 Bacteria 15172
886 Ga0495669_0005679 3300046684 Bacteria 5204
887 Ga0495669_0020498 3300046684 Bacteria 2863
888 Ga0495669_0020519 3300046684 Bacteria 2861
889 Ga0495669_0038294 3300046684 Bacteria 2123
890 Ga0495669_0045422 3300046684 Bacteria 1958
891 Ga0495669_0083505 3300046684 Bacteria 1468
892 Ga0495670_0000419 3300046691 Bacteria 20409
893 Ga0495687_127407 3300047443 Bacteria 908
894 Ga0495677_0006249 3300047445 Bacteria 4496
895 Ga0496100_0006760 3300048903 Bacteria 6279
896 Ga0496100_0024299 3300048903 Bacteria 3695
897 Ga0496100_0077240 3300048903 Bacteria 2238
898 Ga0496101_0028317 3300048904 Bacteria 3910
899 Ga0496101_0034507 3300048904 Bacteria 3573
900 Ga0496101_0062189 3300048904 Bacteria 2714
901 Ga0496102_0201758 3300048905 Bacteria 1875
902 Ga0496102_0509992 3300048905 Bacteria 1125
903 Ga0496102_0677616 3300048905 Bacteria 954
904 Ga0496104_0228229 3300048907 Bacteria 1774
905 Ga0496105_0429349 3300048908 Bacteria 1045
906 Ga0496106_0250019 3300048909 Bacteria 1417
907 Ga0496107_0026600 3300048910 Bacteria 4102
908 Ga0496107_0329318 3300048910 Bacteria 1136
909 Ga0496107_0491885 3300048910 Bacteria 910
910 Ga0496107_0602693 3300048910 Bacteria 812
911 Ga0496108_0020881 3300048911 Bacteria 5385
912 Ga0496108_0028757 3300048911 Bacteria 4598
913 Ga0496109_0018758 3300048912 Bacteria 6083
914 Ga0496109_0027142 3300048912 Bacteria 5110
915 Ga0496109_0330918 3300048912 Bacteria 1438
916 Ga0496109_0510234 3300048912 Bacteria 1135
917 Ga0496110_0002541 3300048913 Bacteria 13719
918 Ga0496110_0469898 3300048913 Bacteria 1146
919 Ga0496111_0017327 3300048914 Bacteria 4980
920 Ga0496111_0289920 3300048914 Bacteria 1214
921 Ga0496112_0044335 3300048915 Bacteria 4357
922 Ga0496112_0216318 3300048915 Bacteria 1872
923 Ga0496112_0591918 3300048915 Bacteria 1041
924 Ga0496113_0057805 3300048916 Bacteria 2916
925 Ga0496113_0068373 3300048916 Bacteria 2695
926 Ga0496113_0141605 3300048916 Bacteria 1892
927 Ga0496114_0031860 3300048917 Bacteria 4337
928 Ga0496114_0043215 3300048917 Bacteria 3737
929 Ga0501067_0163257 3300049583 Bacteria 1240
930 Ga0501069_0164639 3300049585 Bacteria 1278
931 Ga0501071_0252784 3300049587 Bacteria 1331
932 Ga0501074_0019492 3300049590 Bacteria 4926
933 Ga0501074_0489136 3300049590 Bacteria 872
934 Ga0501080_0102531 3300049742 Bacteria 2654
935 Ga0501080_0174399 3300049742 Bacteria 1982
936 nmdc:mga08y16_298687_c1 3300050511 Bacteria 1660
937 Ga0500658_0000032 3300053134 Bacteria 90863
938 Ga0307410_10183167
939 JGI24736J21556_1001761
940 JGI24741J21665_1007010
941 JGI24741J21665_1008951
942 JGI24740J21852_10008870
943 JGI24740J21852_10010728
944 JGI24740J21852_10011657
945 JGI24740J21852_10014558
946 JGI24740J21852_10049411
947 JGI24739J22299_10003668
948 JGI24739J22299_10026139
949 JGI24737J22298_10000027
950 JGI24737J22298_10002717
951 JGI24737J22298_10009047
952 JGI24737J22298_10015505
953 JGI24737J22298_10043043
954 JGI24735J21928_10013682
955 JGI24735J21928_10068611
956 JGI24735J21928_10077855
957 JGI24748J21848_1005841
958 JGI24738J21930_10000290
959 JGI24738J21930_10000704
960 JGI24034J26672_10020372
961 JGI24742J22300_10020331
962 Ga0065714_10031798
963 Ga0065712_10183480
964 Ga0065712_10215761
965 Ga0070658_10000177
966 Ga0070658_10000256
967 Ga0070658_10020304
968 Ga0070658_10022765
969 Ga0070658_10162922
970 Ga0070658_10429013
971 Ga0070658_10973881
972 Ga0070676_10021238
973 Ga0070676_10141676
974 Ga0070676_10666096
975 Ga0070683_100000686
976 Ga0070683_100003873
977 Ga0070683_100050239
978 Ga0070683_100072541
979 Ga0070683_100234693
980 Ga0070683_100316563
981 Ga0070683_100374073
982 Ga0070683_100955734
983 Ga0070690_100027952
984 Ga0070690_100044875
985 Ga0070670_100016168
986 Ga0070670_100018943
987 Ga0070670_100062322
988 Ga0070670_100163395
989 Ga0070670_100177462
990 Ga0070670_100269695
991 Ga0070670_100489360
992 Ga0070677_10070847
993 Ga0068869_100000085
994 Ga0070666_10002604
995 Ga0070666_10003935
996 Ga0070666_10038740
997 Ga0070666_10076658
998 Ga0070666_10180548
999 Ga0070666_10374340
1000 Ga0070680_100000105
1001 Ga0070680_100000468
1002 Ga0070680_100028233
1003 Ga0070680_100229266
1004 Ga0070680_100316445
1005 Ga0070682_100077142
1006 Ga0070682_100096718
1007 Ga0070682_100282225
1008 Ga0068868_100002300
1009 Ga0068868_100048116
1010 Ga0068868_100060350
1011 Ga0068868_100116361
1012 Ga0068868_100321585
1013 Ga0068868_100851844
1014 Ga0070660_100000064
1015 Ga0070660_100000065
1016 Ga0070660_100000881
1017 Ga0070660_100023060
1018 Ga0070660_100035333
1019 Ga0070660_100042976
1020 Ga0070660_100062476
1021 Ga0070660_100065454
1022 Ga0070660_100073471
1023 Ga0070660_100083678
1024 Ga0070660_100121670
1025 Ga0070660_100144466
1026 Ga0070660_100151365
1027 Ga0070660_100167216
1028 Ga0070660_100175796
1029 Ga0070660_100219532
1030 Ga0070660_100392196
1031 Ga0070689_100096115
1032 Ga0070689_100847327
1033 Ga0070687_100211280
1034 Ga0070661_100000084
1035 Ga0070661_100013397
1036 Ga0070661_100026745
1037 Ga0070661_100109120
1038 Ga0070661_100185953
1039 Ga0070661_100220098
1040 Ga0070661_100276485
1041 Ga0070661_100285762
1042 Ga0070661_100339304
1043 Ga0070661_100455738
1044 Ga0070692_10006763
1045 Ga0070692_10050515
1046 Ga0070668_100017746
1047 Ga0070668_100128357
1048 Ga0070669_100000693
1049 Ga0070669_100021053
1050 Ga0070669_100108014
1051 Ga0070669_100172090
1052 Ga0070669_100341331
1053 Ga0070675_100007745
1054 Ga0070675_100068433
1055 Ga0070675_100468954
1056 Ga0070671_100002311
1057 Ga0070671_100019717
1058 Ga0070671_100036716
1059 Ga0070671_100053853
1060 Ga0070671_100103405
1061 Ga0070671_100298758
1062 Ga0070671_100825410
1063 Ga0070674_100061388
1064 Ga0070674_100080724
1065 Ga0070674_100402059
1066 Ga0070673_100000376
1067 Ga0070673_100000450
1068 Ga0070673_100196773
1069 Ga0070673_100236826
1070 Ga0070688_100718488
1071 Ga0070659_100000525
1072 Ga0070659_100001520
1073 Ga0070659_100006328
1074 Ga0070659_100008959
1075 Ga0070659_100014437
1076 Ga0070659_100017555
1077 Ga0070659_100020517
1078 Ga0070659_100035708
1079 Ga0070659_100079644
1080 Ga0070659_100123586
1081 Ga0070659_100146692
1082 Ga0070659_100175757
1083 Ga0070659_100935084
1084 Ga0070659_100995614
1085 Ga0070667_100003791
1086 Ga0070667_100004748
1087 Ga0070667_100009183
1088 Ga0070667_100016562
1089 Ga0070667_100022180
1090 Ga0070667_100028643
1091 Ga0070667_100263609
1092 Ga0070701_10176659
1093 Ga0070663_100000033
1094 Ga0070663_100000701
1095 Ga0070663_100020653
1096 Ga0070663_100047532
1097 Ga0070663_100049110
1098 Ga0070663_100228312
1099 Ga0070663_100363311
1100 Ga0070678_100021253
1101 Ga0070662_100000017
1102 Ga0070662_100000337
1103 Ga0070662_100002326
1104 Ga0070662_100007419
1105 Ga0070662_100052969
1106 Ga0070662_100057399
1107 Ga0070662_100121293
1108 Ga0070662_100158648
1109 Ga0070662_100178251
1110 Ga0070662_100239726
1111 Ga0070662_100405224
1112 Ga0070662_100619845
1113 Ga0070681_10147488
1114 Ga0070681_10158073
1115 Ga0070681_10187293
1116 Ga0070681_10330725
1117 Ga0070681_10335655
1118 Ga0070681_10496321
1119 Ga0068867_100000661
1120 Ga0068867_100017629
1121 Ga0068867_100120327
1122 Ga0068867_100775382
1123 Ga0070685_10187435
1124 Ga0070685_10670710
1125 Ga0070679_100000125
1126 Ga0070679_100160520
1127 Ga0070679_100210860
1128 Ga0070679_100295648
1129 Ga0070679_100327552
1130 Ga0070684_100014356
1131 Ga0070684_100032578
1132 Ga0070684_100048674
1133 Ga0070684_100229098
1134 Ga0070684_100308102
1135 Ga0070684_100317512
1136 Ga0068853_100000703
1137 Ga0068853_100002455
1138 Ga0068853_100019401
1139 Ga0068853_100092375
1140 Ga0068853_100130212
1141 Ga0068853_100156838
1142 Ga0068853_100181917
1143 Ga0068853_100198190
1144 Ga0068853_100206360
1145 Ga0068853_100234696
1146 Ga0068853_100258667
1147 Ga0068853_100333860
1148 Ga0068853_100668853
1149 Ga0068853_100695352
1150 Ga0070672_100000476
1151 Ga0070672_100008105
1152 Ga0070672_100026712
1153 Ga0070672_100120656
1154 Ga0070672_100132807
1155 Ga0070672_100151181
1156 Ga0070672_100822963
1157 Ga0070686_100024287
1158 Ga0070693_100001690
1159 Ga0070693_100077317
1160 Ga0070693_100122132
1161 Ga0070693_100146278
1162 Ga0070665_100001860
1163 Ga0070665_100008788
1164 Ga0070665_100039045
1165 Ga0070665_100042584
1166 Ga0070665_100240903
1167 Ga0070665_100927814
1168 Ga0068855_100000194
1169 Ga0068855_100001289
1170 Ga0068855_100003759
1171 Ga0068855_100024723
1172 Ga0070664_100000098
1173 Ga0070664_100006436
1174 Ga0070664_100019681
1175 Ga0070664_100022986
1176 Ga0070664_100056039
1177 Ga0070664_100123321
1178 Ga0070664_100132675
1179 Ga0070664_100174574
1180 Ga0070664_100238337
1181 Ga0070664_100275604
1182 Ga0070664_100646734
1183 Ga0070664_101015498
1184 Ga0068857_100000665
1185 Ga0068857_100007380
1186 Ga0068857_100016423
1187 Ga0068857_100033361
1188 Ga0068857_100037630
1189 Ga0068857_100055046
1190 Ga0068857_100153538
1191 Ga0068857_100201847
1192 Ga0068857_100273227
1193 Ga0068857_100388447
1194 Ga0068857_100548396
1195 Ga0068857_100664959
1196 Ga0068854_100000173
1197 Ga0068854_100005007
1198 Ga0068854_100006044
1199 Ga0068854_100014434
1200 Ga0068854_100031998
1201 Ga0068854_100074884
1202 Ga0068854_100090666
1203 Ga0068856_100000098
1204 Ga0068856_100079659
1205 Ga0068856_100143854
1206 Ga0068856_100445962
1207 Ga0068852_100000305
1208 Ga0068852_100000440
1209 Ga0068852_100001638
1210 Ga0068852_100015427
1211 Ga0068852_100023774
1212 Ga0068852_100061550
1213 Ga0068852_100115465
1214 Ga0068852_100132658
1215 Ga0068852_100314935
1216 Ga0068852_100421902
1217 Ga0068852_100450744
1218 Ga0068859_100001231
1219 Ga0068859_100006954
1220 Ga0068859_100013585
1221 Ga0068859_100016998
1222 Ga0068859_100150356
1223 Ga0068859_100155998
1224 Ga0068859_100320839
1225 Ga0068864_100000953
1226 Ga0068864_100005001
1227 Ga0068864_100007173
1228 Ga0068864_100041313
1229 Ga0068864_100049155
1230 Ga0068864_100495632
1231 Ga0068866_10062715
1232 Ga0068866_10461201
1233 Ga0068861_100745590
1234 Ga0068851_10001580
1235 Ga0068851_10011809
1236 Ga0068851_10032269
1237 Ga0068851_10074576
1238 Ga0068863_100001401
1239 Ga0068863_100003718
1240 Ga0068863_100004123
1241 Ga0068863_100041431
1242 Ga0068863_100108956
1243 Ga0068863_100200401
1244 Ga0068858_100000695
1245 Ga0068858_100001052
1246 Ga0068858_100018849
1247 Ga0068858_100028003
1248 Ga0068858_100045545
1249 Ga0068858_100068509
1250 Ga0068860_100005142
1251 Ga0068860_100005163
1252 Ga0068860_100007383
1253 Ga0068860_100013811
1254 Ga0068860_100095372
1255 Ga0068860_100129719
1256 Ga0068860_100443975
1257 Ga0068860_100562506
1258 Ga0068860_100595960
1259 Ga0068860_100669708
1260 Ga0068860_101110481
1261 Ga0068862_100011824
1262 Ga0068862_100024286
1263 Ga0068862_100040300
1264 Ga0068862_100128353
1265 Ga0068862_100145331
1266 Ga0070712_100377463
1267 Ga0097621_100021272
1268 Ga0097621_100052581
1269 Ga0097621_100108662
1270 Ga0097621_100304904
1271 Ga0097621_100416499
1272 Ga0097621_100496959
1273 Ga0068871_100055253
1274 Ga0068871_100067514
1275 Ga0068871_100134859
1276 Ga0068871_100471397
1277 Ga0068865_100000263
1278 Ga0068865_100068775
1279 Ga0068865_100533465
1280 Ga0097620_100001231
1281 Ga0097620_100006954
1282 Ga0097620_100013585
1283 Ga0097620_100016999
1284 Ga0097620_100150354
1285 Ga0097620_100155996
1286 Ga0097620_100320832
1287 Ga0105250_10085987
1288 Ga0105240_10024667
1289 Ga0105240_10349346
1290 Ga0111539_10500823
1291 Ga0105245_10000170
1292 Ga0105245_10022139
1293 Ga0105245_10046821
1294 Ga0105247_10025079
1295 Ga0105241_10101665
1296 Ga0105242_10111248
1297 Ga0105242_10279764
1298 Ga0105242_10292092
1299 Ga0105242_10362549
1300 Ga0105248_10000184
1301 Ga0105248_10000444
1302 Ga0105248_10001388
1303 Ga0105248_10002857
1304 Ga0105248_10009540
1305 Ga0105248_10013149
1306 Ga0105248_10233904
1307 Ga0105248_10241736
1308 Ga0105248_10244152
1309 Ga0105237_10087792
1310 Ga0105237_10436089
1311 Ga0105238_10011487
1312 Ga0105238_10093095
1313 Ga0105238_10189951
1314 Ga0105238_10424693
1315 Ga0105249_10028703
1316 Ga0105249_10039995
1317 Ga0105239_10030847
1318 Ga0105239_10310956
1319 Ga0105239_10482562
1320 Ga0105246_10367803
1321 Ga0157373_10050961
1322 Ga0157373_10094845
1323 Ga0157373_10105014
1324 Ga0157373_10136155
1325 Ga0157373_10138979
1326 Ga0157373_10160085
1327 Ga0157373_10196779
1328 Ga0157373_10270299
1329 Ga0157373_10342205
1330 Ga0157373_10502457
1331 Ga0157371_10002003
1332 Ga0157371_10002538
1333 Ga0157371_10032813
1334 Ga0157371_10039501
1335 Ga0157371_10082625
1336 Ga0157371_10098819
1337 Ga0157371_10129211
1338 Ga0157371_10130394
1339 Ga0157371_10174748
1340 Ga0157371_10218009
1341 Ga0157371_10646112
1342 Ga0157370_10004682
1343 Ga0157370_10063558
1344 Ga0157370_10112848
1345 Ga0157370_10140342
1346 Ga0157370_10148643
1347 Ga0157370_10296106
1348 Ga0157370_10676888
1349 Ga0157369_10014436
1350 Ga0157369_10022235
1351 Ga0157369_10068568
1352 Ga0157369_10130390
1353 Ga0157369_10221357
1354 Ga0157369_10283109
1355 Ga0157369_10653184
1356 Ga0157369_10716822
1357 Ga0157374_10005952
1358 Ga0157374_10087130
1359 Ga0157374_10107210
1360 Ga0157374_10217092
1361 Ga0157378_10009672
1362 Ga0157378_10173240
1363 Ga0157378_10273959
1364 Ga0163162_10011236
1365 Ga0163162_10107529
1366 Ga0163162_10331223
1367 Ga0157372_10046340
1368 Ga0157372_10055484
1369 Ga0157372_10182810
1370 Ga0157372_10303303
1371 Ga0157372_10418841
1372 Ga0157372_10449933
1373 Ga0157372_10715489
1374 Ga0157372_10951373
1375 Ga0157372_11182920
1376 Ga0157375_10040452
1377 Ga0157375_10276648
1378 Ga0157375_10607234
1379 Ga0157375_10838577
1380 Ga0163163_10000131
1381 Ga0163163_10000169
1382 Ga0163163_10036317
1383 Ga0163163_10042057
1384 Ga0163163_10269310
1385 Ga0157377_10428421
1386 Ga0157379_10042496
1387 Ga0157379_10204579
1388 Ga0157379_10225141
1389 Ga0157379_10300492
1390 Ga0157376_10137819
1391 Ga0163161_10145893
1392 Ga0163161_10451479
1393 Ga0207697_10000072
1394 Ga0207697_10028127
1395 Ga0207697_10077848
1396 Ga0207697_10224559
1397 Ga0207697_10287325
1398 Ga0207656_10007053
1399 Ga0207656_10020820
1400 Ga0207656_10024253
1401 Ga0207656_10070331
1402 Ga0207682_10088368
1403 Ga0207688_10000289
1404 Ga0207688_10083390
1405 Ga0207680_10001493
1406 Ga0207680_10013727
1407 Ga0207680_10016032
1408 Ga0207680_10032903
1409 Ga0207680_10080524
1410 Ga0207680_10408662
1411 Ga0207647_10000629
1412 Ga0207647_10004742
1413 Ga0207647_10010118
1414 Ga0207647_10014936
1415 Ga0207647_10015139
1416 Ga0207647_10069756
1417 Ga0207647_10078945
1418 Ga0207647_10110058
1419 Ga0207647_10126097
1420 Ga0207645_10024315
1421 Ga0207643_10058305
1422 Ga0207705_10000067
1423 Ga0207705_10000137
1424 Ga0207705_10008145
1425 Ga0207705_10012457
1426 Ga0207705_10018700
1427 Ga0207705_10023057
1428 Ga0207705_10085422
1429 Ga0207705_10294239
1430 Ga0207705_10364222
1431 Ga0207705_10622304
1432 Ga0207654_10048771
1433 Ga0207707_10065005
1434 Ga0207707_10099796
1435 Ga0207707_10105866
1436 Ga0207707_10121426
1437 Ga0207707_10340502
1438 Ga0207695_10024864
1439 Ga0207695_10442583
1440 Ga0207671_10025318
1441 Ga0207671_10296825
1442 Ga0207660_10000099
1443 Ga0207660_10127812
1444 Ga0207660_10156072
1445 Ga0207660_10194690
1446 Ga0207660_10196431
1447 Ga0207660_10372422
1448 Ga0207660_10711174
1449 Ga0207662_10218004
1450 Ga0207657_10000508
1451 Ga0207657_10000552
1452 Ga0207657_10001819
1453 Ga0207657_10008540
1454 Ga0207657_10009745
1455 Ga0207657_10018598
1456 Ga0207657_10036840
1457 Ga0207657_10039000
1458 Ga0207657_10077648
1459 Ga0207657_10080529
1460 Ga0207657_10086457
1461 Ga0207657_10096165
1462 Ga0207657_10144270
1463 Ga0207657_10157112
1464 Ga0207657_10275821
1465 Ga0207649_10000186
1466 Ga0207649_10017380
1467 Ga0207649_10025411
1468 Ga0207649_10048894
1469 Ga0207649_10060825
1470 Ga0207649_10106586
1471 Ga0207649_10123308
1472 Ga0207649_10161326
1473 Ga0207649_10178690
1474 Ga0207652_10000058
1475 Ga0207652_10149277
1476 Ga0207652_10659449
1477 Ga0207652_11124571
1478 Ga0207681_10003676
1479 Ga0207681_10168461
1480 Ga0207681_10381350
1481 Ga0207694_10013561
1482 Ga0207694_10111512
1483 Ga0207694_10410137
1484 Ga0207650_10005248
1485 Ga0207650_10016618
1486 Ga0207650_10032998
1487 Ga0207650_10047175
1488 Ga0207650_10076066
1489 Ga0207650_10078090
1490 Ga0207650_10453360
1491 Ga0207659_10004404
1492 Ga0207659_10113213
1493 Ga0207659_10362559
1494 Ga0207687_10001079
1495 Ga0207687_10028175
1496 Ga0207687_10054164
1497 Ga0207644_10024289
1498 Ga0207644_10032888
1499 Ga0207644_10048157
1500 Ga0207644_10049168
1501 Ga0207644_10050244
1502 Ga0207644_10175027
1503 Ga0207644_10219889
1504 Ga0207690_10000108
1505 Ga0207690_10002964
1506 Ga0207690_10004142
1507 Ga0207690_10017516
1508 Ga0207690_10025999
1509 Ga0207690_10043676
1510 Ga0207690_10051311
1511 Ga0207690_10103270
1512 Ga0207690_10121128
1513 Ga0207690_10245231
1514 Ga0207690_10245252
1515 Ga0207690_10258735
1516 Ga0207690_10263120
1517 Ga0207690_10312198
1518 Ga0207690_10624911
1519 Ga0207706_10000514
1520 Ga0207706_10000816
1521 Ga0207706_10001018
1522 Ga0207706_10008582
1523 Ga0207706_10026502
1524 Ga0207706_10037007
1525 Ga0207706_10049706
1526 Ga0207706_10079281
1527 Ga0207706_10134521
1528 Ga0207706_10188857
1529 Ga0207706_10193587
1530 Ga0207706_10269405
1531 Ga0207706_10408409
1532 Ga0207706_10513710
1533 Ga0207706_10652043
1534 Ga0207706_10698757
1535 Ga0207706_10791461
1536 Ga0207686_10094114
1537 Ga0207709_10010054
1538 Ga0207670_10056018
1539 Ga0207669_10002756
1540 Ga0207669_10077021
1541 Ga0207704_10064883
1542 Ga0207704_10340243
1543 Ga0207691_10001562
1544 Ga0207691_10002265
1545 Ga0207691_10087413
1546 Ga0207691_10136207
1547 Ga0207691_10192153
1548 Ga0207691_10196229
1549 Ga0207691_10409686
1550 Ga0207711_10000105
1551 Ga0207711_10002153
1552 Ga0207711_10005548
1553 Ga0207711_10006893
1554 Ga0207711_10026581
1555 Ga0207711_10039957
1556 Ga0207711_10074999
1557 Ga0207711_10174168
1558 Ga0207711_10467986
1559 Ga0207689_10000051
1560 Ga0207661_10005828
1561 Ga0207661_10006577
1562 Ga0207661_10073023
1563 Ga0207661_10254276
1564 Ga0207661_10336113
1565 Ga0207661_10489905
1566 Ga0207661_10562013
1567 Ga0207661_11121525
1568 Ga0207679_10000114
1569 Ga0207679_10035150
1570 Ga0207679_10067743
1571 Ga0207679_10195598
1572 Ga0207679_10256136
1573 Ga0207679_10294993
1574 Ga0207679_10466339
1575 Ga0207679_10652224
1576 Ga0207679_10919939
1577 Ga0207667_10000828
1578 Ga0207667_10024815
1579 Ga0207667_10030403
1580 Ga0207667_10075674
1581 Ga0207667_10143406
1582 Ga0207667_10362401
1583 Ga0207651_10005577
1584 Ga0207651_10013218
1585 Ga0207651_10071298
1586 Ga0207651_10089315
1587 Ga0207651_10130041
1588 Ga0207712_10043521
1589 Ga0207640_10000999
1590 Ga0207640_10004989
1591 Ga0207640_10006687
1592 Ga0207640_10009679
1593 Ga0207640_10017692
1594 Ga0207640_10257824
1595 Ga0207640_10263407
1596 Ga0207640_11134713
1597 Ga0207658_10002159
1598 Ga0207658_10002297
1599 Ga0207658_10004192
1600 Ga0207658_10005799
1601 Ga0207658_10017839
1602 Ga0207658_10046761
1603 Ga0207658_10669092
1604 Ga0207658_10986883
1605 Ga0207677_10001693
1606 Ga0207677_10005567
1607 Ga0207677_10128788
1608 Ga0207677_10154050
1609 Ga0207677_10666791
1610 Ga0207703_10005297
1611 Ga0207703_10005508
1612 Ga0207703_10006841
1613 Ga0207703_10015590
1614 Ga0207703_10030088
1615 Ga0207703_10067103
1616 Ga0207703_10443738
1617 Ga0207639_10000139
1618 Ga0207639_10001476
1619 Ga0207639_10002396
1620 Ga0207639_10110209
1621 Ga0207639_10235074
1622 Ga0207639_10461931
1623 Ga0207639_11061659
1624 Ga0207678_10000278
1625 Ga0207678_10000321
1626 Ga0207678_10002094
1627 Ga0207678_10018288
1628 Ga0207678_10029027
1629 Ga0207678_10062145
1630 Ga0207678_10102127
1631 Ga0207678_10235738
1632 Ga0207678_10779964
1633 Ga0207702_10001266
1634 Ga0207702_10028183
1635 Ga0207702_10133484
1636 Ga0207702_10140961
1637 Ga0207702_10188818
1638 Ga0207702_10248851
1639 Ga0207702_11420818
1640 Ga0207641_10000172
1641 Ga0207641_10025141
1642 Ga0207641_10031805
1643 Ga0207641_10047185
1644 Ga0207641_10053288
1645 Ga0207641_10078400
1646 Ga0207641_10188055
1647 Ga0207641_10319328
1648 Ga0207648_10000221
1649 Ga0207648_10005512
1650 Ga0207676_10000898
1651 Ga0207676_10002758
1652 Ga0207676_10008169
1653 Ga0207676_10068951
1654 Ga0207676_10191109
1655 Ga0207676_10535911
1656 Ga0207674_10001223
1657 Ga0207674_10005246
1658 Ga0207674_10005279
1659 Ga0207674_10020585
1660 Ga0207674_10021077
1661 Ga0207674_10028871
1662 Ga0207674_10043317
1663 Ga0207674_10123007
1664 Ga0207674_10145224
1665 Ga0207674_10199898
1666 Ga0207674_10219461
1667 Ga0207674_10416532
1668 Ga0207674_10524517
1669 Ga0207683_10009875
1670 Ga0207683_10040016
1671 Ga0207683_10160104
1672 Ga0207683_10388645
1673 Ga0207698_10000598
1674 Ga0207698_10008526
1675 Ga0207698_10019756
1676 Ga0207698_10036328
1677 Ga0207698_10037937
1678 Ga0207698_10040743
1679 Ga0207698_10055984
1680 Ga0207698_10294109
1681 Ga0207698_10376815
1682 Ga0209974_10003135
1683 Ga0268266_10000200
1684 Ga0268266_10021481
1685 Ga0268266_10229813
1686 Ga0268266_11203420
1687 Ga0268265_10007828
1688 Ga0268265_10040913
1689 Ga0268265_10095317
1690 Ga0268265_10108363
1691 Ga0268265_10115816
1692 Ga0268265_10417391
1693 Ga0268264_10001019
1694 Ga0268264_10023910
1695 Ga0268264_10040961
1696 Ga0268264_10055223
1697 Ga0268264_10389472
1698 Ga0307515_10571179
1699 Ga0307513_10078700
1700 Ga0307408_100119559
1701 Ga0307405_10305177
1702 Ga0307405_10397325
1703 Ga0307413_10061476
1704 Ga0307413_10240180
1705 Ga0307413_10655646
1706 Ga0307406_10177515
1707 Ga0307412_10182381
1708 Ga0307409_100311476
1709 Ga0307416_100286682
1710 Ga0307416_100340645
1711 Ga0307416_100685970
1712 Ga0307416_101073528
1713 Ga0307414_10703437
1714 Ga0307415_100155951
1715 Ga0373930_0042321
1716 Ga0373961_0077501
1717 Ga0373931_0012293
1718 Ga0373931_0187973
1719 Ga0373931_0204536
1720 Ga0373937_0163968
1721 Ga0373937_0959469
1722 Ga0395899_0000157
1723 Ga0395899_0002294
1724 Ga0395899_0004063
1725 Ga0395899_0039306
1726 Ga0395899_0097215
1727 Ga0395899_0102041
1728 Ga0395899_0141461
1729 Ga0395899_0165267
1730 Ga0395900_0000296
1731 Ga0395900_0004777
1732 Ga0395900_0006847
1733 Ga0395900_0008602
1734 Ga0395900_0020243
1735 Ga0395900_0024324
1736 Ga0395900_0030776
1737 Ga0395900_0047847
1738 Ga0395900_0049032
1739 Ga0395900_0051556
1740 Ga0395900_0138822
1741 Ga0395900_0230242
1742 Ga0395900_0330047
1743 Ga0395900_0390515
1744 Ga0395900_0423124
1745 Ga0395898_0000054
1746 Ga0395898_0002796
1747 Ga0395898_0014959
1748 Ga0395898_0074159
1749 Ga0395898_0079240
1750 Ga0395898_0087368
1751 Ga0395898_0244412
1752 Ga0395898_0315879
1753 Ga0395905_0000046
1754 Ga0395905_0000232
1755 Ga0395905_0007745
1756 Ga0395905_0019500
1757 Ga0395905_0034124
1758 Ga0395905_0043209
1759 Ga0395905_0061256
1760 Ga0395905_0097840
1761 Ga0395905_0097888
1762 Ga0395905_0115344
1763 Ga0395905_0160705
1764 Ga0395905_0169728
1765 Ga0395905_0339351
1766 Ga0395905_0357881
1767 Ga0395905_0385178
1768 Ga0395905_0454476
1769 Ga0395901_0000086
1770 Ga0395901_0000102
1771 Ga0395901_0001796
1772 Ga0395901_0003125
1773 Ga0395901_0008693
1774 Ga0395901_0026965
1775 Ga0395901_0045169
1776 Ga0395901_0079721
1777 Ga0395901_0183524
1778 Ga0395901_0422872
1779 Ga0395901_0477825
1780 Ga0395901_0596953
1781 Ga0395901_1234943
1782 Ga0436365_1846725
1783 Ga0439448_0002775
1784 Ga0439458_0000023
1785 Ga0466969_0053298
1786 Ga0466972_0051383
1787 Ga0466965_0248390
1788 Ga0466966_0052874
1789 Ga0466966_0409481
1790 Ga0466963_0007060
1791 Ga0466963_0037968
1792 Ga0466963_0137362
1793 Ga0466963_0142550
1794 Ga0466963_0152580
1795 Ga0466963_0417294
1796 Ga0466964_0053968
1797 Ga0466970_0234235
1798 Ga0466957_0096277
1799 Ga0466957_0108806
1800 Ga0466957_0627291
1801 Ga0466960_0040970
1802 Ga0466960_0412356
1803 Ga0466959_0022141
1804 Ga0466967_0010597
1805 Ga0466967_0010807
1806 Ga0466967_0014326
1807 Ga0466967_0085183
1808 Ga0466967_0114551
1809 Ga0466967_0295069
1810 Ga0466967_0659384
1811 Ga0466967_0666754
1812 Ga0495582_0269561
1813 Ga0495663_0018269
1814 Ga0495642_0051683
1815 Ga0495598_0000366
1816 Ga0495621_0000027
1817 Ga0495633_0104951
1818 Ga0495668_0033384
1819 Ga0495668_0315711
1820 Ga0495625_0291827
1821 Ga0495647_0043213
1822 Ga0495669_0000648
1823 Ga0495669_0005679
1824 Ga0495669_0020498
1825 Ga0495669_0020519
1826 Ga0495669_0038294
1827 Ga0495669_0045422
1828 Ga0495669_0083505
1829 Ga0495670_0000419
1830 Ga0495687_127407
1831 Ga0495677_0006249
1832 Ga0496100_0006760
1833 Ga0496100_0024299
1834 Ga0496100_0077240
1835 Ga0496101_0028317
1836 Ga0496101_0034507
1837 Ga0496101_0062189
1838 Ga0496102_0201758
1839 Ga0496102_0509992
1840 Ga0496102_0677616
1841 Ga0496104_0228229
1842 Ga0496105_0429349
1843 Ga0496106_0250019
1844 Ga0496107_0026600
1845 Ga0496107_0329318
1846 Ga0496107_0491885
1847 Ga0496107_0602693
1848 Ga0496108_0020881
1849 Ga0496108_0028757
1850 Ga0496109_0018758
1851 Ga0496109_0027142
1852 Ga0496109_0330918
1853 Ga0496109_0510234
1854 Ga0496110_0002541
1855 Ga0496110_0469898
1856 Ga0496111_0017327
1857 Ga0496111_0289920
1858 Ga0496112_0044335
1859 Ga0496112_0216318
1860 Ga0496112_0591918
1861 Ga0496113_0057805
1862 Ga0496113_0068373
1863 Ga0496113_0141605
1864 Ga0496114_0031860
1865 Ga0496114_0043215
1866 Ga0501067_0163257
1867 Ga0501069_0164639
1868 Ga0501071_0252784
1869 Ga0501074_0019492
1870 Ga0501074_0489136
1871 Ga0501080_0102531
1872 Ga0501080_0174399
1873 nmdc:mga08y16_298687_c1
1874 Ga0500658_0000032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

16

161

0.87

Map