F486229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 269 | 937 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0067399|Ga0451576_0067399_68_616 |
| Length | 182 |
| Sequence | MRGCAARPQAQGSWLEPWALWALSLDSEQKEKTNMAIVKVDPFRELTAMQDRMARLFGDVYLRDEDTGFRGSWTPAVDIFETEHHDLVLKAEVPGMTRENIEVTVENGTLVLKGQKNFDTDVKEEHYRRIERSYGQFYRSFTLPNTVDTSKVAADYKNGILTVKLPFREEAKPRSINVEVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 99 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 190 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 193 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 222 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 223 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 245 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 98.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000909 | 3300001977 | Bacteria | 4622 |
| 2 | JGI24750J21931_1027064 | 3300002070 | Bacteria | 828 |
| 3 | JGI24749J21850_1010328 | 3300002076 | Unclassified | 1309 |
| 4 | JGI24035J26624_1029462 | 3300002126 | Archaea | 595 |
| 5 | JGI24751J29686_10093352 | 3300002459 | Unclassified | 626 |
| 6 | JGI25406J46586_10012672 | 3300003203 | Bacteria | 3646 |
| 7 | Ga0058860_11692652 | 3300004801 | Archaea | 502 |
| 8 | Ga0058860_11970884 | 3300004801 | Unclassified | 618 |
| 9 | Ga0058860_12184011 | 3300004801 | Bacteria | 617 |
| 10 | Ga0065714_10342292 | 3300005288 | Bacteria | 617 |
| 11 | Ga0065704_10077157 | 3300005289 | Bacteria | 4835 |
| 12 | Ga0065704_10246247 | 3300005289 | Bacteria | 1001 |
| 13 | Ga0065704_10347472 | 3300005289 | Archaea | 814 |
| 14 | Ga0065704_10483285 | 3300005289 | Unclassified | 680 |
| 15 | Ga0065712_10012047 | 3300005290 | Bacteria | 3073 |
| 16 | Ga0065712_10019331 | 3300005290 | Unclassified | 1697 |
| 17 | Ga0065712_10085635 | 3300005290 | Bacteria | 2685 |
| 18 | Ga0065712_10086488 | 3300005290 | Bacteria | 2626 |
| 19 | Ga0065712_10088620 | 3300005290 | Bacteria | 2500 |
| 20 | Ga0065712_10223940 | 3300005290 | Bacteria | 1032 |
| 21 | Ga0065712_10375391 | 3300005290 | Unclassified | 758 |
| 22 | Ga0065712_10534061 | 3300005290 | Unclassified | 628 |
| 23 | Ga0065715_10000879 | 3300005293 | Bacteria | 12771 |
| 24 | Ga0065715_10096891 | 3300005293 | Bacteria | 3801 |
| 25 | Ga0065715_10100717 | 3300005293 | Bacteria | 3275 |
| 26 | Ga0065715_10624584 | 3300005293 | Unclassified | 693 |
| 27 | Ga0065715_10701154 | 3300005293 | Bacteria | 653 |
| 28 | Ga0065715_11083627 | 3300005293 | Unclassified | 524 |
| 29 | Ga0065707_10006295 | 3300005295 | Bacteria | 3125 |
| 30 | Ga0065707_10023887 | 3300005295 | Bacteria | 2106 |
| 31 | Ga0065707_10275714 | 3300005295 | Bacteria | 1043 |
| 32 | Ga0065707_10628294 | 3300005295 | Archaea | 654 |
| 33 | Ga0065707_10805685 | 3300005295 | Unclassified | 597 |
| 34 | Ga0070658_10477958 | 3300005327 | Bacteria | 1075 |
| 35 | Ga0070658_11265126 | 3300005327 | Bacteria | 641 |
| 36 | Ga0070658_11305960 | 3300005327 | Unclassified | 630 |
| 37 | Ga0070676_10004240 | 3300005328 | Bacteria | 7536 |
| 38 | Ga0070676_10126212 | 3300005328 | Bacteria | 1612 |
| 39 | Ga0070676_10333427 | 3300005328 | Unclassified | 1038 |
| 40 | Ga0070676_10402252 | 3300005328 | Bacteria | 953 |
| 41 | Ga0070676_10959672 | 3300005328 | Unclassified | 640 |
| 42 | Ga0070683_100065328 | 3300005329 | Bacteria | 3388 |
| 43 | Ga0070683_100734194 | 3300005329 | Bacteria | 946 |
| 44 | Ga0070683_101725729 | 3300005329 | Unclassified | 602 |
| 45 | Ga0070690_100013733 | 3300005330 | Bacteria | 4796 |
| 46 | Ga0070690_100016453 | 3300005330 | Bacteria | 4431 |
| 47 | Ga0070690_100041224 | 3300005330 | Bacteria | 2922 |
| 48 | Ga0070690_101516938 | 3300005330 | Unclassified | 542 |
| 49 | Ga0070670_100021219 | 3300005331 | Bacteria | 5588 |
| 50 | Ga0070670_100062034 | 3300005331 | Bacteria | 3209 |
| 51 | Ga0070670_100069094 | 3300005331 | Bacteria | 3032 |
| 52 | Ga0070670_100183131 | 3300005331 | Bacteria | 1819 |
| 53 | Ga0070670_100268336 | 3300005331 | Bacteria | 1489 |
| 54 | Ga0070670_100387732 | 3300005331 | Bacteria | 1231 |
| 55 | Ga0070670_101120704 | 3300005331 | Bacteria | 718 |
| 56 | Ga0070670_101218015 | 3300005331 | Archaea | 688 |
| 57 | Ga0070670_101273836 | 3300005331 | Bacteria | 673 |
| 58 | Ga0070677_10010650 | 3300005333 | Bacteria | 3150 |
| 59 | Ga0070677_10321537 | 3300005333 | Bacteria | 793 |
| 60 | Ga0068869_100003236 | 3300005334 | Bacteria | 9954 |
| 61 | Ga0068869_100173747 | 3300005334 | Bacteria | 1685 |
| 62 | Ga0068869_100309489 | 3300005334 | Bacteria | 1278 |
| 63 | Ga0068869_100520169 | 3300005334 | Unclassified | 996 |
| 64 | Ga0068869_100688548 | 3300005334 | Bacteria | 871 |
| 65 | Ga0068869_100955344 | 3300005334 | Bacteria | 744 |
| 66 | Ga0070666_10019167 | 3300005335 | Bacteria | 4413 |
| 67 | Ga0070666_10025313 | 3300005335 | Bacteria | 3867 |
| 68 | Ga0070666_10056738 | 3300005335 | Bacteria | 2645 |
| 69 | Ga0070666_10750475 | 3300005335 | Unclassified | 717 |
| 70 | Ga0070680_100189453 | 3300005336 | Bacteria | 1733 |
| 71 | Ga0070680_100290096 | 3300005336 | Bacteria | 1387 |
| 72 | Ga0070680_101041765 | 3300005336 | Bacteria | 707 |
| 73 | Ga0070682_100593957 | 3300005337 | Archaea | 873 |
| 74 | Ga0070682_102066207 | 3300005337 | Unclassified | 502 |
| 75 | Ga0068868_100007147 | 3300005338 | Bacteria | 7935 |
| 76 | Ga0068868_100132565 | 3300005338 | Bacteria | 2040 |
| 77 | Ga0068868_100300595 | 3300005338 | Bacteria | 1363 |
| 78 | Ga0068868_101566876 | 3300005338 | Unclassified | 618 |
| 79 | Ga0070660_101288933 | 3300005339 | Unclassified | 620 |
| 80 | Ga0070689_100006102 | 3300005340 | Bacteria | 8305 |
| 81 | Ga0070689_100008169 | 3300005340 | Bacteria | 7356 |
| 82 | Ga0070689_100062418 | 3300005340 | Bacteria | 2899 |
| 83 | Ga0070689_100444795 | 3300005340 | Bacteria | 1102 |
| 84 | Ga0070691_10169574 | 3300005341 | Bacteria | 1130 |
| 85 | Ga0070687_100136219 | 3300005343 | Bacteria | 1424 |
| 86 | Ga0070687_100584483 | 3300005343 | Bacteria | 765 |
| 87 | Ga0070687_100643985 | 3300005343 | Unclassified | 734 |
| 88 | Ga0070661_100033797 | 3300005344 | Bacteria | 3707 |
| 89 | Ga0070661_100044414 | 3300005344 | Bacteria | 3247 |
| 90 | Ga0070661_100230524 | 3300005344 | Unclassified | 1423 |
| 91 | Ga0070661_100425074 | 3300005344 | Bacteria | 1054 |
| 92 | Ga0070692_10086280 | 3300005345 | Bacteria | 1699 |
| 93 | Ga0070692_10477954 | 3300005345 | Archaea | 803 |
| 94 | Ga0070668_100107964 | 3300005347 | Bacteria | 2213 |
| 95 | Ga0070668_100125945 | 3300005347 | Bacteria | 2052 |
| 96 | Ga0070668_100332063 | 3300005347 | Bacteria | 1282 |
| 97 | Ga0070668_101342214 | 3300005347 | Bacteria | 651 |
| 98 | Ga0070669_100004669 | 3300005353 | Bacteria | 9888 |
| 99 | Ga0070669_100007056 | 3300005353 | Bacteria | 8073 |
| 100 | Ga0070669_100016438 | 3300005353 | Bacteria | 5279 |
| 101 | Ga0070669_100097839 | 3300005353 | Bacteria | 2209 |
| 102 | Ga0070669_100156477 | 3300005353 | Bacteria | 1768 |
| 103 | Ga0070669_100193327 | 3300005353 | Bacteria | 1597 |
| 104 | Ga0070669_100249264 | 3300005353 | Unclassified | 1413 |
| 105 | Ga0070669_100431899 | 3300005353 | Bacteria | 1083 |
| 106 | Ga0070675_100000998 | 3300005354 | Bacteria | 20285 |
| 107 | Ga0070675_100003145 | 3300005354 | Bacteria | 12491 |
| 108 | Ga0070675_100005576 | 3300005354 | Bacteria | 9637 |
| 109 | Ga0070675_100017262 | 3300005354 | Bacteria | 5733 |
| 110 | Ga0070675_100056448 | 3300005354 | Bacteria | 3236 |
| 111 | Ga0070675_100068099 | 3300005354 | Bacteria | 2947 |
| 112 | Ga0070675_100103317 | 3300005354 | Bacteria | 2403 |
| 113 | Ga0070675_100176359 | 3300005354 | Bacteria | 1846 |
| 114 | Ga0070675_100348068 | 3300005354 | Unclassified | 1314 |
| 115 | Ga0070675_100358438 | 3300005354 | Bacteria | 1294 |
| 116 | Ga0070675_100418093 | 3300005354 | Bacteria | 1198 |
| 117 | Ga0070675_100571563 | 3300005354 | Bacteria | 1023 |
| 118 | Ga0070675_100914156 | 3300005354 | Bacteria | 804 |
| 119 | Ga0070675_101343057 | 3300005354 | Unclassified | 659 |
| 120 | Ga0070675_101746188 | 3300005354 | Unclassified | 574 |
| 121 | Ga0070671_100154900 | 3300005355 | Bacteria | 1936 |
| 122 | Ga0070671_100338502 | 3300005355 | Bacteria | 1283 |
| 123 | Ga0070674_100001500 | 3300005356 | Bacteria | 12440 |
| 124 | Ga0070674_100126837 | 3300005356 | Unclassified | 1897 |
| 125 | Ga0070674_100677382 | 3300005356 | Unclassified | 879 |
| 126 | Ga0070674_101023128 | 3300005356 | Unclassified | 726 |
| 127 | Ga0070674_101318208 | 3300005356 | Unclassified | 644 |
| 128 | Ga0070673_100011067 | 3300005364 | Bacteria | 6147 |
| 129 | Ga0070673_100024542 | 3300005364 | Bacteria | 4423 |
| 130 | Ga0070673_100094764 | 3300005364 | Unclassified | 2447 |
| 131 | Ga0070673_100142705 | 3300005364 | Bacteria | 2022 |
| 132 | Ga0070673_100203331 | 3300005364 | Bacteria | 1706 |
| 133 | Ga0070673_100266332 | 3300005364 | Bacteria | 1498 |
| 134 | Ga0070673_100409621 | 3300005364 | Bacteria | 1214 |
| 135 | Ga0070688_100020189 | 3300005365 | Bacteria | 3870 |
| 136 | Ga0070688_100092983 | 3300005365 | Bacteria | 1974 |
| 137 | Ga0070688_100164937 | 3300005365 | Bacteria | 1525 |
| 138 | Ga0070688_100188539 | 3300005365 | Unclassified | 1435 |
| 139 | Ga0070688_100393658 | 3300005365 | Bacteria | 1024 |
| 140 | Ga0070688_100537017 | 3300005365 | Bacteria | 887 |
| 141 | Ga0070688_101304894 | 3300005365 | Unclassified | 586 |
| 142 | Ga0070659_100016032 | 3300005366 | Bacteria | 5621 |
| 143 | Ga0070659_100821816 | 3300005366 | Unclassified | 809 |
| 144 | Ga0070667_100025321 | 3300005367 | Bacteria | 4932 |
| 145 | Ga0070667_100169857 | 3300005367 | Bacteria | 1925 |
| 146 | Ga0070667_101069016 | 3300005367 | Unclassified | 754 |
| 147 | Ga0070667_101368857 | 3300005367 | Bacteria | 664 |
| 148 | Ga0070701_10079984 | 3300005438 | Bacteria | 1767 |
| 149 | Ga0070701_10116834 | 3300005438 | Bacteria | 1498 |
| 150 | Ga0070701_10276904 | 3300005438 | Archaea | 1023 |
| 151 | Ga0070701_10455345 | 3300005438 | Bacteria | 822 |
| 152 | Ga0070705_100001006 | 3300005440 | Bacteria | 15697 |
| 153 | Ga0070705_100065913 | 3300005440 | Bacteria | 2170 |
| 154 | Ga0070705_100169270 | 3300005440 | Bacteria | 1469 |
| 155 | Ga0070705_100615398 | 3300005440 | Bacteria | 842 |
| 156 | Ga0070705_100767487 | 3300005440 | Unclassified | 764 |
| 157 | Ga0070700_100089978 | 3300005441 | Bacteria | 2001 |
| 158 | Ga0070700_100152172 | 3300005441 | Bacteria | 1583 |
| 159 | Ga0070700_100296060 | 3300005441 | Bacteria | 1179 |
| 160 | Ga0070700_100303262 | 3300005441 | Bacteria | 1167 |
| 161 | Ga0070694_100001224 | 3300005444 | Bacteria | 14823 |
| 162 | Ga0070694_100002510 | 3300005444 | Bacteria | 10833 |
| 163 | Ga0070694_100886870 | 3300005444 | Viruses | 736 |
| 164 | Ga0070678_100019465 | 3300005456 | Bacteria | 4426 |
| 165 | Ga0070678_100120646 | 3300005456 | Unclassified | 2067 |
| 166 | Ga0070678_100129534 | 3300005456 | Bacteria | 2002 |
| 167 | Ga0070678_100207670 | 3300005456 | Bacteria | 1620 |
| 168 | Ga0070678_100443188 | 3300005456 | Unclassified | 1136 |
| 169 | Ga0070678_100602360 | 3300005456 | Bacteria | 981 |
| 170 | Ga0070678_101572406 | 3300005456 | Unclassified | 617 |
| 171 | Ga0070662_100054409 | 3300005457 | Bacteria | 2900 |
| 172 | Ga0070662_100063348 | 3300005457 | Bacteria | 2704 |
| 173 | Ga0070662_100302125 | 3300005457 | Bacteria | 1301 |
| 174 | Ga0070662_100548831 | 3300005457 | Unclassified | 968 |
| 175 | Ga0070681_10018905 | 3300005458 | Bacteria | 6894 |
| 176 | Ga0068867_100000147 | 3300005459 | Bacteria | 45184 |
| 177 | Ga0068867_100163313 | 3300005459 | Bacteria | 1758 |
| 178 | Ga0068867_100512027 | 3300005459 | Bacteria | 1033 |
| 179 | Ga0068867_100580038 | 3300005459 | Bacteria | 975 |
| 180 | Ga0068867_101319548 | 3300005459 | Archaea | 667 |
| 181 | Ga0068867_101459412 | 3300005459 | Unclassified | 636 |
| 182 | Ga0070685_10523763 | 3300005466 | Bacteria | 842 |
| 183 | Ga0070685_11257714 | 3300005466 | Unclassified | 564 |
| 184 | Ga0070685_11294069 | 3300005466 | Bacteria | 557 |
| 185 | Ga0070707_100177536 | 3300005468 | Bacteria | 2076 |
| 186 | Ga0070707_100182523 | 3300005468 | Bacteria | 2046 |
| 187 | Ga0070698_100047613 | 3300005471 | Bacteria | 4382 |
| 188 | Ga0070698_100329574 | 3300005471 | Bacteria | 1458 |
| 189 | Ga0070698_100458203 | 3300005471 | Unclassified | 1211 |
| 190 | Ga0070699_100002298 | 3300005518 | Bacteria | 17202 |
| 191 | Ga0070699_100181189 | 3300005518 | Bacteria | 1869 |
| 192 | Ga0070699_100220060 | 3300005518 | Bacteria | 1692 |
| 193 | Ga0070699_100463047 | 3300005518 | Bacteria | 1150 |
| 194 | Ga0070699_100521705 | 3300005518 | Bacteria | 1080 |
| 195 | Ga0070679_100795251 | 3300005530 | Bacteria | 889 |
| 196 | Ga0070679_101079940 | 3300005530 | Bacteria | 747 |
| 197 | Ga0070684_100205443 | 3300005535 | Bacteria | 1795 |
| 198 | Ga0070684_101315427 | 3300005535 | Bacteria | 680 |
| 199 | Ga0070684_101438109 | 3300005535 | Unclassified | 649 |
| 200 | Ga0070697_100152879 | 3300005536 | Bacteria | 1946 |
| 201 | Ga0070697_100552502 | 3300005536 | Unclassified | 1010 |
| 202 | Ga0070697_100590928 | 3300005536 | Unclassified | 975 |
| 203 | Ga0070697_101035731 | 3300005536 | Bacteria | 730 |
| 204 | Ga0068853_101545535 | 3300005539 | Bacteria | 643 |
| 205 | Ga0070672_100014870 | 3300005543 | Bacteria | 5525 |
| 206 | Ga0070672_100066226 | 3300005543 | Bacteria | 2860 |
| 207 | Ga0070672_100078828 | 3300005543 | Bacteria | 2636 |
| 208 | Ga0070672_100134439 | 3300005543 | Unclassified | 2036 |
| 209 | Ga0070672_100258503 | 3300005543 | Unclassified | 1468 |
| 210 | Ga0070672_100902142 | 3300005543 | Bacteria | 781 |
| 211 | Ga0070686_100005406 | 3300005544 | Bacteria | 7073 |
| 212 | Ga0070686_100126426 | 3300005544 | Bacteria | 1762 |
| 213 | Ga0070686_100164530 | 3300005544 | Bacteria | 1565 |
| 214 | Ga0070695_100000425 | 3300005545 | Bacteria | 21837 |
| 215 | Ga0070695_100549752 | 3300005545 | Bacteria | 900 |
| 216 | Ga0070695_100744111 | 3300005545 | Unclassified | 781 |
| 217 | Ga0070696_100008088 | 3300005546 | Bacteria | 7028 |
| 218 | Ga0070696_100093207 | 3300005546 | Bacteria | 2147 |
| 219 | Ga0070696_100093556 | 3300005546 | Bacteria | 2144 |
| 220 | Ga0070665_100063029 | 3300005548 | Bacteria | 3717 |
| 221 | Ga0070704_100002260 | 3300005549 | Bacteria | 10750 |
| 222 | Ga0070704_100002570 | 3300005549 | Bacteria | 10234 |
| 223 | Ga0070704_100128184 | 3300005549 | Bacteria | 1962 |
| 224 | Ga0070704_100184255 | 3300005549 | Bacteria | 1673 |
| 225 | Ga0070704_100855012 | 3300005549 | Unclassified | 816 |
| 226 | Ga0070664_100044718 | 3300005564 | Bacteria | 3739 |
| 227 | Ga0070664_100052952 | 3300005564 | Bacteria | 3439 |
| 228 | Ga0070664_100162791 | 3300005564 | Bacteria | 1975 |
| 229 | Ga0070664_100403114 | 3300005564 | Bacteria | 1251 |
| 230 | Ga0070664_100410841 | 3300005564 | Bacteria | 1239 |
| 231 | Ga0070664_101347338 | 3300005564 | Bacteria | 674 |
| 232 | Ga0070664_102294566 | 3300005564 | Bacteria | 512 |
| 233 | Ga0068857_100164472 | 3300005577 | Bacteria | 2014 |
| 234 | Ga0068857_100270782 | 3300005577 | Bacteria | 1561 |
| 235 | Ga0068857_100363994 | 3300005577 | Bacteria | 1341 |
| 236 | Ga0068854_101606235 | 3300005578 | Archaea | 593 |
| 237 | Ga0070702_100054578 | 3300005615 | Bacteria | 2300 |
| 238 | Ga0070702_100604312 | 3300005615 | Unclassified | 823 |
| 239 | Ga0070702_100617564 | 3300005615 | Unclassified | 815 |
| 240 | Ga0070702_100949974 | 3300005615 | Bacteria | 677 |
| 241 | Ga0068852_100955304 | 3300005616 | Unclassified | 875 |
| 242 | Ga0068852_101595063 | 3300005616 | Bacteria | 675 |
| 243 | Ga0068852_101730433 | 3300005616 | Archaea | 648 |
| 244 | Ga0068859_100002071 | 3300005617 | Bacteria | 20473 |
| 245 | Ga0068859_100002533 | 3300005617 | Bacteria | 18549 |
| 246 | Ga0068859_100022922 | 3300005617 | Bacteria | 6260 |
| 247 | Ga0068859_100069602 | 3300005617 | Unclassified | 3554 |
| 248 | Ga0068859_100185587 | 3300005617 | Unclassified | 2163 |
| 249 | Ga0068859_101290359 | 3300005617 | Bacteria | 805 |
| 250 | Ga0068859_102563362 | 3300005617 | Unclassified | 561 |
| 251 | Ga0068864_100043267 | 3300005618 | Bacteria | 3856 |
| 252 | Ga0068864_100067309 | 3300005618 | Bacteria | 3110 |
| 253 | Ga0068864_100369486 | 3300005618 | Bacteria | 1357 |
| 254 | Ga0068864_100431660 | 3300005618 | Bacteria | 1257 |
| 255 | Ga0068864_100499665 | 3300005618 | Bacteria | 1170 |
| 256 | Ga0068864_100586708 | 3300005618 | Bacteria | 1080 |
| 257 | Ga0068866_10447546 | 3300005718 | Bacteria | 844 |
| 258 | Ga0068866_11108478 | 3300005718 | Bacteria | 567 |
| 259 | Ga0068861_100001293 | 3300005719 | Bacteria | 15634 |
| 260 | Ga0068861_101108998 | 3300005719 | Bacteria | 761 |
| 261 | Ga0068851_10849134 | 3300005834 | Archaea | 570 |
| 262 | Ga0068870_10008632 | 3300005840 | Bacteria | 4593 |
| 263 | Ga0068870_10014068 | 3300005840 | Bacteria | 3773 |
| 264 | Ga0068870_10017998 | 3300005840 | Bacteria | 3404 |
| 265 | Ga0068870_10026411 | 3300005840 | Bacteria | 2895 |
| 266 | Ga0068870_10314003 | 3300005840 | Unclassified | 993 |
| 267 | Ga0068870_10456817 | 3300005840 | Unclassified | 843 |
| 268 | Ga0068870_10752093 | 3300005840 | Bacteria | 677 |
| 269 | Ga0068863_100019665 | 3300005841 | Bacteria | 6459 |
| 270 | Ga0068863_100186579 | 3300005841 | Bacteria | 1992 |
| 271 | Ga0068863_100751413 | 3300005841 | Unclassified | 971 |
| 272 | Ga0068863_100948241 | 3300005841 | Bacteria | 862 |
| 273 | Ga0068858_100015339 | 3300005842 | Bacteria | 7208 |
| 274 | Ga0068858_100052144 | 3300005842 | Bacteria | 3784 |
| 275 | Ga0068858_100094724 | 3300005842 | Bacteria | 2781 |
| 276 | Ga0068858_100585933 | 3300005842 | Bacteria | 1081 |
| 277 | Ga0068860_100006114 | 3300005843 | Bacteria | 12108 |
| 278 | Ga0068860_100038938 | 3300005843 | Bacteria | 4548 |
| 279 | Ga0068860_101260478 | 3300005843 | Unclassified | 760 |
| 280 | Ga0068862_100001293 | 3300005844 | Bacteria | 23404 |
| 281 | Ga0068862_100004501 | 3300005844 | Bacteria | 11752 |
| 282 | Ga0068862_100345180 | 3300005844 | Bacteria | 1380 |
| 283 | Ga0068862_100580042 | 3300005844 | Bacteria | 1074 |
| 284 | Ga0068862_100698178 | 3300005844 | Bacteria | 983 |
| 285 | Ga0068862_100717161 | 3300005844 | Bacteria | 970 |
| 286 | Ga0068862_101781073 | 3300005844 | Unclassified | 625 |
| 287 | Ga0081539_10000013 | 3300005985 | Bacteria | 432395 |
| 288 | Ga0081539_10000164 | 3300005985 | Bacteria | 154639 |
| 289 | Ga0081539_10013539 | 3300005985 | Bacteria | 6136 |
| 290 | Ga0081539_10058268 | 3300005985 | Bacteria | 2132 |
| 291 | Ga0075432_10061975 | 3300006058 | Bacteria | 1333 |
| 292 | Ga0075432_10088489 | 3300006058 | Bacteria | 1131 |
| 293 | Ga0070712_101446797 | 3300006175 | Unclassified | 600 |
| 294 | Ga0097621_100092943 | 3300006237 | Bacteria | 2527 |
| 295 | Ga0097621_100255420 | 3300006237 | Bacteria | 1536 |
| 296 | Ga0097621_100309097 | 3300006237 | Bacteria | 1398 |
| 297 | Ga0097621_100995095 | 3300006237 | Unclassified | 784 |
| 298 | Ga0068871_100065374 | 3300006358 | Bacteria | 2979 |
| 299 | Ga0068871_100192405 | 3300006358 | Bacteria | 1758 |
| 300 | Ga0068871_100218569 | 3300006358 | Bacteria | 1650 |
| 301 | Ga0068871_100230976 | 3300006358 | Unclassified | 1606 |
| 302 | Ga0068871_101280608 | 3300006358 | Bacteria | 689 |
| 303 | Ga0075428_100000869 | 3300006844 | Bacteria | 31758 |
| 304 | Ga0075428_100026891 | 3300006844 | Bacteria | 6371 |
| 305 | Ga0075428_100038755 | 3300006844 | Bacteria | 5244 |
| 306 | Ga0075428_100169423 | 3300006844 | Unclassified | 2368 |
| 307 | Ga0075428_100181984 | 3300006844 | Bacteria | 2274 |
| 308 | Ga0075428_100192975 | 3300006844 | Bacteria | 2203 |
| 309 | Ga0075428_100234100 | 3300006844 | Bacteria | 1982 |
| 310 | Ga0075428_100572935 | 3300006844 | Bacteria | 1206 |
| 311 | Ga0075428_100884459 | 3300006844 | Bacteria | 948 |
| 312 | Ga0075428_101247363 | 3300006844 | Bacteria | 783 |
| 313 | Ga0075428_101818621 | 3300006844 | Unclassified | 634 |
| 314 | Ga0075430_100005569 | 3300006846 | Bacteria | 10638 |
| 315 | Ga0075430_100010153 | 3300006846 | Bacteria | 7971 |
| 316 | Ga0075430_100015622 | 3300006846 | Bacteria | 6465 |
| 317 | Ga0075430_100114945 | 3300006846 | Bacteria | 2242 |
| 318 | Ga0075430_100164103 | 3300006846 | Bacteria | 1849 |
| 319 | Ga0075430_100225283 | 3300006846 | Bacteria | 1555 |
| 320 | Ga0075430_100569743 | 3300006846 | Bacteria | 934 |
| 321 | Ga0075431_100000533 | 3300006847 | Bacteria | 31908 |
| 322 | Ga0075431_100058743 | 3300006847 | Bacteria | 3969 |
| 323 | Ga0075431_100117491 | 3300006847 | Bacteria | 2745 |
| 324 | Ga0075431_100117777 | 3300006847 | Bacteria | 2741 |
| 325 | Ga0075431_100455459 | 3300006847 | Bacteria | 1274 |
| 326 | Ga0075431_100809648 | 3300006847 | Bacteria | 910 |
| 327 | Ga0075433_10014616 | 3300006852 | Bacteria | 6418 |
| 328 | Ga0075433_10030688 | 3300006852 | Bacteria | 4588 |
| 329 | Ga0075433_10036407 | 3300006852 | Bacteria | 4239 |
| 330 | Ga0075433_10053367 | 3300006852 | Bacteria | 3524 |
| 331 | Ga0075433_10054073 | 3300006852 | Bacteria | 3502 |
| 332 | Ga0075433_10183185 | 3300006852 | Bacteria | 1863 |
| 333 | Ga0075433_10227894 | 3300006852 | Bacteria | 1655 |
| 334 | Ga0075434_100008828 | 3300006871 | Bacteria | 9381 |
| 335 | Ga0075434_100054222 | 3300006871 | Bacteria | 3984 |
| 336 | Ga0075434_100098176 | 3300006871 | Unclassified | 2934 |
| 337 | Ga0075434_100107712 | 3300006871 | Bacteria | 2797 |
| 338 | Ga0075434_100268093 | 3300006871 | Bacteria | 1727 |
| 339 | Ga0075434_101096201 | 3300006871 | Unclassified | 809 |
| 340 | Ga0075429_100038051 | 3300006880 | Bacteria | 4187 |
| 341 | Ga0075429_100044382 | 3300006880 | Bacteria | 3867 |
| 342 | Ga0075429_100062109 | 3300006880 | Bacteria | 3255 |
| 343 | Ga0075429_100380944 | 3300006880 | Bacteria | 1235 |
| 344 | Ga0075429_100391003 | 3300006880 | Bacteria | 1218 |
| 345 | Ga0068865_100150804 | 3300006881 | Bacteria | 1763 |
| 346 | Ga0068865_100297666 | 3300006881 | Bacteria | 1290 |
| 347 | Ga0068865_100338176 | 3300006881 | Bacteria | 1216 |
| 348 | Ga0068865_100855738 | 3300006881 | Unclassified | 788 |
| 349 | Ga0068865_100978026 | 3300006881 | Bacteria | 740 |
| 350 | Ga0068865_101042451 | 3300006881 | Unclassified | 718 |
| 351 | Ga0097620_100002071 | 3300006931 | Bacteria | 20473 |
| 352 | Ga0097620_100002533 | 3300006931 | Bacteria | 18549 |
| 353 | Ga0097620_100022927 | 3300006931 | Bacteria | 6260 |
| 354 | Ga0097620_100069604 | 3300006931 | Unclassified | 3554 |
| 355 | Ga0097620_100185599 | 3300006931 | Unclassified | 2163 |
| 356 | Ga0097620_101290289 | 3300006931 | Bacteria | 805 |
| 357 | Ga0097620_102562974 | 3300006931 | Unclassified | 561 |
| 358 | Ga0075435_100005714 | 3300007076 | Bacteria | 8719 |
| 359 | Ga0075435_100060230 | 3300007076 | Bacteria | 3078 |
| 360 | Ga0075435_100637741 | 3300007076 | Bacteria | 924 |
| 361 | Ga0111539_10000044 | 3300009094 | Bacteria | 125347 |
| 362 | Ga0111539_10000769 | 3300009094 | Bacteria | 41797 |
| 363 | Ga0111539_10001774 | 3300009094 | Bacteria | 28680 |
| 364 | Ga0111539_10010913 | 3300009094 | Bacteria | 11433 |
| 365 | Ga0111539_10022455 | 3300009094 | Bacteria | 7752 |
| 366 | Ga0111539_10026374 | 3300009094 | Bacteria | 7105 |
| 367 | Ga0111539_10139223 | 3300009094 | Bacteria | 2842 |
| 368 | Ga0111539_10360069 | 3300009094 | Bacteria | 1693 |
| 369 | Ga0111539_10419078 | 3300009094 | Bacteria | 1559 |
| 370 | Ga0111539_10516430 | 3300009094 | Unclassified | 1391 |
| 371 | Ga0111539_10654940 | 3300009094 | Bacteria | 1223 |
| 372 | Ga0111539_10915013 | 3300009094 | Bacteria | 1020 |
| 373 | Ga0111539_10926144 | 3300009094 | Bacteria | 1013 |
| 374 | Ga0111539_11208015 | 3300009094 | Unclassified | 878 |
| 375 | Ga0111539_12329190 | 3300009094 | Bacteria | 621 |
| 376 | Ga0111539_12498185 | 3300009094 | Unclassified | 599 |
| 377 | Ga0111539_13317903 | 3300009094 | Unclassified | 518 |
| 378 | Ga0105245_10457378 | 3300009098 | Bacteria | 1286 |
| 379 | Ga0114129_10003276 | 3300009147 | Bacteria | 22724 |
| 380 | Ga0114129_10006054 | 3300009147 | Bacteria | 17152 |
| 381 | Ga0114129_10008048 | 3300009147 | Bacteria | 15021 |
| 382 | Ga0114129_10074700 | 3300009147 | Bacteria | 4722 |
| 383 | Ga0114129_10088180 | 3300009147 | Bacteria | 4302 |
| 384 | Ga0114129_10109324 | 3300009147 | Bacteria | 3817 |
| 385 | Ga0114129_10113438 | 3300009147 | Bacteria | 3737 |
| 386 | Ga0114129_10431633 | 3300009147 | Bacteria | 1731 |
| 387 | Ga0114129_10610543 | 3300009147 | Bacteria | 1412 |
| 388 | Ga0114129_10641114 | 3300009147 | Bacteria | 1372 |
| 389 | Ga0114129_11204322 | 3300009147 | Bacteria | 943 |
| 390 | Ga0114129_11329002 | 3300009147 | Bacteria | 890 |
| 391 | Ga0114129_11330908 | 3300009147 | Bacteria | 889 |
| 392 | Ga0114129_11365552 | 3300009147 | Archaea | 876 |
| 393 | Ga0114129_12868545 | 3300009147 | Unclassified | 571 |
| 394 | Ga0105243_10039279 | 3300009148 | Bacteria | 3688 |
| 395 | Ga0105243_10281598 | 3300009148 | Bacteria | 1498 |
| 396 | Ga0105243_11884064 | 3300009148 | Bacteria | 630 |
| 397 | Ga0105242_10246359 | 3300009176 | Bacteria | 1608 |
| 398 | Ga0105242_10467408 | 3300009176 | Bacteria | 1192 |
| 399 | Ga0105242_10611704 | 3300009176 | Bacteria | 1054 |
| 400 | Ga0105248_10076791 | 3300009177 | Bacteria | 3754 |
| 401 | Ga0105248_10089923 | 3300009177 | Bacteria | 3457 |
| 402 | Ga0105248_10158064 | 3300009177 | Bacteria | 2558 |
| 403 | Ga0105249_10001334 | 3300009553 | Bacteria | 21606 |
| 404 | Ga0105249_10133236 | 3300009553 | Bacteria | 2375 |
| 405 | Ga0105249_10170129 | 3300009553 | Bacteria | 2112 |
| 406 | Ga0105249_11948953 | 3300009553 | Bacteria | 660 |
| 407 | Ga0105246_10095338 | 3300011119 | Bacteria | 2154 |
| 408 | Ga0105246_10214474 | 3300011119 | Bacteria | 1505 |
| 409 | Ga0105246_10827539 | 3300011119 | Bacteria | 824 |
| 410 | Ga0105246_10905180 | 3300011119 | Bacteria | 791 |
| 411 | Ga0157346_1019322 | 3300012480 | Unclassified | 581 |
| 412 | Ga0157323_1007328 | 3300012495 | Unclassified | 793 |
| 413 | Ga0157373_10981274 | 3300013100 | Bacteria | 630 |
| 414 | Ga0157374_10037760 | 3300013296 | Bacteria | 4435 |
| 415 | Ga0157374_10199239 | 3300013296 | Bacteria | 1960 |
| 416 | Ga0157374_10321343 | 3300013296 | Unclassified | 1534 |
| 417 | Ga0157378_10059392 | 3300013297 | Bacteria | 3412 |
| 418 | Ga0157378_10089613 | 3300013297 | Bacteria | 2794 |
| 419 | Ga0157378_10372797 | 3300013297 | Bacteria | 1400 |
| 420 | Ga0163162_10016085 | 3300013306 | Bacteria | 7313 |
| 421 | Ga0163162_10589379 | 3300013306 | Bacteria | 1238 |
| 422 | Ga0163162_10912523 | 3300013306 | Bacteria | 991 |
| 423 | Ga0157375_10009638 | 3300013308 | Bacteria | 8487 |
| 424 | Ga0157375_10027823 | 3300013308 | Bacteria | 5290 |
| 425 | Ga0157375_10304445 | 3300013308 | Bacteria | 1758 |
| 426 | Ga0157375_10370261 | 3300013308 | Bacteria | 1599 |
| 427 | Ga0163163_10017755 | 3300014325 | Bacteria | 6641 |
| 428 | Ga0163163_10255424 | 3300014325 | Bacteria | 1803 |
| 429 | Ga0163163_10513067 | 3300014325 | Unclassified | 1261 |
| 430 | Ga0157380_10005619 | 3300014326 | Bacteria | 8764 |
| 431 | Ga0157380_10021207 | 3300014326 | Bacteria | 4870 |
| 432 | Ga0157380_10204245 | 3300014326 | Bacteria | 1755 |
| 433 | Ga0157380_10700305 | 3300014326 | Bacteria | 1018 |
| 434 | Ga0157380_10757404 | 3300014326 | Bacteria | 983 |
| 435 | Ga0157380_11914128 | 3300014326 | Unclassified | 654 |
| 436 | Ga0157377_10002991 | 3300014745 | Bacteria | 7572 |
| 437 | Ga0157377_10034044 | 3300014745 | Bacteria | 2785 |
| 438 | Ga0157377_10048960 | 3300014745 | Bacteria | 2374 |
| 439 | Ga0157377_10078417 | 3300014745 | Bacteria | 1925 |
| 440 | Ga0157377_10140301 | 3300014745 | Bacteria | 1485 |
| 441 | Ga0157377_10681957 | 3300014745 | Bacteria | 744 |
| 442 | Ga0157377_11044006 | 3300014745 | Bacteria | 622 |
| 443 | Ga0157377_11316128 | 3300014745 | Bacteria | 566 |
| 444 | Ga0157379_10003739 | 3300014968 | Bacteria | 12939 |
| 445 | Ga0157379_10087853 | 3300014968 | Bacteria | 2787 |
| 446 | Ga0157376_10068589 | 3300014969 | Bacteria | 3004 |
| 447 | Ga0157376_10310734 | 3300014969 | Bacteria | 1495 |
| 448 | Ga0157376_10927609 | 3300014969 | Bacteria | 890 |
| 449 | Ga0157376_11247253 | 3300014969 | Bacteria | 772 |
| 450 | Ga0157376_11523918 | 3300014969 | Unclassified | 702 |
| 451 | Ga0157376_11528060 | 3300014969 | Unclassified | 701 |
| 452 | Ga0163161_10011766 | 3300017792 | Bacteria | 6067 |
| 453 | Ga0163161_10478577 | 3300017792 | Unclassified | 1011 |
| 454 | Ga0163161_10552852 | 3300017792 | Unclassified | 944 |
| 455 | Ga0163161_10553520 | 3300017792 | Bacteria | 943 |
| 456 | Ga0163161_10583739 | 3300017792 | Bacteria | 919 |
| 457 | Ga0163161_11582325 | 3300017792 | Bacteria | 577 |
| 458 | Ga0207666_1077723 | 3300025271 | Archaea | 536 |
| 459 | Ga0207673_1004738 | 3300025290 | Unclassified | 1636 |
| 460 | Ga0207697_10001621 | 3300025315 | Bacteria | 12145 |
| 461 | Ga0207697_10102352 | 3300025315 | Bacteria | 1221 |
| 462 | Ga0207682_10001841 | 3300025893 | Bacteria | 9661 |
| 463 | Ga0207682_10010257 | 3300025893 | Bacteria | 3674 |
| 464 | Ga0207682_10013530 | 3300025893 | Bacteria | 3178 |
| 465 | Ga0207682_10052606 | 3300025893 | Bacteria | 1688 |
| 466 | Ga0207682_10593655 | 3300025893 | Unclassified | 522 |
| 467 | Ga0207642_10186498 | 3300025899 | Bacteria | 1135 |
| 468 | Ga0207688_10001443 | 3300025901 | Bacteria | 12425 |
| 469 | Ga0207688_10059067 | 3300025901 | Bacteria | 2159 |
| 470 | Ga0207688_10132575 | 3300025901 | Bacteria | 1461 |
| 471 | Ga0207688_10699274 | 3300025901 | Unclassified | 641 |
| 472 | Ga0207680_10018186 | 3300025903 | Bacteria | 3730 |
| 473 | Ga0207680_10060337 | 3300025903 | Unclassified | 2308 |
| 474 | Ga0207647_10047580 | 3300025904 | Bacteria | 2667 |
| 475 | Ga0207645_10001881 | 3300025907 | Bacteria | 16948 |
| 476 | Ga0207645_10217224 | 3300025907 | Bacteria | 1260 |
| 477 | Ga0207645_10245118 | 3300025907 | Bacteria | 1184 |
| 478 | Ga0207645_10266359 | 3300025907 | Bacteria | 1136 |
| 479 | Ga0207645_10529058 | 3300025907 | Unclassified | 799 |
| 480 | Ga0207643_10004144 | 3300025908 | Bacteria | 7810 |
| 481 | Ga0207643_10005748 | 3300025908 | Bacteria | 6631 |
| 482 | Ga0207643_10053082 | 3300025908 | Bacteria | 2302 |
| 483 | Ga0207643_10053648 | 3300025908 | Bacteria | 2290 |
| 484 | Ga0207643_10076499 | 3300025908 | Bacteria | 1933 |
| 485 | Ga0207643_10234149 | 3300025908 | Unclassified | 1127 |
| 486 | Ga0207643_10605897 | 3300025908 | Bacteria | 705 |
| 487 | Ga0207705_10224675 | 3300025909 | Bacteria | 1427 |
| 488 | Ga0207684_10115149 | 3300025910 | Bacteria | 2302 |
| 489 | Ga0207707_10084480 | 3300025912 | Bacteria | 2772 |
| 490 | Ga0207693_10434261 | 3300025915 | Bacteria | 1026 |
| 491 | Ga0207660_10129706 | 3300025917 | Bacteria | 1918 |
| 492 | Ga0207660_10199381 | 3300025917 | Bacteria | 1563 |
| 493 | Ga0207660_10513750 | 3300025917 | Unclassified | 972 |
| 494 | Ga0207660_10725343 | 3300025917 | Bacteria | 811 |
| 495 | Ga0207662_10002054 | 3300025918 | Bacteria | 9973 |
| 496 | Ga0207662_10004271 | 3300025918 | Bacteria | 7500 |
| 497 | Ga0207662_10028524 | 3300025918 | Bacteria | 3228 |
| 498 | Ga0207662_10129801 | 3300025918 | Bacteria | 1588 |
| 499 | Ga0207657_10899733 | 3300025919 | Unclassified | 682 |
| 500 | Ga0207649_10023217 | 3300025920 | Bacteria | 3590 |
| 501 | Ga0207649_10267003 | 3300025920 | Bacteria | 1239 |
| 502 | Ga0207649_10466101 | 3300025920 | Bacteria | 956 |
| 503 | Ga0207649_11297535 | 3300025920 | Unclassified | 576 |
| 504 | Ga0207652_10701069 | 3300025921 | Unclassified | 903 |
| 505 | Ga0207652_10750787 | 3300025921 | Bacteria | 868 |
| 506 | Ga0207646_10020399 | 3300025922 | Bacteria | 6142 |
| 507 | Ga0207646_10166267 | 3300025922 | Bacteria | 1991 |
| 508 | Ga0207646_10177495 | 3300025922 | Bacteria | 1924 |
| 509 | Ga0207646_10231923 | 3300025922 | Bacteria | 1668 |
| 510 | Ga0207646_10270986 | 3300025922 | Bacteria | 1534 |
| 511 | Ga0207681_10000566 | 3300025923 | Bacteria | 25276 |
| 512 | Ga0207681_10077568 | 3300025923 | Bacteria | 2336 |
| 513 | Ga0207681_10088862 | 3300025923 | Bacteria | 2201 |
| 514 | Ga0207681_10210141 | 3300025923 | Bacteria | 1499 |
| 515 | Ga0207681_10542263 | 3300025923 | Unclassified | 956 |
| 516 | Ga0207650_10037192 | 3300025925 | Bacteria | 3546 |
| 517 | Ga0207650_10126129 | 3300025925 | Bacteria | 1998 |
| 518 | Ga0207650_10148492 | 3300025925 | Bacteria | 1848 |
| 519 | Ga0207650_10182355 | 3300025925 | Bacteria | 1673 |
| 520 | Ga0207650_10273829 | 3300025925 | Bacteria | 1373 |
| 521 | Ga0207650_10437743 | 3300025925 | Bacteria | 1087 |
| 522 | Ga0207650_10569237 | 3300025925 | Bacteria | 951 |
| 523 | Ga0207650_11065203 | 3300025925 | Bacteria | 688 |
| 524 | Ga0207650_11118654 | 3300025925 | Bacteria | 670 |
| 525 | Ga0207659_10001222 | 3300025926 | Bacteria | 15363 |
| 526 | Ga0207659_10002242 | 3300025926 | Bacteria | 11514 |
| 527 | Ga0207659_10004787 | 3300025926 | Bacteria | 8206 |
| 528 | Ga0207659_10007569 | 3300025926 | Bacteria | 6690 |
| 529 | Ga0207659_10027161 | 3300025926 | Bacteria | 3871 |
| 530 | Ga0207659_10032972 | 3300025926 | Bacteria | 3559 |
| 531 | Ga0207659_10048877 | 3300025926 | Bacteria | 2998 |
| 532 | Ga0207659_10071033 | 3300025926 | Bacteria | 2541 |
| 533 | Ga0207659_10402165 | 3300025926 | Unclassified | 1146 |
| 534 | Ga0207659_10510909 | 3300025926 | Bacteria | 1018 |
| 535 | Ga0207687_10849320 | 3300025927 | Archaea | 780 |
| 536 | Ga0207644_10154004 | 3300025931 | Bacteria | 1781 |
| 537 | Ga0207644_10748292 | 3300025931 | Bacteria | 816 |
| 538 | Ga0207644_10882921 | 3300025931 | Unclassified | 749 |
| 539 | Ga0207690_10165282 | 3300025932 | Bacteria | 1653 |
| 540 | Ga0207690_10184925 | 3300025932 | Bacteria | 1572 |
| 541 | Ga0207690_10250642 | 3300025932 | Bacteria | 1368 |
| 542 | Ga0207706_10003425 | 3300025933 | Bacteria | 15142 |
| 543 | Ga0207706_10037583 | 3300025933 | Bacteria | 4298 |
| 544 | Ga0207706_10057657 | 3300025933 | Bacteria | 3421 |
| 545 | Ga0207706_10146880 | 3300025933 | Bacteria | 2074 |
| 546 | Ga0207706_10336125 | 3300025933 | Bacteria | 1314 |
| 547 | Ga0207706_10766219 | 3300025933 | Unclassified | 821 |
| 548 | Ga0207706_10833559 | 3300025933 | Bacteria | 782 |
| 549 | Ga0207686_10113634 | 3300025934 | Bacteria | 1831 |
| 550 | Ga0207686_10552084 | 3300025934 | Bacteria | 901 |
| 551 | Ga0207686_10822442 | 3300025934 | Bacteria | 746 |
| 552 | Ga0207709_10161212 | 3300025935 | Bacteria | 1564 |
| 553 | Ga0207670_10003736 | 3300025936 | Bacteria | 8086 |
| 554 | Ga0207670_10006525 | 3300025936 | Bacteria | 6477 |
| 555 | Ga0207670_10362549 | 3300025936 | Bacteria | 1150 |
| 556 | Ga0207669_10001529 | 3300025937 | Bacteria | 9860 |
| 557 | Ga0207669_10428381 | 3300025937 | Bacteria | 1043 |
| 558 | Ga0207669_10833780 | 3300025937 | Bacteria | 766 |
| 559 | Ga0207669_11139124 | 3300025937 | Unclassified | 659 |
| 560 | Ga0207704_10053194 | 3300025938 | Bacteria | 2459 |
| 561 | Ga0207704_11537265 | 3300025938 | Bacteria | 571 |
| 562 | Ga0207691_10012691 | 3300025940 | Bacteria | 8070 |
| 563 | Ga0207691_10050039 | 3300025940 | Bacteria | 3826 |
| 564 | Ga0207691_10055581 | 3300025940 | Bacteria | 3607 |
| 565 | Ga0207691_10085089 | 3300025940 | Bacteria | 2838 |
| 566 | Ga0207691_10088306 | 3300025940 | Bacteria | 2780 |
| 567 | Ga0207691_10180664 | 3300025940 | Bacteria | 1844 |
| 568 | Ga0207691_10256872 | 3300025940 | Unclassified | 1507 |
| 569 | Ga0207691_10365531 | 3300025940 | Bacteria | 1233 |
| 570 | Ga0207691_10817532 | 3300025940 | Bacteria | 782 |
| 571 | Ga0207711_10083185 | 3300025941 | Bacteria | 2799 |
| 572 | Ga0207711_10169955 | 3300025941 | Unclassified | 1978 |
| 573 | Ga0207711_10242585 | 3300025941 | Bacteria | 1652 |
| 574 | Ga0207689_10000831 | 3300025942 | Bacteria | 29759 |
| 575 | Ga0207689_10048175 | 3300025942 | Bacteria | 3515 |
| 576 | Ga0207689_10084887 | 3300025942 | Bacteria | 2603 |
| 577 | Ga0207661_10028828 | 3300025944 | Bacteria | 4256 |
| 578 | Ga0207679_10029892 | 3300025945 | Bacteria | 3798 |
| 579 | Ga0207679_10082888 | 3300025945 | Bacteria | 2456 |
| 580 | Ga0207679_10294889 | 3300025945 | Bacteria | 1395 |
| 581 | Ga0207679_10586087 | 3300025945 | Bacteria | 1003 |
| 582 | Ga0207679_10757637 | 3300025945 | Bacteria | 883 |
| 583 | Ga0207679_11454145 | 3300025945 | Bacteria | 629 |
| 584 | Ga0207651_10025082 | 3300025960 | Bacteria | 3701 |
| 585 | Ga0207651_10096190 | 3300025960 | Bacteria | 2183 |
| 586 | Ga0207651_10125337 | 3300025960 | Bacteria | 1956 |
| 587 | Ga0207651_10180642 | 3300025960 | Bacteria | 1673 |
| 588 | Ga0207651_10244533 | 3300025960 | Bacteria | 1464 |
| 589 | Ga0207651_10380877 | 3300025960 | Bacteria | 1195 |
| 590 | Ga0207651_10622228 | 3300025960 | Bacteria | 946 |
| 591 | Ga0207651_10709019 | 3300025960 | Bacteria | 887 |
| 592 | Ga0207712_10002418 | 3300025961 | Bacteria | 12069 |
| 593 | Ga0207712_10464140 | 3300025961 | Bacteria | 1076 |
| 594 | Ga0207668_10118148 | 3300025972 | Bacteria | 2003 |
| 595 | Ga0207668_10150849 | 3300025972 | Bacteria | 1799 |
| 596 | Ga0207668_10159885 | 3300025972 | Bacteria | 1754 |
| 597 | Ga0207668_10269874 | 3300025972 | Bacteria | 1390 |
| 598 | Ga0207668_11030614 | 3300025972 | Bacteria | 736 |
| 599 | Ga0207640_10067322 | 3300025981 | Bacteria | 2396 |
| 600 | Ga0207640_10250656 | 3300025981 | Bacteria | 1374 |
| 601 | Ga0207640_11766552 | 3300025981 | Unclassified | 559 |
| 602 | Ga0207640_12203733 | 3300025981 | Unclassified | 500 |
| 603 | Ga0207658_10012438 | 3300025986 | Bacteria | 5814 |
| 604 | Ga0207658_10346730 | 3300025986 | Bacteria | 1292 |
| 605 | Ga0207658_11138384 | 3300025986 | Unclassified | 713 |
| 606 | Ga0207658_11145954 | 3300025986 | Unclassified | 711 |
| 607 | Ga0207677_10063258 | 3300026023 | Bacteria | 2571 |
| 608 | Ga0207677_10145249 | 3300026023 | Bacteria | 1822 |
| 609 | Ga0207677_10603857 | 3300026023 | Unclassified | 963 |
| 610 | Ga0207703_10042317 | 3300026035 | Bacteria | 3654 |
| 611 | Ga0207703_10141518 | 3300026035 | Bacteria | 2088 |
| 612 | Ga0207703_10289415 | 3300026035 | Unclassified | 1490 |
| 613 | Ga0207703_10472240 | 3300026035 | Bacteria | 1174 |
| 614 | Ga0207639_11705257 | 3300026041 | Bacteria | 590 |
| 615 | Ga0207708_10017222 | 3300026075 | Bacteria | 5439 |
| 616 | Ga0207708_10095321 | 3300026075 | Bacteria | 2298 |
| 617 | Ga0207708_10159192 | 3300026075 | Bacteria | 1782 |
| 618 | Ga0207708_10269838 | 3300026075 | Bacteria | 1376 |
| 619 | Ga0207708_11023236 | 3300026075 | Bacteria | 718 |
| 620 | Ga0207641_10097682 | 3300026088 | Bacteria | 2582 |
| 621 | Ga0207641_10105045 | 3300026088 | Bacteria | 2494 |
| 622 | Ga0207641_10792093 | 3300026088 | Bacteria | 937 |
| 623 | Ga0207641_11460006 | 3300026088 | Bacteria | 685 |
| 624 | Ga0207641_11546920 | 3300026088 | Unclassified | 665 |
| 625 | Ga0207648_10000446 | 3300026089 | Bacteria | 45706 |
| 626 | Ga0207648_10046637 | 3300026089 | Bacteria | 3800 |
| 627 | Ga0207648_10062997 | 3300026089 | Unclassified | 3232 |
| 628 | Ga0207648_10410519 | 3300026089 | Bacteria | 1228 |
| 629 | Ga0207648_10474768 | 3300026089 | Unclassified | 1141 |
| 630 | Ga0207648_10708929 | 3300026089 | Unclassified | 933 |
| 631 | Ga0207648_11114991 | 3300026089 | Bacteria | 740 |
| 632 | Ga0207676_10010914 | 3300026095 | Bacteria | 6481 |
| 633 | Ga0207676_10026175 | 3300026095 | Bacteria | 4337 |
| 634 | Ga0207676_10306404 | 3300026095 | Bacteria | 1452 |
| 635 | Ga0207676_11021163 | 3300026095 | Bacteria | 815 |
| 636 | Ga0207676_11105762 | 3300026095 | Bacteria | 784 |
| 637 | Ga0207674_10176364 | 3300026116 | Bacteria | 2089 |
| 638 | Ga0207674_10185565 | 3300026116 | Bacteria | 2030 |
| 639 | Ga0207674_10465004 | 3300026116 | Bacteria | 1223 |
| 640 | Ga0207674_10633889 | 3300026116 | Bacteria | 1032 |
| 641 | Ga0207674_11192251 | 3300026116 | Archaea | 731 |
| 642 | Ga0207674_11281744 | 3300026116 | Unclassified | 702 |
| 643 | Ga0207675_100001058 | 3300026118 | Bacteria | 27297 |
| 644 | Ga0207675_100004015 | 3300026118 | Bacteria | 14272 |
| 645 | Ga0207675_100094653 | 3300026118 | Unclassified | 2810 |
| 646 | Ga0207675_100770580 | 3300026118 | Bacteria | 974 |
| 647 | Ga0207675_100794938 | 3300026118 | Unclassified | 959 |
| 648 | Ga0207675_101820305 | 3300026118 | Bacteria | 628 |
| 649 | Ga0207683_10021244 | 3300026121 | Bacteria | 5554 |
| 650 | Ga0207683_10128891 | 3300026121 | Unclassified | 2275 |
| 651 | Ga0207683_10135522 | 3300026121 | Bacteria | 2216 |
| 652 | Ga0207683_10451795 | 3300026121 | Bacteria | 1185 |
| 653 | Ga0207683_10624160 | 3300026121 | Bacteria | 998 |
| 654 | Ga0207683_10670690 | 3300026121 | Unclassified | 961 |
| 655 | Ga0207683_10808344 | 3300026121 | Bacteria | 870 |
| 656 | Ga0207683_10814772 | 3300026121 | Bacteria | 867 |
| 657 | Ga0207698_10509518 | 3300026142 | Unclassified | 1172 |
| 658 | Ga0209968_1053945 | 3300027526 | Unclassified | 702 |
| 659 | Ga0210002_1084402 | 3300027617 | Bacteria | 567 |
| 660 | Ga0207428_10000224 | 3300027907 | Bacteria | 78533 |
| 661 | Ga0207428_10000353 | 3300027907 | Bacteria | 59325 |
| 662 | Ga0207428_10004706 | 3300027907 | Bacteria | 12908 |
| 663 | Ga0207428_10005989 | 3300027907 | Bacteria | 11257 |
| 664 | Ga0207428_10010077 | 3300027907 | Bacteria | 8459 |
| 665 | Ga0207428_10304822 | 3300027907 | Bacteria | 1178 |
| 666 | Ga0207428_10465962 | 3300027907 | Bacteria | 920 |
| 667 | Ga0268266_10312547 | 3300028379 | Bacteria | 1469 |
| 668 | Ga0268265_10000540 | 3300028380 | Bacteria | 38471 |
| 669 | Ga0268265_10055567 | 3300028380 | Bacteria | 3008 |
| 670 | Ga0268265_10374861 | 3300028380 | Bacteria | 1307 |
| 671 | Ga0268265_10622631 | 3300028380 | Bacteria | 1034 |
| 672 | Ga0268265_10913339 | 3300028380 | Bacteria | 863 |
| 673 | Ga0268265_11372760 | 3300028380 | Unclassified | 708 |
| 674 | Ga0268265_12172198 | 3300028380 | Unclassified | 562 |
| 675 | Ga0268264_10012807 | 3300028381 | Bacteria | 6902 |
| 676 | Ga0268264_10115573 | 3300028381 | Bacteria | 2357 |
| 677 | Ga0268264_10879495 | 3300028381 | Unclassified | 898 |
| 678 | Ga0268264_11413075 | 3300028381 | Unclassified | 706 |
| 679 | Ga0307408_100364100 | 3300031548 | Unclassified | 1231 |
| 680 | Ga0307408_100388393 | 3300031548 | Bacteria | 1195 |
| 681 | Ga0307408_101045124 | 3300031548 | Unclassified | 755 |
| 682 | Ga0307405_10003692 | 3300031731 | Bacteria | 7100 |
| 683 | Ga0307405_10091958 | 3300031731 | Bacteria | 2011 |
| 684 | Ga0307405_10751537 | 3300031731 | Unclassified | 812 |
| 685 | Ga0307413_10045918 | 3300031824 | Bacteria | 2593 |
| 686 | Ga0307413_10140375 | 3300031824 | Bacteria | 1669 |
| 687 | Ga0307413_11234604 | 3300031824 | Unclassified | 651 |
| 688 | Ga0307413_11805844 | 3300031824 | Unclassified | 547 |
| 689 | Ga0307410_10005392 | 3300031852 | Bacteria | 6761 |
| 690 | Ga0307410_10123448 | 3300031852 | Bacteria | 1892 |
| 691 | Ga0307410_10141882 | 3300031852 | Bacteria | 1778 |
| 692 | Ga0307410_11728725 | 3300031852 | Bacteria | 555 |
| 693 | Ga0307406_10041702 | 3300031901 | Bacteria | 2861 |
| 694 | Ga0307406_11405123 | 3300031901 | Bacteria | 612 |
| 695 | Ga0307407_10004637 | 3300031903 | Bacteria | 5864 |
| 696 | Ga0307407_10060573 | 3300031903 | Bacteria | 2209 |
| 697 | Ga0307407_10968281 | 3300031903 | Bacteria | 656 |
| 698 | Ga0307412_10009853 | 3300031911 | Bacteria | 5490 |
| 699 | Ga0307412_10083761 | 3300031911 | Bacteria | 2212 |
| 700 | Ga0307412_10671720 | 3300031911 | Bacteria | 886 |
| 701 | Ga0307412_10934579 | 3300031911 | Bacteria | 762 |
| 702 | Ga0307409_100004850 | 3300031995 | Bacteria | 7639 |
| 703 | Ga0307409_100018258 | 3300031995 | Bacteria | 4708 |
| 704 | Ga0307409_100104257 | 3300031995 | Bacteria | 2361 |
| 705 | Ga0307409_100115339 | 3300031995 | Bacteria | 2261 |
| 706 | Ga0307409_100147164 | 3300031995 | Bacteria | 2039 |
| 707 | Ga0307409_100334185 | 3300031995 | Bacteria | 1423 |
| 708 | Ga0307409_100927127 | 3300031995 | Bacteria | 886 |
| 709 | Ga0307416_100004482 | 3300032002 | Bacteria | 8423 |
| 710 | Ga0307416_100012439 | 3300032002 | Bacteria | 5733 |
| 711 | Ga0307416_100072394 | 3300032002 | Bacteria | 2868 |
| 712 | Ga0307416_100119105 | 3300032002 | Bacteria | 2348 |
| 713 | Ga0307416_100290128 | 3300032002 | Bacteria | 1619 |
| 714 | Ga0307416_100530497 | 3300032002 | Bacteria | 1247 |
| 715 | Ga0307416_100791711 | 3300032002 | Bacteria | 1043 |
| 716 | Ga0307416_101584211 | 3300032002 | Unclassified | 760 |
| 717 | Ga0307416_101974363 | 3300032002 | Bacteria | 686 |
| 718 | Ga0307416_102130950 | 3300032002 | Unclassified | 662 |
| 719 | Ga0307416_102784627 | 3300032002 | Unclassified | 585 |
| 720 | Ga0307416_103018112 | 3300032002 | Unclassified | 563 |
| 721 | Ga0307416_103157408 | 3300032002 | Unclassified | 551 |
| 722 | Ga0307414_10366728 | 3300032004 | Bacteria | 1241 |
| 723 | Ga0307414_10418639 | 3300032004 | Bacteria | 1168 |
| 724 | Ga0307414_10549306 | 3300032004 | Bacteria | 1029 |
| 725 | Ga0307411_10003247 | 3300032005 | Bacteria | 7497 |
| 726 | Ga0307411_10029786 | 3300032005 | Bacteria | 3339 |
| 727 | Ga0307411_10819408 | 3300032005 | Bacteria | 821 |
| 728 | Ga0307411_12312917 | 3300032005 | Bacteria | 505 |
| 729 | Ga0307415_100007237 | 3300032126 | Bacteria | 6058 |
| 730 | Ga0307415_100068095 | 3300032126 | Unclassified | 2490 |
| 731 | Ga0307415_100134002 | 3300032126 | Bacteria | 1880 |
| 732 | Ga0307415_101561037 | 3300032126 | Unclassified | 633 |
| 733 | Ga0373958_0149005 | 3300034819 | Archaea | 584 |
| 734 | Ga0373940_0089324 | 3300035088 | Bacteria | 921 |
| 735 | Ga0373939_0279073 | 3300035114 | Unclassified | 659 |
| 736 | Ga0373941_0201517 | 3300035115 | Unclassified | 757 |
| 737 | Ga0373941_0428774 | 3300035115 | Archaea | 551 |
| 738 | Ga0373961_0222983 | 3300035241 | Unclassified | 673 |
| 739 | Ga0242420_143832 | 3300038996 | Unclassified | 532 |
| 740 | Ga0451853_1692674 | 3300041512 | Unclassified | 774 |
| 741 | Ga0451853_3527350 | 3300041512 | Unclassified | 983 |
| 742 | Ga0439442_126911 | 3300042002 | Unclassified | 560 |
| 743 | Ga0439454_116389 | 3300042011 | Archaea | 514 |
| 744 | Ga0439434_0071318 | 3300042435 | Bacteria | 1094 |
| 745 | Ga0439444_0009088 | 3300042437 | Bacteria | 1560 |
| 746 | Ga0439460_0244470 | 3300042461 | Bacteria | 619 |
| 747 | Ga0451577_0607601 | 3300042876 | Bacteria | 992 |
| 748 | Ga0439440_0104320 | 3300042993 | Bacteria | 774 |
| 749 | Ga0451576_0007819 | 3300045051 | Bacteria | 12670 |
| 750 | Ga0451576_0013731 | 3300045051 | Bacteria | 9047 |
| 751 | Ga0451576_0067399 | 3300045051 | Bacteria | 3726 |
| 752 | Ga0451576_0079338 | 3300045051 | Bacteria | 3415 |
| 753 | Ga0451576_0186928 | 3300045051 | Bacteria | 2163 |
| 754 | Ga0451576_0705066 | 3300045051 | Bacteria | 1060 |
| 755 | Ga0495603_0188771 | 3300046455 | Bacteria | 1192 |
| 756 | Ga0495629_0057974 | 3300046459 | Bacteria | 2707 |
| 757 | Ga0495580_0339705 | 3300046472 | Bacteria | 1019 |
| 758 | Ga0495580_0532991 | 3300046472 | Bacteria | 781 |
| 759 | Ga0495585_0147225 | 3300046492 | Unclassified | 1230 |
| 760 | Ga0495594_0028254 | 3300046499 | Bacteria | 3026 |
| 761 | Ga0495643_0001548 | 3300046522 | Bacteria | 20538 |
| 762 | Ga0495644_0019673 | 3300046523 | Bacteria | 2578 |
| 763 | Ga0495642_0046137 | 3300046528 | Bacteria | 1782 |
| 764 | Ga0495642_0048601 | 3300046528 | Bacteria | 1741 |
| 765 | Ga0495598_0240921 | 3300046537 | Bacteria | 667 |
| 766 | Ga0495598_0383849 | 3300046537 | Bacteria | 546 |
| 767 | Ga0495609_0147241 | 3300046538 | Bacteria | 1003 |
| 768 | Ga0495621_0015340 | 3300046539 | Bacteria | 2442 |
| 769 | Ga0495621_0107764 | 3300046539 | Bacteria | 1066 |
| 770 | Ga0495621_0177265 | 3300046539 | Unclassified | 849 |
| 771 | Ga0495656_0059120 | 3300046615 | Bacteria | 1666 |
| 772 | Ga0495659_0003442 | 3300046664 | Bacteria | 5051 |
| 773 | Ga0495659_0013145 | 3300046664 | Bacteria | 2693 |
| 774 | Ga0495659_0190341 | 3300046664 | Unclassified | 838 |
| 775 | Ga0495659_0308799 | 3300046664 | Unclassified | 669 |
| 776 | Ga0495659_0348468 | 3300046664 | Unclassified | 632 |
| 777 | Ga0495588_0024382 | 3300046674 | Bacteria | 3005 |
| 778 | Ga0495658_0097707 | 3300046683 | Bacteria | 1748 |
| 779 | Ga0495669_0462621 | 3300046684 | Bacteria | 616 |
| 780 | Ga0495670_0118046 | 3300046691 | Bacteria | 1377 |
| 781 | Ga0495670_0173556 | 3300046691 | Unclassified | 1136 |
| 782 | Ga0495670_0483775 | 3300046691 | Bacteria | 672 |
| 783 | Ga0495589_0492716 | 3300046794 | Unclassified | 560 |
| 784 | Ga0495636_0063710 | 3300047318 | Bacteria | 1563 |
| 785 | Ga0495677_0028335 | 3300047445 | Bacteria | 2034 |
| 786 | Ga0495677_0195527 | 3300047445 | Bacteria | 786 |
| 787 | Ga0496104_0815228 | 3300048907 | Bacteria | 839 |
| 788 | Ga0496108_1280058 | 3300048911 | Bacteria | 617 |
| 789 | Ga0496110_0387822 | 3300048913 | Bacteria | 1273 |
| 790 | Ga0496112_1640137 | 3300048915 | Unclassified | 556 |
| 791 | Ga0501290_071205 | 3300049513 | Bacteria | 577 |
| 792 | Ga0501298_154992 | 3300049521 | Unclassified | 562 |
| 793 | Ga0501031_0284762 | 3300049568 | Unclassified | 1072 |
| 794 | Ga0501033_0768025 | 3300049570 | Unclassified | 653 |
| 795 | Ga0501036_0315208 | 3300049572 | Bacteria | 1307 |
| 796 | Ga0501036_0665359 | 3300049572 | Unclassified | 862 |
| 797 | Ga0501037_0599418 | 3300049573 | Unclassified | 740 |
| 798 | Ga0501037_0639497 | 3300049573 | Unclassified | 712 |
| 799 | Ga0501038_0856032 | 3300049574 | Bacteria | 673 |
| 800 | Ga0501038_1061858 | 3300049574 | Unclassified | 593 |
| 801 | Ga0501039_0007557 | 3300049575 | Bacteria | 8303 |
| 802 | Ga0501039_0056186 | 3300049575 | Bacteria | 3049 |
| 803 | Ga0501039_0299496 | 3300049575 | Bacteria | 1264 |
| 804 | Ga0501040_0012945 | 3300049576 | Bacteria | 5483 |
| 805 | Ga0501041_0135843 | 3300049577 | Bacteria | 1532 |
| 806 | Ga0501041_0227101 | 3300049577 | Bacteria | 1172 |
| 807 | Ga0501042_0003889 | 3300049578 | Bacteria | 9445 |
| 808 | Ga0501042_0286231 | 3300049578 | Bacteria | 1190 |
| 809 | Ga0501042_0632904 | 3300049578 | Bacteria | 778 |
| 810 | Ga0501043_0936479 | 3300049579 | Unclassified | 619 |
| 811 | Ga0501046_0074757 | 3300049580 | Bacteria | 2628 |
| 812 | Ga0501048_0035520 | 3300049582 | Bacteria | 3588 |
| 813 | Ga0501048_0107006 | 3300049582 | Bacteria | 1974 |
| 814 | Ga0501067_0296343 | 3300049583 | Unclassified | 900 |
| 815 | Ga0501068_0368144 | 3300049584 | Unclassified | 925 |
| 816 | Ga0501069_0586049 | 3300049585 | Unclassified | 669 |
| 817 | Ga0501071_0821372 | 3300049587 | Unclassified | 717 |
| 818 | Ga0501072_0008859 | 3300049588 | Bacteria | 7644 |
| 819 | Ga0501072_0027578 | 3300049588 | Bacteria | 4430 |
| 820 | Ga0501072_0205831 | 3300049588 | Bacteria | 1569 |
| 821 | Ga0501072_0352631 | 3300049588 | Bacteria | 1168 |
| 822 | Ga0501072_0392733 | 3300049588 | Unclassified | 1101 |
| 823 | Ga0501075_0098439 | 3300049591 | Bacteria | 2220 |
| 824 | Ga0501075_0156761 | 3300049591 | Bacteria | 1736 |
| 825 | Ga0501075_0293114 | 3300049591 | Bacteria | 1239 |
| 826 | Ga0501075_0502202 | 3300049591 | Bacteria | 925 |
| 827 | Ga0501076_0009175 | 3300049592 | Bacteria | 7291 |
| 828 | Ga0501076_0044775 | 3300049592 | Bacteria | 3491 |
| 829 | Ga0501076_0156572 | 3300049592 | Bacteria | 1855 |
| 830 | Ga0501076_0214437 | 3300049592 | Bacteria | 1574 |
| 831 | Ga0501076_0311423 | 3300049592 | Bacteria | 1291 |
| 832 | Ga0501076_1659100 | 3300049592 | Bacteria | 524 |
| 833 | Ga0501208_041509 | 3300049655 | Bacteria | 851 |
| 834 | Ga0501249_016262 | 3300049679 | Bacteria | 1597 |
| 835 | Ga0501249_200628 | 3300049679 | Unclassified | 523 |
| 836 | Ga0501221_137825 | 3300049704 | Bacteria | 637 |
| 837 | Ga0501245_059587 | 3300049708 | Bacteria | 695 |
| 838 | Ga0501079_0034154 | 3300049741 | Bacteria | 3913 |
| 839 | Ga0501079_0075401 | 3300049741 | Bacteria | 2608 |
| 840 | Ga0501079_0133364 | 3300049741 | Bacteria | 1933 |
| 841 | Ga0501079_0445534 | 3300049741 | Bacteria | 1017 |
| 842 | Ga0501079_0480084 | 3300049741 | Bacteria | 977 |
| 843 | Ga0501080_0553263 | 3300049742 | Unclassified | 1025 |
| 844 | Ga0501080_0994261 | 3300049742 | Unclassified | 728 |
| 845 | Ga0501081_0048284 | 3300049743 | Bacteria | 2929 |
| 846 | Ga0501081_0190447 | 3300049743 | Bacteria | 1485 |
| 847 | Ga0501081_0224269 | 3300049743 | Bacteria | 1367 |
| 848 | Ga0501081_0339545 | 3300049743 | Bacteria | 1106 |
| 849 | Ga0501081_0384370 | 3300049743 | Bacteria | 1038 |
| 850 | Ga0501081_0386495 | 3300049743 | Unclassified | 1035 |
| 851 | Ga0501081_0625649 | 3300049743 | Unclassified | 806 |
| 852 | Ga0501081_0869432 | 3300049743 | Bacteria | 679 |
| 853 | Ga0501083_0641713 | 3300049744 | Unclassified | 691 |
| 854 | Ga0501272_020596 | 3300049769 | Unclassified | 791 |
| 855 | Ga0501283_035584 | 3300049779 | Unclassified | 848 |
| 856 | Ga0501045_0024405 | 3300049824 | Bacteria | 4341 |
| 857 | Ga0501045_0157688 | 3300049824 | Unclassified | 1689 |
| 858 | nmdc:mga05p37_1167638_c1 | 3300050507 | Bacteria | 799 |
| 859 | nmdc:mga05p37_155524_c1 | 3300050507 | Bacteria | 2795 |
| 860 | nmdc:mga05p37_1654227_c1 | 3300050507 | Unclassified | 627 |
| 861 | nmdc:mga05p37_1656263_c1 | 3300050507 | Unclassified | 627 |
| 862 | nmdc:mga05p37_17011_c1 | 3300050507 | Bacteria | 8770 |
| 863 | nmdc:mga05p37_200071_c1 | 3300050507 | Bacteria | 2420 |
| 864 | nmdc:mga05p37_244730_c1 | 3300050507 | Bacteria | 2154 |
| 865 | nmdc:mga05p37_395165_c1 | 3300050507 | Bacteria | 1616 |
| 866 | nmdc:mga05p37_503469_c1 | 3300050507 | Unclassified | 1389 |
| 867 | nmdc:mga05p37_56561_c1 | 3300050507 | Bacteria | 4830 |
| 868 | nmdc:mga05p37_70703_c1 | 3300050507 | Bacteria | 4293 |
| 869 | nmdc:mga05p37_974417_c1 | 3300050507 | Bacteria | 904 |
| 870 | nmdc:mga09592_240558_c1 | 3300050508 | Bacteria | 1568 |
| 871 | nmdc:mga09592_275748_c1 | 3300050508 | Bacteria | 1459 |
| 872 | nmdc:mga09592_29049_c1 | 3300050508 | Bacteria | 4598 |
| 873 | nmdc:mga09592_334982_c1 | 3300050508 | Bacteria | 1310 |
| 874 | nmdc:mga09592_504093_c1 | 3300050508 | Unclassified | 1042 |
| 875 | nmdc:mga09592_61109_c1 | 3300050508 | Bacteria | 3186 |
| 876 | nmdc:mga09592_80073_c1 | 3300050508 | Bacteria | 2781 |
| 877 | nmdc:mga0qj67_280529_c1 | 3300050509 | Bacteria | 1350 |
| 878 | nmdc:mga0qj67_526_c1 | 3300050509 | Bacteria | 26048 |
| 879 | nmdc:mga0qj67_5293_c1 | 3300050509 | Bacteria | 9413 |
| 880 | nmdc:mga0qj67_541447_c1 | 3300050509 | Bacteria | 934 |
| 881 | nmdc:mga0qj67_5798_c1 | 3300050509 | Bacteria | 9039 |
| 882 | nmdc:mga06r32_107386_c1 | 3300050510 | Bacteria | 2743 |
| 883 | nmdc:mga06r32_127805_c1 | 3300050510 | Unclassified | 2511 |
| 884 | nmdc:mga06r32_18027_c1 | 3300050510 | Bacteria | 6456 |
| 885 | nmdc:mga06r32_24815_c1 | 3300050510 | Bacteria | 5572 |
| 886 | nmdc:mga06r32_310457_c1 | 3300050510 | Bacteria | 1563 |
| 887 | nmdc:mga06r32_610525_c1 | 3300050510 | Bacteria | 1061 |
| 888 | nmdc:mga08y16_15575_c1 | 3300050511 | Bacteria | 7995 |
| 889 | nmdc:mga08y16_167360_c1 | 3300050511 | Bacteria | 2284 |
| 890 | nmdc:mga08y16_168786_c1 | 3300050511 | Bacteria | 2273 |
| 891 | nmdc:mga08y16_1836417_c1 | 3300050511 | Unclassified | 558 |
| 892 | nmdc:mga08y16_41616_c1 | 3300050511 | Bacteria | 4813 |
| 893 | nmdc:mga08y16_467911_c1 | 3300050511 | Bacteria | 1284 |
| 894 | nmdc:mga08y16_575165_c1 | 3300050511 | Bacteria | 1138 |
| 895 | nmdc:mga08y16_5828_c1 | 3300050511 | Bacteria | 12911 |
| 896 | nmdc:mga08y16_60586_c1 | 3300050511 | Bacteria | 3953 |
| 897 | nmdc:mga08y16_684391_c1 | 3300050511 | Unclassified | 1027 |
| 898 | nmdc:mga08y16_945_c1 | 3300050511 | Bacteria | 28237 |
| 899 | nmdc:mga08y16_958632_c1 | 3300050511 | Bacteria | 838 |
| 900 | nmdc:mga08y16_979410_c1 | 3300050511 | Bacteria | 827 |
| 901 | nmdc:mga0n895_1446644_c1 | 3300050512 | Unclassified | 655 |
| 902 | nmdc:mga0n895_32666_c1 | 3300050512 | Bacteria | 4996 |
| 903 | nmdc:mga0n895_465314_c1 | 3300050512 | Bacteria | 1276 |
| 904 | nmdc:mga0n895_65768_c1 | 3300050512 | Bacteria | 3589 |
| 905 | nmdc:mga0n895_809892_c1 | 3300050512 | Unclassified | 927 |
| 906 | nmdc:mga0n895_88881_c1 | 3300050512 | Bacteria | 3090 |
| 907 | nmdc:mga0n895_90365_c1 | 3300050512 | Bacteria | 3064 |
| 908 | nmdc:mga0rr50_102607_c1 | 3300050513 | Bacteria | 2250 |
| 909 | nmdc:mga0rr50_111579_c1 | 3300050513 | Bacteria | 2164 |
| 910 | nmdc:mga0rr50_1506752_c1 | 3300050513 | Bacteria | 569 |
| 911 | nmdc:mga0rr50_63989_c1 | 3300050513 | Bacteria | 2780 |
| 912 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 913 | nmdc:mga0a205_107387_c1 | 3300050515 | Bacteria | 2689 |
| 914 | nmdc:mga0a205_1497_c1 | 3300050515 | Bacteria | 19917 |
| 915 | nmdc:mga0a205_161479_c1 | 3300050515 | Bacteria | 2137 |
| 916 | nmdc:mga0a205_422640_c1 | 3300050515 | Unclassified | 1195 |
| 917 | nmdc:mga0a205_55600_c1 | 3300050515 | Bacteria | 3822 |
| 918 | nmdc:mga0a205_68363_c1 | 3300050515 | Bacteria | 3431 |
| 919 | nmdc:mga0a205_91795_c1 | 3300050515 | Bacteria | 2934 |
| 920 | nmdc:mga0a205_94654_c1 | 3300050515 | Bacteria | 2886 |
| 921 | Ga0500556_0007638 | 3300053104 | Bacteria | 3095 |
| 922 | Ga0501084_0148547 | 3300054114 | Bacteria | 1975 |
| 923 | Ga0501084_0250372 | 3300054114 | Bacteria | 1496 |
| 924 | Ga0501084_0465655 | 3300054114 | Unclassified | 1069 |
| 925 | Ga0501084_0764188 | 3300054114 | Bacteria | 814 |
| 926 | Ga0590071_000198 | 3300059421 | Bacteria | 17604 |
| 927 | Ga0590071_001421 | 3300059421 | Bacteria | 6337 |
| 928 | Ga0590071_007060 | 3300059421 | Bacteria | 2658 |
| 929 | Ga0590074_009905 | 3300059423 | Bacteria | 1591 |
| 930 | Ga0590075_000275 | 3300059424 | Bacteria | 14557 |
| 931 | Ga0590075_007624 | 3300059424 | Bacteria | 2576 |
| 932 | Ga0590077_000049 | 3300059426 | Bacteria | 28044 |
| 933 | Ga0590077_001543 | 3300059426 | Bacteria | 5322 |
| 934 | Ga0501082_0010321 | 3300060353 | Bacteria | 8043 |
| 935 | Ga0501082_0211640 | 3300060353 | Bacteria | 1687 |
| 936 | Ga0530510_0001774 | 3300061734 | Bacteria | 14711 |
| 937 | Ga0530510_0173337 | 3300061734 | Bacteria | 1598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006846 | Ga0075430_100225283 | Ga0075430_1002252832 | 121 |
| 2 | 3300006844 | Ga0075428_101818621 | Ga0075428_1018186212 | 126 |
| 3 | 3300049579 | Ga0501043_0936479 | Ga0501043_0936479_27_410 | 127 |
| 4 | 3300006844 | Ga0075428_100192975 | Ga0075428_1001929752 | 128 |
| 5 | 3300006058 | Ga0075432_10088489 | Ga0075432_100884891 | 129 |
| 6 | 3300006846 | Ga0075430_100114945 | Ga0075430_1001149452 | 129 |
| 7 | 3300006852 | Ga0075433_10227894 | Ga0075433_102278942 | 129 |
| 8 | 3300006880 | Ga0075429_100044382 | Ga0075429_1000443826 | 129 |
| 9 | 3300009094 | Ga0111539_10001774 | Ga0111539_1000177429 | 129 |
| 10 | 3300009147 | Ga0114129_10074700 | Ga0114129_100747006 | 129 |
| 11 | 3300009147 | Ga0114129_11330908 | Ga0114129_113309082 | 129 |
| 12 | 3300027907 | Ga0207428_10000353 | Ga0207428_1000035325 | 129 |
| 13 | 3300041512 | Ga0451853_1692674 | Ga0451853_1692674_24_413 | 129 |
| 14 | 3300049521 | Ga0501298_154992 | Ga0501298_154992_153_542 | 129 |
| 15 | 3300049679 | Ga0501249_200628 | Ga0501249_200628_54_443 | 129 |
| 16 | 3300049769 | Ga0501272_020596 | Ga0501272_020596_265_654 | 129 |
| 17 | 3300050507 | nmdc:mga05p37_1167638_c1 | nmdc:mga05p37_1167638_c1_109_498 | 129 |
| 18 | 3300050507 | nmdc:mga05p37_155524_c1 | nmdc:mga05p37_155524_c1_2374_2763 | 129 |
| 19 | 3300050511 | nmdc:mga08y16_167360_c1 | nmdc:mga08y16_167360_c1_1360_1749 | 129 |
| 20 | 3300050515 | nmdc:mga0a205_161479_c1 | nmdc:mga0a205_161479_c1_1525_1914 | 129 |
| 21 | 3300049744 | Ga0501083_0641713 | Ga0501083_0641713_75_473 | 132 |
| 22 | 3300004801 | Ga0058860_11970884 | Ga0058860_119708841 | 136 |
| 23 | 3300005290 | Ga0065712_10088620 | Ga0065712_100886201 | 136 |
| 24 | 3300005338 | Ga0068868_101566876 | Ga0068868_1015668761 | 136 |
| 25 | 3300005457 | Ga0070662_100548831 | Ga0070662_1005488312 | 136 |
| 26 | 3300005546 | Ga0070696_100093556 | Ga0070696_1000935562 | 136 |
| 27 | 3300005618 | Ga0068864_100369486 | Ga0068864_1003694863 | 136 |
| 28 | 3300005840 | Ga0068870_10026411 | Ga0068870_100264112 | 136 |
| 29 | 3300005844 | Ga0068862_100698178 | Ga0068862_1006981782 | 136 |
| 30 | 3300006844 | Ga0075428_100884459 | Ga0075428_1008844592 | 136 |
| 31 | 3300006852 | Ga0075433_10014616 | Ga0075433_100146167 | 136 |
| 32 | 3300006871 | Ga0075434_100098176 | Ga0075434_1000981765 | 136 |
| 33 | 3300009094 | Ga0111539_10139223 | Ga0111539_101392232 | 136 |
| 34 | 3300009147 | Ga0114129_10109324 | Ga0114129_101093242 | 136 |
| 35 | 3300014745 | Ga0157377_10048960 | Ga0157377_100489603 | 136 |
| 36 | 3300025908 | Ga0207643_10076499 | Ga0207643_100764992 | 136 |
| 37 | 3300025960 | Ga0207651_10709019 | Ga0207651_107090191 | 136 |
| 38 | 3300026095 | Ga0207676_10306404 | Ga0207676_103064043 | 136 |
| 39 | 3300027907 | Ga0207428_10465962 | Ga0207428_104659622 | 136 |
| 40 | 3300049568 | Ga0501031_0284762 | Ga0501031_0284762_541_951 | 136 |
| 41 | 3300049572 | Ga0501036_0315208 | Ga0501036_0315208_360_770 | 136 |
| 42 | 3300049573 | Ga0501037_0599418 | Ga0501037_0599418_49_459 | 136 |
| 43 | 3300049575 | Ga0501039_0056186 | Ga0501039_0056186_1750_2160 | 136 |
| 44 | 3300049578 | Ga0501042_0003889 | Ga0501042_0003889_3233_3643 | 136 |
| 45 | 3300049582 | Ga0501048_0107006 | Ga0501048_0107006_977_1387 | 136 |
| 46 | 3300049585 | Ga0501069_0586049 | Ga0501069_0586049_182_592 | 136 |
| 47 | 3300049588 | Ga0501072_0352631 | Ga0501072_0352631_697_1107 | 136 |
| 48 | 3300049591 | Ga0501075_0156761 | Ga0501075_0156761_572_982 | 136 |
| 49 | 3300049592 | Ga0501076_0009175 | Ga0501076_0009175_1959_2369 | 136 |
| 50 | 3300049741 | Ga0501079_0034154 | Ga0501079_0034154_1366_1776 | 136 |
| 51 | 3300049743 | Ga0501081_0048284 | Ga0501081_0048284_638_1048 | 136 |
| 52 | 3300050508 | nmdc:mga09592_240558_c1 | nmdc:mga09592_240558_c1_727_1137 | 136 |
| 53 | 3300050511 | nmdc:mga08y16_168786_c1 | nmdc:mga08y16_168786_c1_1370_1780 | 136 |
| 54 | 3300050512 | nmdc:mga0n895_65768_c1 | nmdc:mga0n895_65768_c1_462_872 | 136 |
| 55 | 3300050515 | nmdc:mga0a205_68363_c1 | nmdc:mga0a205_68363_c1_2449_2859 | 136 |
| 56 | 3300054114 | Ga0501084_0465655 | Ga0501084_0465655_629_1039 | 136 |
| 57 | 3300060353 | Ga0501082_0211640 | Ga0501082_0211640_545_955 | 136 |
| 58 | 3300005335 | Ga0070666_10056738 | Ga0070666_100567384 | 137 |
| 59 | 3300005336 | Ga0070680_101041765 | Ga0070680_1010417652 | 137 |
| 60 | 3300005343 | Ga0070687_100136219 | Ga0070687_1001362192 | 137 |
| 61 | 3300005344 | Ga0070661_100230524 | Ga0070661_1002305241 | 137 |
| 62 | 3300005347 | Ga0070668_101342214 | Ga0070668_1013422141 | 137 |
| 63 | 3300005354 | Ga0070675_100005576 | Ga0070675_1000055766 | 137 |
| 64 | 3300005354 | Ga0070675_100571563 | Ga0070675_1005715632 | 137 |
| 65 | 3300005356 | Ga0070674_100677382 | Ga0070674_1006773822 | 137 |
| 66 | 3300005356 | Ga0070674_101023128 | Ga0070674_1010231281 | 137 |
| 67 | 3300005364 | Ga0070673_100011067 | Ga0070673_1000110677 | 137 |
| 68 | 3300005365 | Ga0070688_100164937 | Ga0070688_1001649373 | 137 |
| 69 | 3300005441 | Ga0070700_100303262 | Ga0070700_1003032622 | 137 |
| 70 | 3300005456 | Ga0070678_101572406 | Ga0070678_1015724062 | 137 |
| 71 | 3300005544 | Ga0070686_100164530 | Ga0070686_1001645302 | 137 |
| 72 | 3300005617 | Ga0068859_101290359 | Ga0068859_1012903592 | 137 |
| 73 | 3300005618 | Ga0068864_100499665 | Ga0068864_1004996652 | 137 |
| 74 | 3300005719 | Ga0068861_101108998 | Ga0068861_1011089982 | 137 |
| 75 | 3300005841 | Ga0068863_100948241 | Ga0068863_1009482412 | 137 |
| 76 | 3300005844 | Ga0068862_100345180 | Ga0068862_1003451802 | 137 |
| 77 | 3300006844 | Ga0075428_100181984 | Ga0075428_1001819842 | 137 |
| 78 | 3300006846 | Ga0075430_100005569 | Ga0075430_1000055692 | 137 |
| 79 | 3300006846 | Ga0075430_100164103 | Ga0075430_1001641032 | 137 |
| 80 | 3300006847 | Ga0075431_100455459 | Ga0075431_1004554591 | 137 |
| 81 | 3300006847 | Ga0075431_100809648 | Ga0075431_1008096482 | 137 |
| 82 | 3300006880 | Ga0075429_100038051 | Ga0075429_1000380514 | 137 |
| 83 | 3300006881 | Ga0068865_100978026 | Ga0068865_1009780262 | 137 |
| 84 | 3300006931 | Ga0097620_101290289 | Ga0097620_1012902891 | 137 |
| 85 | 3300009094 | Ga0111539_10000044 | Ga0111539_1000004475 | 137 |
| 86 | 3300009094 | Ga0111539_10010913 | Ga0111539_100109132 | 137 |
| 87 | 3300009094 | Ga0111539_10915013 | Ga0111539_109150131 | 137 |
| 88 | 3300009147 | Ga0114129_10008048 | Ga0114129_100080483 | 137 |
| 89 | 3300009147 | Ga0114129_11204322 | Ga0114129_112043222 | 137 |
| 90 | 3300013306 | Ga0163162_10912523 | Ga0163162_109125232 | 137 |
| 91 | 3300013308 | Ga0157375_10304445 | Ga0157375_103044454 | 137 |
| 92 | 3300014326 | Ga0157380_10204245 | Ga0157380_102042452 | 137 |
| 93 | 3300014745 | Ga0157377_10681957 | Ga0157377_106819572 | 137 |
| 94 | 3300017792 | Ga0163161_10553520 | Ga0163161_105535202 | 137 |
| 95 | 3300025903 | Ga0207680_10060337 | Ga0207680_100603372 | 137 |
| 96 | 3300025918 | Ga0207662_10028524 | Ga0207662_100285242 | 137 |
| 97 | 3300025920 | Ga0207649_10466101 | Ga0207649_104661011 | 137 |
| 98 | 3300025926 | Ga0207659_10032972 | Ga0207659_100329723 | 137 |
| 99 | 3300025926 | Ga0207659_10510909 | Ga0207659_105109092 | 137 |
| 100 | 3300025933 | Ga0207706_10336125 | Ga0207706_103361252 | 137 |
| 101 | 3300025938 | Ga0207704_11537265 | Ga0207704_115372652 | 137 |
| 102 | 3300025940 | Ga0207691_10365531 | Ga0207691_103655312 | 137 |
| 103 | 3300025960 | Ga0207651_10025082 | Ga0207651_100250823 | 137 |
| 104 | 3300025972 | Ga0207668_11030614 | Ga0207668_110306141 | 137 |
| 105 | 3300025986 | Ga0207658_10346730 | Ga0207658_103467301 | 137 |
| 106 | 3300026075 | Ga0207708_10159192 | Ga0207708_101591921 | 137 |
| 107 | 3300026088 | Ga0207641_10792093 | Ga0207641_107920932 | 137 |
| 108 | 3300026089 | Ga0207648_10410519 | Ga0207648_104105192 | 137 |
| 109 | 3300026116 | Ga0207674_10633889 | Ga0207674_106338892 | 137 |
| 110 | 3300026121 | Ga0207683_10670690 | Ga0207683_106706902 | 137 |
| 111 | 3300027907 | Ga0207428_10005989 | Ga0207428_1000598911 | 137 |
| 112 | 3300028380 | Ga0268265_10913339 | Ga0268265_109133392 | 137 |
| 113 | 3300028381 | Ga0268264_11413075 | Ga0268264_114130752 | 137 |
| 114 | 3300042011 | Ga0439454_116389 | Ga0439454_116389_35_448 | 137 |
| 115 | 3300042993 | Ga0439440_0104320 | Ga0439440_0104320_114_527 | 137 |
| 116 | 3300046615 | Ga0495656_0059120 | Ga0495656_0059120_65_478 | 137 |
| 117 | 3300046684 | Ga0495669_0462621 | Ga0495669_0462621_48_461 | 137 |
| 118 | 3300050507 | nmdc:mga05p37_503469_c1 | nmdc:mga05p37_503469_c1_369_782 | 137 |
| 119 | 3300050507 | nmdc:mga05p37_56561_c1 | nmdc:mga05p37_56561_c1_381_794 | 137 |
| 120 | 3300050508 | nmdc:mga09592_275748_c1 | nmdc:mga09592_275748_c1_184_597 | 137 |
| 121 | 3300050509 | nmdc:mga0qj67_280529_c1 | nmdc:mga0qj67_280529_c1_311_724 | 137 |
| 122 | 3300050509 | nmdc:mga0qj67_5293_c1 | nmdc:mga0qj67_5293_c1_7106_7519 | 137 |
| 123 | 3300050510 | nmdc:mga06r32_310457_c1 | nmdc:mga06r32_310457_c1_163_576 | 137 |
| 124 | 3300050510 | nmdc:mga06r32_610525_c1 | nmdc:mga06r32_610525_c1_104_517 | 137 |
| 125 | 3300050511 | nmdc:mga08y16_41616_c1 | nmdc:mga08y16_41616_c1_337_750 | 137 |
| 126 | 3300050511 | nmdc:mga08y16_945_c1 | nmdc:mga08y16_945_c1_23172_23585 | 137 |
| 127 | 3300005459 | Ga0068867_100580038 | Ga0068867_1005800382 | 138 |
| 128 | 3300006844 | Ga0075428_100169423 | Ga0075428_1001694235 | 138 |
| 129 | 3300006847 | Ga0075431_100117777 | Ga0075431_1001177772 | 138 |
| 130 | 3300006880 | Ga0075429_100380944 | Ga0075429_1003809442 | 138 |
| 131 | 3300009094 | Ga0111539_12329190 | Ga0111539_123291901 | 138 |
| 132 | 3300050508 | nmdc:mga09592_334982_c1 | nmdc:mga09592_334982_c1_198_614 | 138 |
| 133 | 3300050510 | nmdc:mga06r32_127805_c1 | nmdc:mga06r32_127805_c1_1577_1993 | 138 |
| 134 | 3300026116 | Ga0207674_11281744 | Ga0207674_112817441 | 140 |
| 135 | 3300004801 | Ga0058860_11692652 | Ga0058860_116926521 | 141 |
| 136 | 3300004801 | Ga0058860_12184011 | Ga0058860_121840111 | 141 |
| 137 | 3300005290 | Ga0065712_10012047 | Ga0065712_100120472 | 141 |
| 138 | 3300005290 | Ga0065712_10019331 | Ga0065712_100193312 | 141 |
| 139 | 3300005295 | Ga0065707_10275714 | Ga0065707_102757142 | 141 |
| 140 | 3300005328 | Ga0070676_10126212 | Ga0070676_101262123 | 141 |
| 141 | 3300005331 | Ga0070670_100387732 | Ga0070670_1003877323 | 141 |
| 142 | 3300005331 | Ga0070670_101273836 | Ga0070670_1012738361 | 141 |
| 143 | 3300005334 | Ga0068869_100173747 | Ga0068869_1001737472 | 141 |
| 144 | 3300005335 | Ga0070666_10019167 | Ga0070666_100191671 | 141 |
| 145 | 3300005336 | Ga0070680_100189453 | Ga0070680_1001894533 | 141 |
| 146 | 3300005340 | Ga0070689_100444795 | Ga0070689_1004447952 | 141 |
| 147 | 3300005347 | Ga0070668_100332063 | Ga0070668_1003320632 | 141 |
| 148 | 3300005353 | Ga0070669_100097839 | Ga0070669_1000978394 | 141 |
| 149 | 3300005353 | Ga0070669_100249264 | Ga0070669_1002492643 | 141 |
| 150 | 3300005354 | Ga0070675_100056448 | Ga0070675_1000564484 | 141 |
| 151 | 3300005356 | Ga0070674_100001500 | Ga0070674_1000015005 | 141 |
| 152 | 3300005364 | Ga0070673_100266332 | Ga0070673_1002663323 | 141 |
| 153 | 3300005365 | Ga0070688_100537017 | Ga0070688_1005370172 | 141 |
| 154 | 3300005367 | Ga0070667_101368857 | Ga0070667_1013688571 | 141 |
| 155 | 3300005456 | Ga0070678_100129534 | Ga0070678_1001295342 | 141 |
| 156 | 3300005456 | Ga0070678_100207670 | Ga0070678_1002076702 | 141 |
| 157 | 3300005456 | Ga0070678_100443188 | Ga0070678_1004431882 | 141 |
| 158 | 3300005457 | Ga0070662_100063348 | Ga0070662_1000633482 | 141 |
| 159 | 3300005459 | Ga0068867_100163313 | Ga0068867_1001633131 | 141 |
| 160 | 3300005564 | Ga0070664_102294566 | Ga0070664_1022945661 | 141 |
| 161 | 3300005615 | Ga0070702_100949974 | Ga0070702_1009499741 | 141 |
| 162 | 3300009176 | Ga0105242_10611704 | Ga0105242_106117042 | 141 |
| 163 | 3300009553 | Ga0105249_11948953 | Ga0105249_119489532 | 141 |
| 164 | 3300014325 | Ga0163163_10513067 | Ga0163163_105130672 | 141 |
| 165 | 3300014326 | Ga0157380_10700305 | Ga0157380_107003051 | 141 |
| 166 | 3300017792 | Ga0163161_10478577 | Ga0163161_104785771 | 141 |
| 167 | 3300025893 | Ga0207682_10010257 | Ga0207682_100102575 | 141 |
| 168 | 3300025899 | Ga0207642_10186498 | Ga0207642_101864982 | 141 |
| 169 | 3300025901 | Ga0207688_10059067 | Ga0207688_100590671 | 141 |
| 170 | 3300025903 | Ga0207680_10018186 | Ga0207680_100181864 | 141 |
| 171 | 3300025907 | Ga0207645_10245118 | Ga0207645_102451181 | 141 |
| 172 | 3300025907 | Ga0207645_10266359 | Ga0207645_102663592 | 141 |
| 173 | 3300025908 | Ga0207643_10053648 | Ga0207643_100536482 | 141 |
| 174 | 3300025917 | Ga0207660_10129706 | Ga0207660_101297063 | 141 |
| 175 | 3300025923 | Ga0207681_10542263 | Ga0207681_105422631 | 141 |
| 176 | 3300025925 | Ga0207650_10182355 | Ga0207650_101823552 | 141 |
| 177 | 3300025925 | Ga0207650_11065203 | Ga0207650_110652031 | 141 |
| 178 | 3300025926 | Ga0207659_10048877 | Ga0207659_100488771 | 141 |
| 179 | 3300025932 | Ga0207690_10250642 | Ga0207690_102506422 | 141 |
| 180 | 3300025933 | Ga0207706_10057657 | Ga0207706_100576572 | 141 |
| 181 | 3300025934 | Ga0207686_10552084 | Ga0207686_105520842 | 141 |
| 182 | 3300025937 | Ga0207669_10001529 | Ga0207669_100015299 | 141 |
| 183 | 3300025937 | Ga0207669_10833780 | Ga0207669_108337802 | 141 |
| 184 | 3300025938 | Ga0207704_10053194 | Ga0207704_100531944 | 141 |
| 185 | 3300025940 | Ga0207691_10180664 | Ga0207691_101806642 | 141 |
| 186 | 3300025942 | Ga0207689_10048175 | Ga0207689_100481752 | 141 |
| 187 | 3300025945 | Ga0207679_10586087 | Ga0207679_105860871 | 141 |
| 188 | 3300025972 | Ga0207668_10118148 | Ga0207668_101181483 | 141 |
| 189 | 3300025981 | Ga0207640_11766552 | Ga0207640_117665521 | 141 |
| 190 | 3300026075 | Ga0207708_11023236 | Ga0207708_110232361 | 141 |
| 191 | 3300026089 | Ga0207648_10046637 | Ga0207648_100466372 | 141 |
| 192 | 3300026089 | Ga0207648_10708929 | Ga0207648_107089292 | 141 |
| 193 | 3300026095 | Ga0207676_11105762 | Ga0207676_111057622 | 141 |
| 194 | 3300026118 | Ga0207675_100094653 | Ga0207675_1000946532 | 141 |
| 195 | 3300026118 | Ga0207675_101820305 | Ga0207675_1018203051 | 141 |
| 196 | 3300026121 | Ga0207683_10135522 | Ga0207683_101355222 | 141 |
| 197 | 3300026121 | Ga0207683_10451795 | Ga0207683_104517952 | 141 |
| 198 | 3300026121 | Ga0207683_10814772 | Ga0207683_108147721 | 141 |
| 199 | 3300028380 | Ga0268265_11372760 | Ga0268265_113727601 | 141 |
| 200 | 3300046537 | Ga0495598_0240921 | Ga0495598_0240921_36_461 | 141 |
| 201 | 3300050511 | nmdc:mga08y16_979410_c1 | nmdc:mga08y16_979410_c1_372_797 | 141 |
| 202 | 3300049743 | Ga0501081_0384370 | Ga0501081_0384370_38_481 | 142 |
| 203 | 3300049592 | Ga0501076_0311423 | Ga0501076_0311423_363_839 | 144 |
| 204 | 3300050514 | nmdc:mga08x19_2_c1 | nmdc:mga08x19_2_c1_322739_323383 | 144 |
| 205 | 3300005718 | Ga0068866_11108478 | Ga0068866_111084782 | 145 |
| 206 | 3300006846 | Ga0075430_100569743 | Ga0075430_1005697432 | 145 |
| 207 | 3300049574 | Ga0501038_0856032 | Ga0501038_0856032_189_629 | 145 |
| 208 | 3300049575 | Ga0501039_0299496 | Ga0501039_0299496_681_1121 | 145 |
| 209 | 3300049577 | Ga0501041_0135843 | Ga0501041_0135843_869_1309 | 145 |
| 210 | 3300049578 | Ga0501042_0286231 | Ga0501042_0286231_303_743 | 145 |
| 211 | 3300049582 | Ga0501048_0035520 | Ga0501048_0035520_2257_2697 | 145 |
| 212 | 3300049588 | Ga0501072_0027578 | Ga0501072_0027578_2534_2974 | 145 |
| 213 | 3300049591 | Ga0501075_0293114 | Ga0501075_0293114_564_1004 | 145 |
| 214 | 3300049592 | Ga0501076_1659100 | Ga0501076_1659100_55_495 | 145 |
| 215 | 3300049741 | Ga0501079_0133364 | Ga0501079_0133364_102_542 | 145 |
| 216 | 3300049743 | Ga0501081_0224269 | Ga0501081_0224269_155_595 | 145 |
| 217 | 3300049743 | Ga0501081_0869432 | Ga0501081_0869432_42_482 | 145 |
| 218 | 3300049824 | Ga0501045_0024405 | Ga0501045_0024405_2593_3033 | 145 |
| 219 | 3300050509 | nmdc:mga0qj67_541447_c1 | nmdc:mga0qj67_541447_c1_37_477 | 145 |
| 220 | 3300054114 | Ga0501084_0148547 | Ga0501084_0148547_703_1143 | 145 |
| 221 | 3300061734 | Ga0530510_0173337 | Ga0530510_0173337_1103_1543 | 145 |
| 222 | 3300005328 | Ga0070676_10959672 | Ga0070676_109596721 | 146 |
| 223 | 3300005331 | Ga0070670_101120704 | Ga0070670_1011207041 | 146 |
| 224 | 3300005338 | Ga0068868_100132565 | Ga0068868_1001325653 | 146 |
| 225 | 3300005353 | Ga0070669_100431899 | Ga0070669_1004318992 | 146 |
| 226 | 3300005354 | Ga0070675_101343057 | Ga0070675_1013430571 | 146 |
| 227 | 3300005618 | Ga0068864_100586708 | Ga0068864_1005867081 | 146 |
| 228 | 3300005841 | Ga0068863_100186579 | Ga0068863_1001865792 | 146 |
| 229 | 3300005842 | Ga0068858_100585933 | Ga0068858_1005859332 | 146 |
| 230 | 3300005844 | Ga0068862_100580042 | Ga0068862_1005800421 | 146 |
| 231 | 3300006237 | Ga0097621_100092943 | Ga0097621_1000929434 | 146 |
| 232 | 3300006358 | Ga0068871_100218569 | Ga0068871_1002185691 | 146 |
| 233 | 3300009094 | Ga0111539_10926144 | Ga0111539_109261442 | 146 |
| 234 | 3300009177 | Ga0105248_10089923 | Ga0105248_100899234 | 146 |
| 235 | 3300013296 | Ga0157374_10321343 | Ga0157374_103213432 | 146 |
| 236 | 3300013297 | Ga0157378_10372797 | Ga0157378_103727972 | 146 |
| 237 | 3300025907 | Ga0207645_10217224 | Ga0207645_102172242 | 146 |
| 238 | 3300025926 | Ga0207659_10402165 | Ga0207659_104021652 | 146 |
| 239 | 3300025941 | Ga0207711_10169955 | Ga0207711_101699553 | 146 |
| 240 | 3300026023 | Ga0207677_10145249 | Ga0207677_101452493 | 146 |
| 241 | 3300026035 | Ga0207703_10472240 | Ga0207703_104722402 | 146 |
| 242 | 3300026089 | Ga0207648_10474768 | Ga0207648_104747682 | 146 |
| 243 | 3300026095 | Ga0207676_11021163 | Ga0207676_110211631 | 146 |
| 244 | 3300028380 | Ga0268265_10622631 | Ga0268265_106226311 | 146 |
| 245 | 3300049570 | Ga0501033_0768025 | Ga0501033_0768025_24_467 | 146 |
| 246 | 3300049574 | Ga0501038_1061858 | Ga0501038_1061858_101_544 | 146 |
| 247 | 3300049587 | Ga0501071_0821372 | Ga0501071_0821372_187_630 | 146 |
| 248 | 3300049592 | Ga0501076_0156572 | Ga0501076_0156572_63_506 | 146 |
| 249 | 3300049741 | Ga0501079_0480084 | Ga0501079_0480084_13_456 | 146 |
| 250 | 3300049824 | Ga0501045_0157688 | Ga0501045_0157688_272_715 | 146 |
| 251 | 3300002459 | JGI24751J29686_10093352 | JGI24751J29686_100933521 | 147 |
| 252 | 3300005290 | Ga0065712_10223940 | Ga0065712_102239402 | 147 |
| 253 | 3300005290 | Ga0065712_10375391 | Ga0065712_103753912 | 147 |
| 254 | 3300005293 | Ga0065715_10624584 | Ga0065715_106245841 | 147 |
| 255 | 3300005327 | Ga0070658_11265126 | Ga0070658_112651262 | 147 |
| 256 | 3300005327 | Ga0070658_11305960 | Ga0070658_113059601 | 147 |
| 257 | 3300005328 | Ga0070676_10333427 | Ga0070676_103334272 | 147 |
| 258 | 3300005330 | Ga0070690_100013733 | Ga0070690_1000137336 | 147 |
| 259 | 3300005331 | Ga0070670_100062034 | Ga0070670_1000620343 | 147 |
| 260 | 3300005331 | Ga0070670_100268336 | Ga0070670_1002683361 | 147 |
| 261 | 3300005337 | Ga0070682_102066207 | Ga0070682_1020662071 | 147 |
| 262 | 3300005338 | Ga0068868_100300595 | Ga0068868_1003005951 | 147 |
| 263 | 3300005340 | Ga0070689_100062418 | Ga0070689_1000624182 | 147 |
| 264 | 3300005341 | Ga0070691_10169574 | Ga0070691_101695742 | 147 |
| 265 | 3300005343 | Ga0070687_100643985 | Ga0070687_1006439851 | 147 |
| 266 | 3300005344 | Ga0070661_100044414 | Ga0070661_1000444142 | 147 |
| 267 | 3300005353 | Ga0070669_100016438 | Ga0070669_1000164383 | 147 |
| 268 | 3300005354 | Ga0070675_100003145 | Ga0070675_1000031456 | 147 |
| 269 | 3300005354 | Ga0070675_100348068 | Ga0070675_1003480681 | 147 |
| 270 | 3300005354 | Ga0070675_100358438 | Ga0070675_1003584381 | 147 |
| 271 | 3300005355 | Ga0070671_100154900 | Ga0070671_1001549002 | 147 |
| 272 | 3300005356 | Ga0070674_100126837 | Ga0070674_1001268371 | 147 |
| 273 | 3300005364 | Ga0070673_100203331 | Ga0070673_1002033312 | 147 |
| 274 | 3300005440 | Ga0070705_100001006 | Ga0070705_1000010065 | 147 |
| 275 | 3300005441 | Ga0070700_100296060 | Ga0070700_1002960601 | 147 |
| 276 | 3300005444 | Ga0070694_100001224 | Ga0070694_10000122414 | 147 |
| 277 | 3300005456 | Ga0070678_100602360 | Ga0070678_1006023602 | 147 |
| 278 | 3300005459 | Ga0068867_100512027 | Ga0068867_1005120271 | 147 |
| 279 | 3300005459 | Ga0068867_101459412 | Ga0068867_1014594121 | 147 |
| 280 | 3300005466 | Ga0070685_11257714 | Ga0070685_112577141 | 147 |
| 281 | 3300005471 | Ga0070698_100458203 | Ga0070698_1004582032 | 147 |
| 282 | 3300005535 | Ga0070684_101438109 | Ga0070684_1014381091 | 147 |
| 283 | 3300005536 | Ga0070697_101035731 | Ga0070697_1010357311 | 147 |
| 284 | 3300005543 | Ga0070672_100014870 | Ga0070672_1000148702 | 147 |
| 285 | 3300005543 | Ga0070672_100066226 | Ga0070672_1000662262 | 147 |
| 286 | 3300005543 | Ga0070672_100902142 | Ga0070672_1009021421 | 147 |
| 287 | 3300005544 | Ga0070686_100126426 | Ga0070686_1001264262 | 147 |
| 288 | 3300005545 | Ga0070695_100000425 | Ga0070695_10000042522 | 147 |
| 289 | 3300005546 | Ga0070696_100008088 | Ga0070696_1000080883 | 147 |
| 290 | 3300005564 | Ga0070664_100410841 | Ga0070664_1004108412 | 147 |
| 291 | 3300005615 | Ga0070702_100054578 | Ga0070702_1000545782 | 147 |
| 292 | 3300005616 | Ga0068852_100955304 | Ga0068852_1009553041 | 147 |
| 293 | 3300005617 | Ga0068859_100185587 | Ga0068859_1001855872 | 147 |
| 294 | 3300005618 | Ga0068864_100043267 | Ga0068864_1000432674 | 147 |
| 295 | 3300005718 | Ga0068866_10447546 | Ga0068866_104475462 | 147 |
| 296 | 3300005840 | Ga0068870_10314003 | Ga0068870_103140031 | 147 |
| 297 | 3300005841 | Ga0068863_100751413 | Ga0068863_1007514132 | 147 |
| 298 | 3300005842 | Ga0068858_100094724 | Ga0068858_1000947244 | 147 |
| 299 | 3300005844 | Ga0068862_101781073 | Ga0068862_1017810732 | 147 |
| 300 | 3300006358 | Ga0068871_101280608 | Ga0068871_1012806081 | 147 |
| 301 | 3300006881 | Ga0068865_100297666 | Ga0068865_1002976662 | 147 |
| 302 | 3300006881 | Ga0068865_101042451 | Ga0068865_1010424511 | 147 |
| 303 | 3300006931 | Ga0097620_100185599 | Ga0097620_1001855992 | 147 |
| 304 | 3300009094 | Ga0111539_10026374 | Ga0111539_100263745 | 147 |
| 305 | 3300009094 | Ga0111539_10419078 | Ga0111539_104190782 | 147 |
| 306 | 3300009094 | Ga0111539_10516430 | Ga0111539_105164302 | 147 |
| 307 | 3300009147 | Ga0114129_11365552 | Ga0114129_113655522 | 147 |
| 308 | 3300009148 | Ga0105243_10281598 | Ga0105243_102815982 | 147 |
| 309 | 3300009176 | Ga0105242_10246359 | Ga0105242_102463593 | 147 |
| 310 | 3300009553 | Ga0105249_10133236 | Ga0105249_101332362 | 147 |
| 311 | 3300013296 | Ga0157374_10037760 | Ga0157374_100377604 | 147 |
| 312 | 3300014325 | Ga0163163_10017755 | Ga0163163_100177558 | 147 |
| 313 | 3300014326 | Ga0157380_10021207 | Ga0157380_100212075 | 147 |
| 314 | 3300014326 | Ga0157380_11914128 | Ga0157380_119141281 | 147 |
| 315 | 3300014745 | Ga0157377_10140301 | Ga0157377_101403011 | 147 |
| 316 | 3300014745 | Ga0157377_11044006 | Ga0157377_110440061 | 147 |
| 317 | 3300014745 | Ga0157377_11316128 | Ga0157377_113161281 | 147 |
| 318 | 3300014969 | Ga0157376_10927609 | Ga0157376_109276091 | 147 |
| 319 | 3300014969 | Ga0157376_11523918 | Ga0157376_115239181 | 147 |
| 320 | 3300017792 | Ga0163161_10552852 | Ga0163161_105528522 | 147 |
| 321 | 3300017792 | Ga0163161_10583739 | Ga0163161_105837392 | 147 |
| 322 | 3300017792 | Ga0163161_11582325 | Ga0163161_115823251 | 147 |
| 323 | 3300025893 | Ga0207682_10052606 | Ga0207682_100526062 | 147 |
| 324 | 3300025917 | Ga0207660_10725343 | Ga0207660_107253432 | 147 |
| 325 | 3300025918 | Ga0207662_10004271 | Ga0207662_100042712 | 147 |
| 326 | 3300025925 | Ga0207650_10148492 | Ga0207650_101484923 | 147 |
| 327 | 3300025925 | Ga0207650_11118654 | Ga0207650_111186541 | 147 |
| 328 | 3300025926 | Ga0207659_10007569 | Ga0207659_100075697 | 147 |
| 329 | 3300025931 | Ga0207644_10154004 | Ga0207644_101540042 | 147 |
| 330 | 3300025931 | Ga0207644_10882921 | Ga0207644_108829211 | 147 |
| 331 | 3300025932 | Ga0207690_10184925 | Ga0207690_101849252 | 147 |
| 332 | 3300025933 | Ga0207706_10766219 | Ga0207706_107662191 | 147 |
| 333 | 3300025934 | Ga0207686_10113634 | Ga0207686_101136342 | 147 |
| 334 | 3300025935 | Ga0207709_10161212 | Ga0207709_101612123 | 147 |
| 335 | 3300025936 | Ga0207670_10362549 | Ga0207670_103625491 | 147 |
| 336 | 3300025937 | Ga0207669_11139124 | Ga0207669_111391241 | 147 |
| 337 | 3300025940 | Ga0207691_10055581 | Ga0207691_100555815 | 147 |
| 338 | 3300025940 | Ga0207691_10085089 | Ga0207691_100850894 | 147 |
| 339 | 3300025940 | Ga0207691_10817532 | Ga0207691_108175322 | 147 |
| 340 | 3300025945 | Ga0207679_10294889 | Ga0207679_102948892 | 147 |
| 341 | 3300025960 | Ga0207651_10244533 | Ga0207651_102445332 | 147 |
| 342 | 3300025960 | Ga0207651_10622228 | Ga0207651_106222282 | 147 |
| 343 | 3300025972 | Ga0207668_10159885 | Ga0207668_101598852 | 147 |
| 344 | 3300025981 | Ga0207640_12203733 | Ga0207640_122037331 | 147 |
| 345 | 3300025986 | Ga0207658_11145954 | Ga0207658_111459541 | 147 |
| 346 | 3300026035 | Ga0207703_10289415 | Ga0207703_102894154 | 147 |
| 347 | 3300026075 | Ga0207708_10269838 | Ga0207708_102698382 | 147 |
| 348 | 3300026088 | Ga0207641_11460006 | Ga0207641_114600061 | 147 |
| 349 | 3300026116 | Ga0207674_11192251 | Ga0207674_111922511 | 147 |
| 350 | 3300026118 | Ga0207675_100770580 | Ga0207675_1007705801 | 147 |
| 351 | 3300026121 | Ga0207683_10624160 | Ga0207683_106241602 | 147 |
| 352 | 3300027526 | Ga0209968_1053945 | Ga0209968_10539451 | 147 |
| 353 | 3300027907 | Ga0207428_10004706 | Ga0207428_100047065 | 147 |
| 354 | 3300028380 | Ga0268265_12172198 | Ga0268265_121721981 | 147 |
| 355 | 3300031548 | Ga0307408_100364100 | Ga0307408_1003641002 | 147 |
| 356 | 3300031731 | Ga0307405_10003692 | Ga0307405_100036925 | 147 |
| 357 | 3300031824 | Ga0307413_11805844 | Ga0307413_118058441 | 147 |
| 358 | 3300031852 | Ga0307410_11728725 | Ga0307410_117287251 | 147 |
| 359 | 3300031903 | Ga0307407_10004637 | Ga0307407_100046371 | 147 |
| 360 | 3300031911 | Ga0307412_10009853 | Ga0307412_100098536 | 147 |
| 361 | 3300031995 | Ga0307409_100004850 | Ga0307409_1000048505 | 147 |
| 362 | 3300031995 | Ga0307409_100334185 | Ga0307409_1003341851 | 147 |
| 363 | 3300032002 | Ga0307416_100004482 | Ga0307416_1000044827 | 147 |
| 364 | 3300032002 | Ga0307416_100290128 | Ga0307416_1002901282 | 147 |
| 365 | 3300032002 | Ga0307416_102784627 | Ga0307416_1027846271 | 147 |
| 366 | 3300032005 | Ga0307411_12312917 | Ga0307411_123129171 | 147 |
| 367 | 3300032126 | Ga0307415_100068095 | Ga0307415_1000680955 | 147 |
| 368 | 3300041512 | Ga0451853_3527350 | Ga0451853_3527350_333_776 | 147 |
| 369 | 3300042435 | Ga0439434_0071318 | Ga0439434_0071318_350_793 | 147 |
| 370 | 3300046472 | Ga0495580_0339705 | Ga0495580_0339705_557_1000 | 147 |
| 371 | 3300046537 | Ga0495598_0383849 | Ga0495598_0383849_15_458 | 147 |
| 372 | 3300046539 | Ga0495621_0177265 | Ga0495621_0177265_202_645 | 147 |
| 373 | 3300046683 | Ga0495658_0097707 | Ga0495658_0097707_429_872 | 147 |
| 374 | 3300046691 | Ga0495670_0118046 | Ga0495670_0118046_180_623 | 147 |
| 375 | 3300046794 | Ga0495589_0492716 | Ga0495589_0492716_61_504 | 147 |
| 376 | 3300049592 | Ga0501076_0214437 | Ga0501076_0214437_441_887 | 147 |
| 377 | 3300050508 | nmdc:mga09592_504093_c1 | nmdc:mga09592_504093_c1_481_924 | 147 |
| 378 | 3300050511 | nmdc:mga08y16_5828_c1 | nmdc:mga08y16_5828_c1_2473_2916 | 147 |
| 379 | 3300050511 | nmdc:mga08y16_958632_c1 | nmdc:mga08y16_958632_c1_381_824 | 147 |
| 380 | 3300053104 | Ga0500556_0007638 | Ga0500556_0007638_1292_1744 | 147 |
| 381 | 3300001977 | JGI24746J21847_1000909 | JGI24746J21847_10009091 | 148 |
| 382 | 3300002070 | JGI24750J21931_1027064 | JGI24750J21931_10270642 | 148 |
| 383 | 3300002076 | JGI24749J21850_1010328 | JGI24749J21850_10103281 | 148 |
| 384 | 3300002126 | JGI24035J26624_1029462 | JGI24035J26624_10294621 | 148 |
| 385 | 3300003203 | JGI25406J46586_10012672 | JGI25406J46586_100126726 | 148 |
| 386 | 3300005288 | Ga0065714_10342292 | Ga0065714_103422921 | 148 |
| 387 | 3300005289 | Ga0065704_10077157 | Ga0065704_100771572 | 148 |
| 388 | 3300005289 | Ga0065704_10246247 | Ga0065704_102462471 | 148 |
| 389 | 3300005289 | Ga0065704_10347472 | Ga0065704_103474722 | 148 |
| 390 | 3300005289 | Ga0065704_10483285 | Ga0065704_104832851 | 148 |
| 391 | 3300005290 | Ga0065712_10085635 | Ga0065712_100856352 | 148 |
| 392 | 3300005290 | Ga0065712_10086488 | Ga0065712_100864882 | 148 |
| 393 | 3300005290 | Ga0065712_10534061 | Ga0065712_105340611 | 148 |
| 394 | 3300005293 | Ga0065715_10000879 | Ga0065715_100008794 | 148 |
| 395 | 3300005293 | Ga0065715_10096891 | Ga0065715_100968913 | 148 |
| 396 | 3300005293 | Ga0065715_10100717 | Ga0065715_101007171 | 148 |
| 397 | 3300005293 | Ga0065715_10701154 | Ga0065715_107011541 | 148 |
| 398 | 3300005293 | Ga0065715_11083627 | Ga0065715_110836271 | 148 |
| 399 | 3300005295 | Ga0065707_10006295 | Ga0065707_100062951 | 148 |
| 400 | 3300005295 | Ga0065707_10023887 | Ga0065707_100238872 | 148 |
| 401 | 3300005295 | Ga0065707_10628294 | Ga0065707_106282941 | 148 |
| 402 | 3300005295 | Ga0065707_10805685 | Ga0065707_108056851 | 148 |
| 403 | 3300005327 | Ga0070658_10477958 | Ga0070658_104779581 | 148 |
| 404 | 3300005328 | Ga0070676_10004240 | Ga0070676_100042402 | 148 |
| 405 | 3300005328 | Ga0070676_10402252 | Ga0070676_104022521 | 148 |
| 406 | 3300005329 | Ga0070683_100065328 | Ga0070683_1000653282 | 148 |
| 407 | 3300005329 | Ga0070683_100734194 | Ga0070683_1007341942 | 148 |
| 408 | 3300005329 | Ga0070683_101725729 | Ga0070683_1017257291 | 148 |
| 409 | 3300005330 | Ga0070690_100016453 | Ga0070690_1000164535 | 148 |
| 410 | 3300005330 | Ga0070690_100041224 | Ga0070690_1000412242 | 148 |
| 411 | 3300005330 | Ga0070690_101516938 | Ga0070690_1015169381 | 148 |
| 412 | 3300005331 | Ga0070670_100021219 | Ga0070670_1000212192 | 148 |
| 413 | 3300005331 | Ga0070670_100069094 | Ga0070670_1000690944 | 148 |
| 414 | 3300005331 | Ga0070670_100183131 | Ga0070670_1001831313 | 148 |
| 415 | 3300005331 | Ga0070670_101218015 | Ga0070670_1012180151 | 148 |
| 416 | 3300005333 | Ga0070677_10010650 | Ga0070677_100106505 | 148 |
| 417 | 3300005333 | Ga0070677_10321537 | Ga0070677_103215372 | 148 |
| 418 | 3300005334 | Ga0068869_100003236 | Ga0068869_1000032365 | 148 |
| 419 | 3300005334 | Ga0068869_100309489 | Ga0068869_1003094892 | 148 |
| 420 | 3300005334 | Ga0068869_100520169 | Ga0068869_1005201692 | 148 |
| 421 | 3300005334 | Ga0068869_100688548 | Ga0068869_1006885482 | 148 |
| 422 | 3300005334 | Ga0068869_100955344 | Ga0068869_1009553441 | 148 |
| 423 | 3300005335 | Ga0070666_10025313 | Ga0070666_100253132 | 148 |
| 424 | 3300005335 | Ga0070666_10750475 | Ga0070666_107504751 | 148 |
| 425 | 3300005336 | Ga0070680_100290096 | Ga0070680_1002900962 | 148 |
| 426 | 3300005337 | Ga0070682_100593957 | Ga0070682_1005939571 | 148 |
| 427 | 3300005338 | Ga0068868_100007147 | Ga0068868_1000071478 | 148 |
| 428 | 3300005339 | Ga0070660_101288933 | Ga0070660_1012889331 | 148 |
| 429 | 3300005340 | Ga0070689_100006102 | Ga0070689_10000610211 | 148 |
| 430 | 3300005340 | Ga0070689_100008169 | Ga0070689_10000816910 | 148 |
| 431 | 3300005343 | Ga0070687_100584483 | Ga0070687_1005844832 | 148 |
| 432 | 3300005344 | Ga0070661_100033797 | Ga0070661_1000337975 | 148 |
| 433 | 3300005344 | Ga0070661_100425074 | Ga0070661_1004250742 | 148 |
| 434 | 3300005345 | Ga0070692_10086280 | Ga0070692_100862802 | 148 |
| 435 | 3300005345 | Ga0070692_10477954 | Ga0070692_104779542 | 148 |
| 436 | 3300005347 | Ga0070668_100107964 | Ga0070668_1001079644 | 148 |
| 437 | 3300005347 | Ga0070668_100125945 | Ga0070668_1001259453 | 148 |
| 438 | 3300005353 | Ga0070669_100004669 | Ga0070669_1000046692 | 148 |
| 439 | 3300005353 | Ga0070669_100007056 | Ga0070669_1000070566 | 148 |
| 440 | 3300005353 | Ga0070669_100156477 | Ga0070669_1001564773 | 148 |
| 441 | 3300005353 | Ga0070669_100193327 | Ga0070669_1001933272 | 148 |
| 442 | 3300005354 | Ga0070675_100000998 | Ga0070675_10000099819 | 148 |
| 443 | 3300005354 | Ga0070675_100017262 | Ga0070675_1000172625 | 148 |
| 444 | 3300005354 | Ga0070675_100068099 | Ga0070675_1000680993 | 148 |
| 445 | 3300005354 | Ga0070675_100103317 | Ga0070675_1001033172 | 148 |
| 446 | 3300005354 | Ga0070675_100176359 | Ga0070675_1001763593 | 148 |
| 447 | 3300005354 | Ga0070675_100418093 | Ga0070675_1004180931 | 148 |
| 448 | 3300005354 | Ga0070675_100914156 | Ga0070675_1009141561 | 148 |
| 449 | 3300005354 | Ga0070675_101746188 | Ga0070675_1017461881 | 148 |
| 450 | 3300005355 | Ga0070671_100338502 | Ga0070671_1003385021 | 148 |
| 451 | 3300005356 | Ga0070674_101318208 | Ga0070674_1013182081 | 148 |
| 452 | 3300005364 | Ga0070673_100024542 | Ga0070673_1000245422 | 148 |
| 453 | 3300005364 | Ga0070673_100094764 | Ga0070673_1000947644 | 148 |
| 454 | 3300005364 | Ga0070673_100142705 | Ga0070673_1001427054 | 148 |
| 455 | 3300005364 | Ga0070673_100409621 | Ga0070673_1004096212 | 148 |
| 456 | 3300005365 | Ga0070688_100020189 | Ga0070688_1000201895 | 148 |
| 457 | 3300005365 | Ga0070688_100092983 | Ga0070688_1000929832 | 148 |
| 458 | 3300005365 | Ga0070688_100188539 | Ga0070688_1001885393 | 148 |
| 459 | 3300005365 | Ga0070688_100393658 | Ga0070688_1003936581 | 148 |
| 460 | 3300005365 | Ga0070688_101304894 | Ga0070688_1013048941 | 148 |
| 461 | 3300005366 | Ga0070659_100016032 | Ga0070659_1000160323 | 148 |
| 462 | 3300005366 | Ga0070659_100821816 | Ga0070659_1008218161 | 148 |
| 463 | 3300005367 | Ga0070667_100025321 | Ga0070667_1000253212 | 148 |
| 464 | 3300005367 | Ga0070667_100169857 | Ga0070667_1001698572 | 148 |
| 465 | 3300005367 | Ga0070667_101069016 | Ga0070667_1010690161 | 148 |
| 466 | 3300005438 | Ga0070701_10079984 | Ga0070701_100799841 | 148 |
| 467 | 3300005438 | Ga0070701_10116834 | Ga0070701_101168341 | 148 |
| 468 | 3300005438 | Ga0070701_10276904 | Ga0070701_102769041 | 148 |
| 469 | 3300005438 | Ga0070701_10455345 | Ga0070701_104553451 | 148 |
| 470 | 3300005440 | Ga0070705_100065913 | Ga0070705_1000659133 | 148 |
| 471 | 3300005440 | Ga0070705_100169270 | Ga0070705_1001692701 | 148 |
| 472 | 3300005440 | Ga0070705_100615398 | Ga0070705_1006153982 | 148 |
| 473 | 3300005440 | Ga0070705_100767487 | Ga0070705_1007674871 | 148 |
| 474 | 3300005441 | Ga0070700_100089978 | Ga0070700_1000899783 | 148 |
| 475 | 3300005441 | Ga0070700_100152172 | Ga0070700_1001521722 | 148 |
| 476 | 3300005444 | Ga0070694_100002510 | Ga0070694_1000025104 | 148 |
| 477 | 3300005444 | Ga0070694_100886870 | Ga0070694_1008868701 | 148 |
| 478 | 3300005456 | Ga0070678_100019465 | Ga0070678_1000194654 | 148 |
| 479 | 3300005456 | Ga0070678_100120646 | Ga0070678_1001206462 | 148 |
| 480 | 3300005457 | Ga0070662_100054409 | Ga0070662_1000544092 | 148 |
| 481 | 3300005457 | Ga0070662_100302125 | Ga0070662_1003021252 | 148 |
| 482 | 3300005458 | Ga0070681_10018905 | Ga0070681_100189057 | 148 |
| 483 | 3300005459 | Ga0068867_100000147 | Ga0068867_10000014730 | 148 |
| 484 | 3300005459 | Ga0068867_101319548 | Ga0068867_1013195481 | 148 |
| 485 | 3300005466 | Ga0070685_10523763 | Ga0070685_105237632 | 148 |
| 486 | 3300005466 | Ga0070685_11294069 | Ga0070685_112940691 | 148 |
| 487 | 3300005468 | Ga0070707_100177536 | Ga0070707_1001775364 | 148 |
| 488 | 3300005468 | Ga0070707_100182523 | Ga0070707_1001825232 | 148 |
| 489 | 3300005471 | Ga0070698_100047613 | Ga0070698_1000476136 | 148 |
| 490 | 3300005471 | Ga0070698_100329574 | Ga0070698_1003295742 | 148 |
| 491 | 3300005518 | Ga0070699_100002298 | Ga0070699_1000022987 | 148 |
| 492 | 3300005518 | Ga0070699_100181189 | Ga0070699_1001811892 | 148 |
| 493 | 3300005518 | Ga0070699_100220060 | Ga0070699_1002200603 | 148 |
| 494 | 3300005518 | Ga0070699_100463047 | Ga0070699_1004630471 | 148 |
| 495 | 3300005518 | Ga0070699_100521705 | Ga0070699_1005217052 | 148 |
| 496 | 3300005530 | Ga0070679_100795251 | Ga0070679_1007952511 | 148 |
| 497 | 3300005530 | Ga0070679_101079940 | Ga0070679_1010799401 | 148 |
| 498 | 3300005535 | Ga0070684_100205443 | Ga0070684_1002054432 | 148 |
| 499 | 3300005535 | Ga0070684_101315427 | Ga0070684_1013154271 | 148 |
| 500 | 3300005536 | Ga0070697_100152879 | Ga0070697_1001528792 | 148 |
| 501 | 3300005536 | Ga0070697_100552502 | Ga0070697_1005525021 | 148 |
| 502 | 3300005536 | Ga0070697_100590928 | Ga0070697_1005909282 | 148 |
| 503 | 3300005539 | Ga0068853_101545535 | Ga0068853_1015455351 | 148 |
| 504 | 3300005543 | Ga0070672_100078828 | Ga0070672_1000788284 | 148 |
| 505 | 3300005543 | Ga0070672_100134439 | Ga0070672_1001344393 | 148 |
| 506 | 3300005543 | Ga0070672_100258503 | Ga0070672_1002585033 | 148 |
| 507 | 3300005544 | Ga0070686_100005406 | Ga0070686_1000054067 | 148 |
| 508 | 3300005545 | Ga0070695_100549752 | Ga0070695_1005497522 | 148 |
| 509 | 3300005545 | Ga0070695_100744111 | Ga0070695_1007441111 | 148 |
| 510 | 3300005546 | Ga0070696_100093207 | Ga0070696_1000932072 | 148 |
| 511 | 3300005548 | Ga0070665_100063029 | Ga0070665_1000630295 | 148 |
| 512 | 3300005549 | Ga0070704_100002260 | Ga0070704_1000022602 | 148 |
| 513 | 3300005549 | Ga0070704_100002570 | Ga0070704_1000025707 | 148 |
| 514 | 3300005549 | Ga0070704_100128184 | Ga0070704_1001281843 | 148 |
| 515 | 3300005549 | Ga0070704_100184255 | Ga0070704_1001842552 | 148 |
| 516 | 3300005549 | Ga0070704_100855012 | Ga0070704_1008550121 | 148 |
| 517 | 3300005564 | Ga0070664_100044718 | Ga0070664_1000447182 | 148 |
| 518 | 3300005564 | Ga0070664_100052952 | Ga0070664_1000529524 | 148 |
| 519 | 3300005564 | Ga0070664_100162791 | Ga0070664_1001627912 | 148 |
| 520 | 3300005564 | Ga0070664_100403114 | Ga0070664_1004031142 | 148 |
| 521 | 3300005564 | Ga0070664_101347338 | Ga0070664_1013473381 | 148 |
| 522 | 3300005577 | Ga0068857_100164472 | Ga0068857_1001644722 | 148 |
| 523 | 3300005577 | Ga0068857_100270782 | Ga0068857_1002707822 | 148 |
| 524 | 3300005577 | Ga0068857_100363994 | Ga0068857_1003639942 | 148 |
| 525 | 3300005578 | Ga0068854_101606235 | Ga0068854_1016062351 | 148 |
| 526 | 3300005615 | Ga0070702_100604312 | Ga0070702_1006043122 | 148 |
| 527 | 3300005615 | Ga0070702_100617564 | Ga0070702_1006175642 | 148 |
| 528 | 3300005616 | Ga0068852_101595063 | Ga0068852_1015950631 | 148 |
| 529 | 3300005616 | Ga0068852_101730433 | Ga0068852_1017304331 | 148 |
| 530 | 3300005617 | Ga0068859_100002071 | Ga0068859_1000020712 | 148 |
| 531 | 3300005617 | Ga0068859_100002533 | Ga0068859_1000025335 | 148 |
| 532 | 3300005617 | Ga0068859_100022922 | Ga0068859_1000229227 | 148 |
| 533 | 3300005617 | Ga0068859_100069602 | Ga0068859_1000696021 | 148 |
| 534 | 3300005617 | Ga0068859_102563362 | Ga0068859_1025633621 | 148 |
| 535 | 3300005618 | Ga0068864_100067309 | Ga0068864_1000673092 | 148 |
| 536 | 3300005618 | Ga0068864_100431660 | Ga0068864_1004316603 | 148 |
| 537 | 3300005719 | Ga0068861_100001293 | Ga0068861_10000129313 | 148 |
| 538 | 3300005834 | Ga0068851_10849134 | Ga0068851_108491341 | 148 |
| 539 | 3300005840 | Ga0068870_10008632 | Ga0068870_100086326 | 148 |
| 540 | 3300005840 | Ga0068870_10014068 | Ga0068870_100140682 | 148 |
| 541 | 3300005840 | Ga0068870_10017998 | Ga0068870_100179985 | 148 |
| 542 | 3300005840 | Ga0068870_10456817 | Ga0068870_104568171 | 148 |
| 543 | 3300005840 | Ga0068870_10752093 | Ga0068870_107520931 | 148 |
| 544 | 3300005841 | Ga0068863_100019665 | Ga0068863_1000196654 | 148 |
| 545 | 3300005842 | Ga0068858_100015339 | Ga0068858_10001533910 | 148 |
| 546 | 3300005842 | Ga0068858_100052144 | Ga0068858_1000521444 | 148 |
| 547 | 3300005843 | Ga0068860_100006114 | Ga0068860_1000061142 | 148 |
| 548 | 3300005843 | Ga0068860_100038938 | Ga0068860_1000389385 | 148 |
| 549 | 3300005843 | Ga0068860_101260478 | Ga0068860_1012604781 | 148 |
| 550 | 3300005844 | Ga0068862_100001293 | Ga0068862_10000129322 | 148 |
| 551 | 3300005844 | Ga0068862_100004501 | Ga0068862_1000045018 | 148 |
| 552 | 3300005844 | Ga0068862_100717161 | Ga0068862_1007171612 | 148 |
| 553 | 3300005985 | Ga0081539_10000013 | Ga0081539_10000013358 | 148 |
| 554 | 3300005985 | Ga0081539_10000164 | Ga0081539_1000016457 | 148 |
| 555 | 3300005985 | Ga0081539_10013539 | Ga0081539_100135396 | 148 |
| 556 | 3300005985 | Ga0081539_10058268 | Ga0081539_100582681 | 148 |
| 557 | 3300006058 | Ga0075432_10061975 | Ga0075432_100619752 | 148 |
| 558 | 3300006175 | Ga0070712_101446797 | Ga0070712_1014467971 | 148 |
| 559 | 3300006237 | Ga0097621_100255420 | Ga0097621_1002554202 | 148 |
| 560 | 3300006237 | Ga0097621_100309097 | Ga0097621_1003090972 | 148 |
| 561 | 3300006237 | Ga0097621_100995095 | Ga0097621_1009950952 | 148 |
| 562 | 3300006358 | Ga0068871_100065374 | Ga0068871_1000653742 | 148 |
| 563 | 3300006358 | Ga0068871_100192405 | Ga0068871_1001924052 | 148 |
| 564 | 3300006358 | Ga0068871_100230976 | Ga0068871_1002309763 | 148 |
| 565 | 3300006844 | Ga0075428_100000869 | Ga0075428_10000086918 | 148 |
| 566 | 3300006844 | Ga0075428_100026891 | Ga0075428_1000268911 | 148 |
| 567 | 3300006844 | Ga0075428_100038755 | Ga0075428_1000387555 | 148 |
| 568 | 3300006844 | Ga0075428_100234100 | Ga0075428_1002341002 | 148 |
| 569 | 3300006844 | Ga0075428_100572935 | Ga0075428_1005729351 | 148 |
| 570 | 3300006844 | Ga0075428_101247363 | Ga0075428_1012473632 | 148 |
| 571 | 3300006846 | Ga0075430_100010153 | Ga0075430_1000101537 | 148 |
| 572 | 3300006846 | Ga0075430_100015622 | Ga0075430_1000156225 | 148 |
| 573 | 3300006847 | Ga0075431_100000533 | Ga0075431_10000053311 | 148 |
| 574 | 3300006847 | Ga0075431_100058743 | Ga0075431_1000587432 | 148 |
| 575 | 3300006847 | Ga0075431_100117491 | Ga0075431_1001174912 | 148 |
| 576 | 3300006852 | Ga0075433_10030688 | Ga0075433_100306883 | 148 |
| 577 | 3300006852 | Ga0075433_10036407 | Ga0075433_100364076 | 148 |
| 578 | 3300006852 | Ga0075433_10053367 | Ga0075433_100533673 | 148 |
| 579 | 3300006852 | Ga0075433_10054073 | Ga0075433_100540734 | 148 |
| 580 | 3300006852 | Ga0075433_10183185 | Ga0075433_101831852 | 148 |
| 581 | 3300006871 | Ga0075434_100008828 | Ga0075434_1000088284 | 148 |
| 582 | 3300006871 | Ga0075434_100054222 | Ga0075434_1000542222 | 148 |
| 583 | 3300006871 | Ga0075434_100107712 | Ga0075434_1001077123 | 148 |
| 584 | 3300006871 | Ga0075434_100268093 | Ga0075434_1002680932 | 148 |
| 585 | 3300006871 | Ga0075434_101096201 | Ga0075434_1010962011 | 148 |
| 586 | 3300006880 | Ga0075429_100062109 | Ga0075429_1000621092 | 148 |
| 587 | 3300006880 | Ga0075429_100391003 | Ga0075429_1003910032 | 148 |
| 588 | 3300006881 | Ga0068865_100150804 | Ga0068865_1001508043 | 148 |
| 589 | 3300006881 | Ga0068865_100338176 | Ga0068865_1003381762 | 148 |
| 590 | 3300006881 | Ga0068865_100855738 | Ga0068865_1008557382 | 148 |
| 591 | 3300006931 | Ga0097620_100002071 | Ga0097620_1000020712 | 148 |
| 592 | 3300006931 | Ga0097620_100002533 | Ga0097620_10000253316 | 148 |
| 593 | 3300006931 | Ga0097620_100022927 | Ga0097620_1000229277 | 148 |
| 594 | 3300006931 | Ga0097620_100069604 | Ga0097620_1000696041 | 148 |
| 595 | 3300006931 | Ga0097620_102562974 | Ga0097620_1025629741 | 148 |
| 596 | 3300007076 | Ga0075435_100005714 | Ga0075435_1000057143 | 148 |
| 597 | 3300007076 | Ga0075435_100060230 | Ga0075435_1000602302 | 148 |
| 598 | 3300007076 | Ga0075435_100637741 | Ga0075435_1006377412 | 148 |
| 599 | 3300009094 | Ga0111539_10000769 | Ga0111539_100007695 | 148 |
| 600 | 3300009094 | Ga0111539_10022455 | Ga0111539_100224558 | 148 |
| 601 | 3300009094 | Ga0111539_10360069 | Ga0111539_103600693 | 148 |
| 602 | 3300009094 | Ga0111539_10654940 | Ga0111539_106549401 | 148 |
| 603 | 3300009094 | Ga0111539_11208015 | Ga0111539_112080152 | 148 |
| 604 | 3300009094 | Ga0111539_12498185 | Ga0111539_124981851 | 148 |
| 605 | 3300009094 | Ga0111539_13317903 | Ga0111539_133179031 | 148 |
| 606 | 3300009098 | Ga0105245_10457378 | Ga0105245_104573782 | 148 |
| 607 | 3300009147 | Ga0114129_10003276 | Ga0114129_1000327614 | 148 |
| 608 | 3300009147 | Ga0114129_10006054 | Ga0114129_100060547 | 148 |
| 609 | 3300009147 | Ga0114129_10088180 | Ga0114129_100881807 | 148 |
| 610 | 3300009147 | Ga0114129_10113438 | Ga0114129_101134382 | 148 |
| 611 | 3300009147 | Ga0114129_10431633 | Ga0114129_104316332 | 148 |
| 612 | 3300009147 | Ga0114129_10610543 | Ga0114129_106105432 | 148 |
| 613 | 3300009147 | Ga0114129_10641114 | Ga0114129_106411142 | 148 |
| 614 | 3300009147 | Ga0114129_11329002 | Ga0114129_113290022 | 148 |
| 615 | 3300009147 | Ga0114129_12868545 | Ga0114129_128685451 | 148 |
| 616 | 3300009148 | Ga0105243_10039279 | Ga0105243_100392792 | 148 |
| 617 | 3300009148 | Ga0105243_11884064 | Ga0105243_118840641 | 148 |
| 618 | 3300009176 | Ga0105242_10467408 | Ga0105242_104674082 | 148 |
| 619 | 3300009177 | Ga0105248_10076791 | Ga0105248_100767912 | 148 |
| 620 | 3300009177 | Ga0105248_10158064 | Ga0105248_101580644 | 148 |
| 621 | 3300009553 | Ga0105249_10001334 | Ga0105249_1000133418 | 148 |
| 622 | 3300009553 | Ga0105249_10170129 | Ga0105249_101701293 | 148 |
| 623 | 3300011119 | Ga0105246_10095338 | Ga0105246_100953381 | 148 |
| 624 | 3300011119 | Ga0105246_10214474 | Ga0105246_102144741 | 148 |
| 625 | 3300011119 | Ga0105246_10827539 | Ga0105246_108275392 | 148 |
| 626 | 3300011119 | Ga0105246_10905180 | Ga0105246_109051802 | 148 |
| 627 | 3300012480 | Ga0157346_1019322 | Ga0157346_10193221 | 148 |
| 628 | 3300012495 | Ga0157323_1007328 | Ga0157323_10073281 | 148 |
| 629 | 3300013100 | Ga0157373_10981274 | Ga0157373_109812741 | 148 |
| 630 | 3300013296 | Ga0157374_10199239 | Ga0157374_101992392 | 148 |
| 631 | 3300013297 | Ga0157378_10059392 | Ga0157378_100593922 | 148 |
| 632 | 3300013297 | Ga0157378_10089613 | Ga0157378_100896133 | 148 |
| 633 | 3300013306 | Ga0163162_10016085 | Ga0163162_100160858 | 148 |
| 634 | 3300013306 | Ga0163162_10589379 | Ga0163162_105893792 | 148 |
| 635 | 3300013308 | Ga0157375_10009638 | Ga0157375_1000963811 | 148 |
| 636 | 3300013308 | Ga0157375_10027823 | Ga0157375_100278236 | 148 |
| 637 | 3300013308 | Ga0157375_10370261 | Ga0157375_103702612 | 148 |
| 638 | 3300014325 | Ga0163163_10255424 | Ga0163163_102554243 | 148 |
| 639 | 3300014326 | Ga0157380_10005619 | Ga0157380_100056192 | 148 |
| 640 | 3300014326 | Ga0157380_10757404 | Ga0157380_107574042 | 148 |
| 641 | 3300014745 | Ga0157377_10002991 | Ga0157377_100029915 | 148 |
| 642 | 3300014745 | Ga0157377_10034044 | Ga0157377_100340442 | 148 |
| 643 | 3300014745 | Ga0157377_10078417 | Ga0157377_100784172 | 148 |
| 644 | 3300014968 | Ga0157379_10003739 | Ga0157379_100037396 | 148 |
| 645 | 3300014968 | Ga0157379_10087853 | Ga0157379_100878533 | 148 |
| 646 | 3300014969 | Ga0157376_10068589 | Ga0157376_100685892 | 148 |
| 647 | 3300014969 | Ga0157376_10310734 | Ga0157376_103107343 | 148 |
| 648 | 3300014969 | Ga0157376_11247253 | Ga0157376_112472532 | 148 |
| 649 | 3300014969 | Ga0157376_11528060 | Ga0157376_115280601 | 148 |
| 650 | 3300017792 | Ga0163161_10011766 | Ga0163161_100117666 | 148 |
| 651 | 3300025271 | Ga0207666_1077723 | Ga0207666_10777231 | 148 |
| 652 | 3300025290 | Ga0207673_1004738 | Ga0207673_10047381 | 148 |
| 653 | 3300025315 | Ga0207697_10001621 | Ga0207697_100016212 | 148 |
| 654 | 3300025315 | Ga0207697_10102352 | Ga0207697_101023522 | 148 |
| 655 | 3300025893 | Ga0207682_10001841 | Ga0207682_100018416 | 148 |
| 656 | 3300025893 | Ga0207682_10013530 | Ga0207682_100135301 | 148 |
| 657 | 3300025893 | Ga0207682_10593655 | Ga0207682_105936551 | 148 |
| 658 | 3300025901 | Ga0207688_10001443 | Ga0207688_1000144311 | 148 |
| 659 | 3300025901 | Ga0207688_10132575 | Ga0207688_101325752 | 148 |
| 660 | 3300025901 | Ga0207688_10699274 | Ga0207688_106992741 | 148 |
| 661 | 3300025904 | Ga0207647_10047580 | Ga0207647_100475802 | 148 |
| 662 | 3300025907 | Ga0207645_10001881 | Ga0207645_1000188111 | 148 |
| 663 | 3300025907 | Ga0207645_10529058 | Ga0207645_105290582 | 148 |
| 664 | 3300025908 | Ga0207643_10004144 | Ga0207643_100041448 | 148 |
| 665 | 3300025908 | Ga0207643_10005748 | Ga0207643_100057482 | 148 |
| 666 | 3300025908 | Ga0207643_10053082 | Ga0207643_100530822 | 148 |
| 667 | 3300025908 | Ga0207643_10234149 | Ga0207643_102341493 | 148 |
| 668 | 3300025908 | Ga0207643_10605897 | Ga0207643_106058972 | 148 |
| 669 | 3300025909 | Ga0207705_10224675 | Ga0207705_102246752 | 148 |
| 670 | 3300025910 | Ga0207684_10115149 | Ga0207684_101151492 | 148 |
| 671 | 3300025912 | Ga0207707_10084480 | Ga0207707_100844802 | 148 |
| 672 | 3300025915 | Ga0207693_10434261 | Ga0207693_104342612 | 148 |
| 673 | 3300025917 | Ga0207660_10199381 | Ga0207660_101993812 | 148 |
| 674 | 3300025917 | Ga0207660_10513750 | Ga0207660_105137502 | 148 |
| 675 | 3300025918 | Ga0207662_10002054 | Ga0207662_100020549 | 148 |
| 676 | 3300025918 | Ga0207662_10129801 | Ga0207662_101298012 | 148 |
| 677 | 3300025919 | Ga0207657_10899733 | Ga0207657_108997332 | 148 |
| 678 | 3300025920 | Ga0207649_10023217 | Ga0207649_100232172 | 148 |
| 679 | 3300025920 | Ga0207649_10267003 | Ga0207649_102670032 | 148 |
| 680 | 3300025920 | Ga0207649_11297535 | Ga0207649_112975351 | 148 |
| 681 | 3300025921 | Ga0207652_10701069 | Ga0207652_107010692 | 148 |
| 682 | 3300025921 | Ga0207652_10750787 | Ga0207652_107507872 | 148 |
| 683 | 3300025922 | Ga0207646_10020399 | Ga0207646_100203992 | 148 |
| 684 | 3300025922 | Ga0207646_10166267 | Ga0207646_101662672 | 148 |
| 685 | 3300025922 | Ga0207646_10177495 | Ga0207646_101774952 | 148 |
| 686 | 3300025922 | Ga0207646_10231923 | Ga0207646_102319232 | 148 |
| 687 | 3300025922 | Ga0207646_10270986 | Ga0207646_102709862 | 148 |
| 688 | 3300025923 | Ga0207681_10000566 | Ga0207681_1000056613 | 148 |
| 689 | 3300025923 | Ga0207681_10077568 | Ga0207681_100775682 | 148 |
| 690 | 3300025923 | Ga0207681_10088862 | Ga0207681_100888622 | 148 |
| 691 | 3300025923 | Ga0207681_10210141 | Ga0207681_102101412 | 148 |
| 692 | 3300025925 | Ga0207650_10037192 | Ga0207650_100371922 | 148 |
| 693 | 3300025925 | Ga0207650_10126129 | Ga0207650_101261292 | 148 |
| 694 | 3300025925 | Ga0207650_10273829 | Ga0207650_102738292 | 148 |
| 695 | 3300025925 | Ga0207650_10437743 | Ga0207650_104377431 | 148 |
| 696 | 3300025925 | Ga0207650_10569237 | Ga0207650_105692372 | 148 |
| 697 | 3300025926 | Ga0207659_10001222 | Ga0207659_100012225 | 148 |
| 698 | 3300025926 | Ga0207659_10002242 | Ga0207659_100022425 | 148 |
| 699 | 3300025926 | Ga0207659_10004787 | Ga0207659_100047872 | 148 |
| 700 | 3300025926 | Ga0207659_10027161 | Ga0207659_100271613 | 148 |
| 701 | 3300025926 | Ga0207659_10071033 | Ga0207659_100710333 | 148 |
| 702 | 3300025927 | Ga0207687_10849320 | Ga0207687_108493202 | 148 |
| 703 | 3300025931 | Ga0207644_10748292 | Ga0207644_107482922 | 148 |
| 704 | 3300025932 | Ga0207690_10165282 | Ga0207690_101652822 | 148 |
| 705 | 3300025933 | Ga0207706_10003425 | Ga0207706_100034258 | 148 |
| 706 | 3300025933 | Ga0207706_10037583 | Ga0207706_100375832 | 148 |
| 707 | 3300025933 | Ga0207706_10146880 | Ga0207706_101468803 | 148 |
| 708 | 3300025933 | Ga0207706_10833559 | Ga0207706_108335592 | 148 |
| 709 | 3300025934 | Ga0207686_10822442 | Ga0207686_108224422 | 148 |
| 710 | 3300025936 | Ga0207670_10003736 | Ga0207670_1000373610 | 148 |
| 711 | 3300025936 | Ga0207670_10006525 | Ga0207670_100065256 | 148 |
| 712 | 3300025937 | Ga0207669_10428381 | Ga0207669_104283812 | 148 |
| 713 | 3300025940 | Ga0207691_10012691 | Ga0207691_100126917 | 148 |
| 714 | 3300025940 | Ga0207691_10050039 | Ga0207691_100500394 | 148 |
| 715 | 3300025940 | Ga0207691_10088306 | Ga0207691_100883062 | 148 |
| 716 | 3300025940 | Ga0207691_10256872 | Ga0207691_102568723 | 148 |
| 717 | 3300025941 | Ga0207711_10083185 | Ga0207711_100831854 | 148 |
| 718 | 3300025941 | Ga0207711_10242585 | Ga0207711_102425853 | 148 |
| 719 | 3300025942 | Ga0207689_10000831 | Ga0207689_1000083110 | 148 |
| 720 | 3300025942 | Ga0207689_10084887 | Ga0207689_100848873 | 148 |
| 721 | 3300025944 | Ga0207661_10028828 | Ga0207661_100288284 | 148 |
| 722 | 3300025945 | Ga0207679_10029892 | Ga0207679_100298921 | 148 |
| 723 | 3300025945 | Ga0207679_10082888 | Ga0207679_100828882 | 148 |
| 724 | 3300025945 | Ga0207679_10757637 | Ga0207679_107576372 | 148 |
| 725 | 3300025945 | Ga0207679_11454145 | Ga0207679_114541451 | 148 |
| 726 | 3300025960 | Ga0207651_10096190 | Ga0207651_100961901 | 148 |
| 727 | 3300025960 | Ga0207651_10125337 | Ga0207651_101253372 | 148 |
| 728 | 3300025960 | Ga0207651_10180642 | Ga0207651_101806422 | 148 |
| 729 | 3300025960 | Ga0207651_10380877 | Ga0207651_103808773 | 148 |
| 730 | 3300025961 | Ga0207712_10002418 | Ga0207712_1000241811 | 148 |
| 731 | 3300025961 | Ga0207712_10464140 | Ga0207712_104641402 | 148 |
| 732 | 3300025972 | Ga0207668_10150849 | Ga0207668_101508492 | 148 |
| 733 | 3300025972 | Ga0207668_10269874 | Ga0207668_102698743 | 148 |
| 734 | 3300025981 | Ga0207640_10067322 | Ga0207640_100673222 | 148 |
| 735 | 3300025981 | Ga0207640_10250656 | Ga0207640_102506561 | 148 |
| 736 | 3300025986 | Ga0207658_10012438 | Ga0207658_100124382 | 148 |
| 737 | 3300025986 | Ga0207658_11138384 | Ga0207658_111383841 | 148 |
| 738 | 3300026023 | Ga0207677_10063258 | Ga0207677_100632584 | 148 |
| 739 | 3300026023 | Ga0207677_10603857 | Ga0207677_106038571 | 148 |
| 740 | 3300026035 | Ga0207703_10042317 | Ga0207703_100423173 | 148 |
| 741 | 3300026035 | Ga0207703_10141518 | Ga0207703_101415181 | 148 |
| 742 | 3300026041 | Ga0207639_11705257 | Ga0207639_117052571 | 148 |
| 743 | 3300026075 | Ga0207708_10017222 | Ga0207708_100172222 | 148 |
| 744 | 3300026075 | Ga0207708_10095321 | Ga0207708_100953213 | 148 |
| 745 | 3300026088 | Ga0207641_10097682 | Ga0207641_100976822 | 148 |
| 746 | 3300026088 | Ga0207641_10105045 | Ga0207641_101050452 | 148 |
| 747 | 3300026088 | Ga0207641_11546920 | Ga0207641_115469201 | 148 |
| 748 | 3300026089 | Ga0207648_10000446 | Ga0207648_1000044630 | 148 |
| 749 | 3300026089 | Ga0207648_10062997 | Ga0207648_100629971 | 148 |
| 750 | 3300026089 | Ga0207648_11114991 | Ga0207648_111149912 | 148 |
| 751 | 3300026095 | Ga0207676_10010914 | Ga0207676_100109142 | 148 |
| 752 | 3300026095 | Ga0207676_10026175 | Ga0207676_100261755 | 148 |
| 753 | 3300026116 | Ga0207674_10176364 | Ga0207674_101763642 | 148 |
| 754 | 3300026116 | Ga0207674_10185565 | Ga0207674_101855652 | 148 |
| 755 | 3300026116 | Ga0207674_10465004 | Ga0207674_104650042 | 148 |
| 756 | 3300026118 | Ga0207675_100001058 | Ga0207675_10000105813 | 148 |
| 757 | 3300026118 | Ga0207675_100004015 | Ga0207675_10000401511 | 148 |
| 758 | 3300026118 | Ga0207675_100794938 | Ga0207675_1007949381 | 148 |
| 759 | 3300026121 | Ga0207683_10021244 | Ga0207683_100212445 | 148 |
| 760 | 3300026121 | Ga0207683_10128891 | Ga0207683_101288913 | 148 |
| 761 | 3300026121 | Ga0207683_10808344 | Ga0207683_108083442 | 148 |
| 762 | 3300026142 | Ga0207698_10509518 | Ga0207698_105095182 | 148 |
| 763 | 3300027617 | Ga0210002_1084402 | Ga0210002_10844021 | 148 |
| 764 | 3300027907 | Ga0207428_10000224 | Ga0207428_1000022467 | 148 |
| 765 | 3300027907 | Ga0207428_10010077 | Ga0207428_100100778 | 148 |
| 766 | 3300027907 | Ga0207428_10304822 | Ga0207428_103048222 | 148 |
| 767 | 3300028379 | Ga0268266_10312547 | Ga0268266_103125472 | 148 |
| 768 | 3300028380 | Ga0268265_10000540 | Ga0268265_1000054021 | 148 |
| 769 | 3300028380 | Ga0268265_10055567 | Ga0268265_100555672 | 148 |
| 770 | 3300028380 | Ga0268265_10374861 | Ga0268265_103748611 | 148 |
| 771 | 3300028381 | Ga0268264_10012807 | Ga0268264_100128078 | 148 |
| 772 | 3300028381 | Ga0268264_10115573 | Ga0268264_101155732 | 148 |
| 773 | 3300028381 | Ga0268264_10879495 | Ga0268264_108794952 | 148 |
| 774 | 3300031548 | Ga0307408_100388393 | Ga0307408_1003883931 | 148 |
| 775 | 3300031548 | Ga0307408_101045124 | Ga0307408_1010451241 | 148 |
| 776 | 3300031731 | Ga0307405_10091958 | Ga0307405_100919583 | 148 |
| 777 | 3300031731 | Ga0307405_10751537 | Ga0307405_107515372 | 148 |
| 778 | 3300031824 | Ga0307413_10045918 | Ga0307413_100459183 | 148 |
| 779 | 3300031824 | Ga0307413_10140375 | Ga0307413_101403752 | 148 |
| 780 | 3300031824 | Ga0307413_11234604 | Ga0307413_112346041 | 148 |
| 781 | 3300031852 | Ga0307410_10005392 | Ga0307410_100053923 | 148 |
| 782 | 3300031852 | Ga0307410_10123448 | Ga0307410_101234482 | 148 |
| 783 | 3300031852 | Ga0307410_10141882 | Ga0307410_101418821 | 148 |
| 784 | 3300031901 | Ga0307406_10041702 | Ga0307406_100417022 | 148 |
| 785 | 3300031901 | Ga0307406_11405123 | Ga0307406_114051231 | 148 |
| 786 | 3300031903 | Ga0307407_10060573 | Ga0307407_100605733 | 148 |
| 787 | 3300031903 | Ga0307407_10968281 | Ga0307407_109682812 | 148 |
| 788 | 3300031911 | Ga0307412_10083761 | Ga0307412_100837612 | 148 |
| 789 | 3300031911 | Ga0307412_10671720 | Ga0307412_106717202 | 148 |
| 790 | 3300031911 | Ga0307412_10934579 | Ga0307412_109345792 | 148 |
| 791 | 3300031995 | Ga0307409_100018258 | Ga0307409_1000182584 | 148 |
| 792 | 3300031995 | Ga0307409_100104257 | Ga0307409_1001042573 | 148 |
| 793 | 3300031995 | Ga0307409_100115339 | Ga0307409_1001153392 | 148 |
| 794 | 3300031995 | Ga0307409_100147164 | Ga0307409_1001471643 | 148 |
| 795 | 3300031995 | Ga0307409_100927127 | Ga0307409_1009271272 | 148 |
| 796 | 3300032002 | Ga0307416_100012439 | Ga0307416_1000124395 | 148 |
| 797 | 3300032002 | Ga0307416_100072394 | Ga0307416_1000723943 | 148 |
| 798 | 3300032002 | Ga0307416_100119105 | Ga0307416_1001191052 | 148 |
| 799 | 3300032002 | Ga0307416_100530497 | Ga0307416_1005304972 | 148 |
| 800 | 3300032002 | Ga0307416_100791711 | Ga0307416_1007917112 | 148 |
| 801 | 3300032002 | Ga0307416_101584211 | Ga0307416_1015842111 | 148 |
| 802 | 3300032002 | Ga0307416_101974363 | Ga0307416_1019743631 | 148 |
| 803 | 3300032002 | Ga0307416_102130950 | Ga0307416_1021309501 | 148 |
| 804 | 3300032002 | Ga0307416_103018112 | Ga0307416_1030181121 | 148 |
| 805 | 3300032002 | Ga0307416_103157408 | Ga0307416_1031574081 | 148 |
| 806 | 3300032004 | Ga0307414_10366728 | Ga0307414_103667283 | 148 |
| 807 | 3300032004 | Ga0307414_10418639 | Ga0307414_104186392 | 148 |
| 808 | 3300032004 | Ga0307414_10549306 | Ga0307414_105493062 | 148 |
| 809 | 3300032005 | Ga0307411_10003247 | Ga0307411_100032478 | 148 |
| 810 | 3300032005 | Ga0307411_10029786 | Ga0307411_100297864 | 148 |
| 811 | 3300032005 | Ga0307411_10819408 | Ga0307411_108194081 | 148 |
| 812 | 3300032126 | Ga0307415_100007237 | Ga0307415_1000072372 | 148 |
| 813 | 3300032126 | Ga0307415_100134002 | Ga0307415_1001340023 | 148 |
| 814 | 3300032126 | Ga0307415_101561037 | Ga0307415_1015610372 | 148 |
| 815 | 3300034819 | Ga0373958_0149005 | Ga0373958_0149005_78_524 | 148 |
| 816 | 3300035088 | Ga0373940_0089324 | Ga0373940_0089324_13_459 | 148 |
| 817 | 3300035114 | Ga0373939_0279073 | Ga0373939_0279073_190_636 | 148 |
| 818 | 3300035115 | Ga0373941_0201517 | Ga0373941_0201517_131_577 | 148 |
| 819 | 3300035115 | Ga0373941_0428774 | Ga0373941_0428774_37_483 | 148 |
| 820 | 3300035241 | Ga0373961_0222983 | Ga0373961_0222983_144_590 | 148 |
| 821 | 3300038996 | Ga0242420_143832 | Ga0242420_143832_29_475 | 148 |
| 822 | 3300042002 | Ga0439442_126911 | Ga0439442_126911_40_486 | 148 |
| 823 | 3300042437 | Ga0439444_0009088 | Ga0439444_0009088_848_1297 | 148 |
| 824 | 3300042461 | Ga0439460_0244470 | Ga0439460_0244470_83_529 | 148 |
| 825 | 3300042876 | Ga0451577_0607601 | Ga0451577_0607601_152_598 | 148 |
| 826 | 3300045051 | Ga0451576_0007819 | Ga0451576_0007819_11741_12187 | 148 |
| 827 | 3300045051 | Ga0451576_0013731 | Ga0451576_0013731_4330_4776 | 148 |
| 828 | 3300045051 | Ga0451576_0067399 | Ga0451576_0067399_68_616 | 148 |
| 829 | 3300045051 | Ga0451576_0079338 | Ga0451576_0079338_2800_3246 | 148 |
| 830 | 3300045051 | Ga0451576_0186928 | Ga0451576_0186928_83_529 | 148 |
| 831 | 3300045051 | Ga0451576_0705066 | Ga0451576_0705066_362_808 | 148 |
| 832 | 3300046455 | Ga0495603_0188771 | Ga0495603_0188771_640_1086 | 148 |
| 833 | 3300046459 | Ga0495629_0057974 | Ga0495629_0057974_130_576 | 148 |
| 834 | 3300046472 | Ga0495580_0532991 | Ga0495580_0532991_46_492 | 148 |
| 835 | 3300046492 | Ga0495585_0147225 | Ga0495585_0147225_583_1029 | 148 |
| 836 | 3300046499 | Ga0495594_0028254 | Ga0495594_0028254_2258_2704 | 148 |
| 837 | 3300046522 | Ga0495643_0001548 | Ga0495643_0001548_4068_4514 | 148 |
| 838 | 3300046523 | Ga0495644_0019673 | Ga0495644_0019673_1235_1681 | 148 |
| 839 | 3300046528 | Ga0495642_0046137 | Ga0495642_0046137_1246_1692 | 148 |
| 840 | 3300046528 | Ga0495642_0048601 | Ga0495642_0048601_224_670 | 148 |
| 841 | 3300046538 | Ga0495609_0147241 | Ga0495609_0147241_371_817 | 148 |
| 842 | 3300046539 | Ga0495621_0015340 | Ga0495621_0015340_824_1270 | 148 |
| 843 | 3300046539 | Ga0495621_0107764 | Ga0495621_0107764_234_680 | 148 |
| 844 | 3300046664 | Ga0495659_0003442 | Ga0495659_0003442_1716_2162 | 148 |
| 845 | 3300046664 | Ga0495659_0013145 | Ga0495659_0013145_1687_2133 | 148 |
| 846 | 3300046664 | Ga0495659_0190341 | Ga0495659_0190341_64_510 | 148 |
| 847 | 3300046664 | Ga0495659_0308799 | Ga0495659_0308799_173_619 | 148 |
| 848 | 3300046664 | Ga0495659_0348468 | Ga0495659_0348468_62_508 | 148 |
| 849 | 3300046674 | Ga0495588_0024382 | Ga0495588_0024382_1780_2226 | 148 |
| 850 | 3300046691 | Ga0495670_0173556 | Ga0495670_0173556_15_461 | 148 |
| 851 | 3300046691 | Ga0495670_0483775 | Ga0495670_0483775_187_648 | 148 |
| 852 | 3300047318 | Ga0495636_0063710 | Ga0495636_0063710_943_1389 | 148 |
| 853 | 3300047445 | Ga0495677_0028335 | Ga0495677_0028335_1420_1866 | 148 |
| 854 | 3300047445 | Ga0495677_0195527 | Ga0495677_0195527_92_538 | 148 |
| 855 | 3300048907 | Ga0496104_0815228 | Ga0496104_0815228_109_555 | 148 |
| 856 | 3300048911 | Ga0496108_1280058 | Ga0496108_1280058_90_536 | 148 |
| 857 | 3300048913 | Ga0496110_0387822 | Ga0496110_0387822_367_813 | 148 |
| 858 | 3300048915 | Ga0496112_1640137 | Ga0496112_1640137_25_471 | 148 |
| 859 | 3300049513 | Ga0501290_071205 | Ga0501290_071205_94_540 | 148 |
| 860 | 3300049572 | Ga0501036_0665359 | Ga0501036_0665359_320_766 | 148 |
| 861 | 3300049573 | Ga0501037_0639497 | Ga0501037_0639497_91_540 | 148 |
| 862 | 3300049575 | Ga0501039_0007557 | Ga0501039_0007557_5395_5844 | 148 |
| 863 | 3300049576 | Ga0501040_0012945 | Ga0501040_0012945_2002_2451 | 148 |
| 864 | 3300049577 | Ga0501041_0227101 | Ga0501041_0227101_660_1106 | 148 |
| 865 | 3300049578 | Ga0501042_0632904 | Ga0501042_0632904_48_494 | 148 |
| 866 | 3300049580 | Ga0501046_0074757 | Ga0501046_0074757_1125_1574 | 148 |
| 867 | 3300049583 | Ga0501067_0296343 | Ga0501067_0296343_115_561 | 148 |
| 868 | 3300049584 | Ga0501068_0368144 | Ga0501068_0368144_270_719 | 148 |
| 869 | 3300049588 | Ga0501072_0008859 | Ga0501072_0008859_315_764 | 148 |
| 870 | 3300049588 | Ga0501072_0205831 | Ga0501072_0205831_300_746 | 148 |
| 871 | 3300049588 | Ga0501072_0392733 | Ga0501072_0392733_15_461 | 148 |
| 872 | 3300049591 | Ga0501075_0098439 | Ga0501075_0098439_1653_2102 | 148 |
| 873 | 3300049591 | Ga0501075_0502202 | Ga0501075_0502202_431_877 | 148 |
| 874 | 3300049592 | Ga0501076_0044775 | Ga0501076_0044775_264_713 | 148 |
| 875 | 3300049655 | Ga0501208_041509 | Ga0501208_041509_243_689 | 148 |
| 876 | 3300049679 | Ga0501249_016262 | Ga0501249_016262_814_1260 | 148 |
| 877 | 3300049704 | Ga0501221_137825 | Ga0501221_137825_104_550 | 148 |
| 878 | 3300049708 | Ga0501245_059587 | Ga0501245_059587_120_566 | 148 |
| 879 | 3300049741 | Ga0501079_0075401 | Ga0501079_0075401_101_550 | 148 |
| 880 | 3300049741 | Ga0501079_0445534 | Ga0501079_0445534_249_695 | 148 |
| 881 | 3300049742 | Ga0501080_0553263 | Ga0501080_0553263_111_557 | 148 |
| 882 | 3300049742 | Ga0501080_0994261 | Ga0501080_0994261_215_661 | 148 |
| 883 | 3300049743 | Ga0501081_0190447 | Ga0501081_0190447_998_1447 | 148 |
| 884 | 3300049743 | Ga0501081_0339545 | Ga0501081_0339545_583_1029 | 148 |
| 885 | 3300049743 | Ga0501081_0386495 | Ga0501081_0386495_155_601 | 148 |
| 886 | 3300049743 | Ga0501081_0625649 | Ga0501081_0625649_341_787 | 148 |
| 887 | 3300049779 | Ga0501283_035584 | Ga0501283_035584_220_666 | 148 |
| 888 | 3300050507 | nmdc:mga05p37_1654227_c1 | nmdc:mga05p37_1654227_c1_25_471 | 148 |
| 889 | 3300050507 | nmdc:mga05p37_1656263_c1 | nmdc:mga05p37_1656263_c1_90_536 | 148 |
| 890 | 3300050507 | nmdc:mga05p37_17011_c1 | nmdc:mga05p37_17011_c1_5840_6286 | 148 |
| 891 | 3300050507 | nmdc:mga05p37_200071_c1 | nmdc:mga05p37_200071_c1_1471_1917 | 148 |
| 892 | 3300050507 | nmdc:mga05p37_244730_c1 | nmdc:mga05p37_244730_c1_1608_2057 | 148 |
| 893 | 3300050507 | nmdc:mga05p37_395165_c1 | nmdc:mga05p37_395165_c1_360_809 | 148 |
| 894 | 3300050507 | nmdc:mga05p37_70703_c1 | nmdc:mga05p37_70703_c1_118_564 | 148 |
| 895 | 3300050507 | nmdc:mga05p37_974417_c1 | nmdc:mga05p37_974417_c1_428_874 | 148 |
| 896 | 3300050508 | nmdc:mga09592_29049_c1 | nmdc:mga09592_29049_c1_1015_1461 | 148 |
| 897 | 3300050508 | nmdc:mga09592_61109_c1 | nmdc:mga09592_61109_c1_2011_2460 | 148 |
| 898 | 3300050508 | nmdc:mga09592_80073_c1 | nmdc:mga09592_80073_c1_1503_1949 | 148 |
| 899 | 3300050509 | nmdc:mga0qj67_526_c1 | nmdc:mga0qj67_526_c1_20470_20916 | 148 |
| 900 | 3300050509 | nmdc:mga0qj67_5798_c1 | nmdc:mga0qj67_5798_c1_3655_4104 | 148 |
| 901 | 3300050510 | nmdc:mga06r32_107386_c1 | nmdc:mga06r32_107386_c1_913_1359 | 148 |
| 902 | 3300050510 | nmdc:mga06r32_18027_c1 | nmdc:mga06r32_18027_c1_1345_1794 | 148 |
| 903 | 3300050510 | nmdc:mga06r32_24815_c1 | nmdc:mga06r32_24815_c1_1249_1695 | 148 |
| 904 | 3300050511 | nmdc:mga08y16_15575_c1 | nmdc:mga08y16_15575_c1_6839_7285 | 148 |
| 905 | 3300050511 | nmdc:mga08y16_1836417_c1 | nmdc:mga08y16_1836417_c1_87_533 | 148 |
| 906 | 3300050511 | nmdc:mga08y16_467911_c1 | nmdc:mga08y16_467911_c1_83_529 | 148 |
| 907 | 3300050511 | nmdc:mga08y16_575165_c1 | nmdc:mga08y16_575165_c1_277_723 | 148 |
| 908 | 3300050511 | nmdc:mga08y16_60586_c1 | nmdc:mga08y16_60586_c1_1600_2046 | 148 |
| 909 | 3300050511 | nmdc:mga08y16_684391_c1 | nmdc:mga08y16_684391_c1_563_1009 | 148 |
| 910 | 3300050512 | nmdc:mga0n895_1446644_c1 | nmdc:mga0n895_1446644_c1_120_566 | 148 |
| 911 | 3300050512 | nmdc:mga0n895_32666_c1 | nmdc:mga0n895_32666_c1_3356_3802 | 148 |
| 912 | 3300050512 | nmdc:mga0n895_465314_c1 | nmdc:mga0n895_465314_c1_424_870 | 148 |
| 913 | 3300050512 | nmdc:mga0n895_809892_c1 | nmdc:mga0n895_809892_c1_458_904 | 148 |
| 914 | 3300050512 | nmdc:mga0n895_88881_c1 | nmdc:mga0n895_88881_c1_1437_1889 | 148 |
| 915 | 3300050512 | nmdc:mga0n895_90365_c1 | nmdc:mga0n895_90365_c1_283_729 | 148 |
| 916 | 3300050513 | nmdc:mga0rr50_102607_c1 | nmdc:mga0rr50_102607_c1_48_494 | 148 |
| 917 | 3300050513 | nmdc:mga0rr50_111579_c1 | nmdc:mga0rr50_111579_c1_27_473 | 148 |
| 918 | 3300050513 | nmdc:mga0rr50_1506752_c1 | nmdc:mga0rr50_1506752_c1_83_529 | 148 |
| 919 | 3300050513 | nmdc:mga0rr50_63989_c1 | nmdc:mga0rr50_63989_c1_1509_1961 | 148 |
| 920 | 3300050515 | nmdc:mga0a205_107387_c1 | nmdc:mga0a205_107387_c1_2074_2526 | 148 |
| 921 | 3300050515 | nmdc:mga0a205_1497_c1 | nmdc:mga0a205_1497_c1_4352_4798 | 148 |
| 922 | 3300050515 | nmdc:mga0a205_422640_c1 | nmdc:mga0a205_422640_c1_270_716 | 148 |
| 923 | 3300050515 | nmdc:mga0a205_55600_c1 | nmdc:mga0a205_55600_c1_350_796 | 148 |
| 924 | 3300050515 | nmdc:mga0a205_91795_c1 | nmdc:mga0a205_91795_c1_1860_2306 | 148 |
| 925 | 3300050515 | nmdc:mga0a205_94654_c1 | nmdc:mga0a205_94654_c1_1890_2336 | 148 |
| 926 | 3300054114 | Ga0501084_0250372 | Ga0501084_0250372_328_777 | 148 |
| 927 | 3300054114 | Ga0501084_0764188 | Ga0501084_0764188_18_464 | 148 |
| 928 | 3300059421 | Ga0590071_000198 | Ga0590071_000198_2862_3311 | 148 |
| 929 | 3300059421 | Ga0590071_001421 | Ga0590071_001421_3257_3703 | 148 |
| 930 | 3300059421 | Ga0590071_007060 | Ga0590071_007060_664_1110 | 148 |
| 931 | 3300059423 | Ga0590074_009905 | Ga0590074_009905_59_508 | 148 |
| 932 | 3300059424 | Ga0590075_000275 | Ga0590075_000275_8794_9243 | 148 |
| 933 | 3300059424 | Ga0590075_007624 | Ga0590075_007624_91_537 | 148 |
| 934 | 3300059426 | Ga0590077_000049 | Ga0590077_000049_3954_4403 | 148 |
| 935 | 3300059426 | Ga0590077_001543 | Ga0590077_001543_1511_1957 | 148 |
| 936 | 3300060353 | Ga0501082_0010321 | Ga0501082_0010321_1061_1510 | 148 |
| 937 | 3300061734 | Ga0530510_0001774 | Ga0530510_0001774_1532_1981 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zul-assembly1.cif.gz_E-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.9138 | 37 | 132 |
| 3guf-assembly1.cif.gz_B | crystal structure of the hspa from xanthomonas axonopodis | 0.8995 | 37 | 134 |
| 2h50-assembly1.cif.gz_P | multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 | 0.8979 | 42 | 132 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8943 | 41 | 132 |
| 5zul-assembly1.cif.gz_A-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.8896 | 37 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3glaB00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9057 | 39 | 135 | 2.60.40.790 |
| 5ds2D00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8943 | 41 | 132 | 2.60.40.790 |
| af_K7KYJ0_12_113_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8919 | 37 | 134 | 2.60.40.790 |
| af_I1M7E1_1_101_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.888 | 38 | 133 | 2.60.40.790 |
| af_C0PJF1_1_102_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8869 | 37 | 135 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1PHI6-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.9259 | 37 | 145 |
|
| AF-A0A0L0H616-F1-model_v4 | SHSP domain-containing protein | 0.9258 | 39 | 145 |
|
| AF-A0A7V5G6R0-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.9226 | 39 | 134 |
|
| AF-A0A2D4Z8W5-F1-model_v4 | deleted | 0.9163 | 39 | 147 |
|
| AF-A0A7V5G6R0-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.9137 | 39 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar