F486229

General Info

Members Datasets Scaffolds Average Seq Length
937 269 937 146

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0067399|Ga0451576_0067399_68_616
Length 182
Sequence MRGCAARPQAQGSWLEPWALWALSLDSEQKEKTNMAIVKVDPFRELTAMQDRMARLFGDVYLRDEDTGFRGSWTPAVDIFETEHHDLVLKAEVPGMTRENIEVTVENGTLVLKGQKNFDTDVKEEHYRRIERSYGQFYRSFTLPNTVDTSKVAADYKNGILTVKLPFREEAKPRSINVEVAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
99 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 0.43
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000909 3300001977 Bacteria 4622
2 JGI24750J21931_1027064 3300002070 Bacteria 828
3 JGI24749J21850_1010328 3300002076 Unclassified 1309
4 JGI24035J26624_1029462 3300002126 Archaea 595
5 JGI24751J29686_10093352 3300002459 Unclassified 626
6 JGI25406J46586_10012672 3300003203 Bacteria 3646
7 Ga0058860_11692652 3300004801 Archaea 502
8 Ga0058860_11970884 3300004801 Unclassified 618
9 Ga0058860_12184011 3300004801 Bacteria 617
10 Ga0065714_10342292 3300005288 Bacteria 617
11 Ga0065704_10077157 3300005289 Bacteria 4835
12 Ga0065704_10246247 3300005289 Bacteria 1001
13 Ga0065704_10347472 3300005289 Archaea 814
14 Ga0065704_10483285 3300005289 Unclassified 680
15 Ga0065712_10012047 3300005290 Bacteria 3073
16 Ga0065712_10019331 3300005290 Unclassified 1697
17 Ga0065712_10085635 3300005290 Bacteria 2685
18 Ga0065712_10086488 3300005290 Bacteria 2626
19 Ga0065712_10088620 3300005290 Bacteria 2500
20 Ga0065712_10223940 3300005290 Bacteria 1032
21 Ga0065712_10375391 3300005290 Unclassified 758
22 Ga0065712_10534061 3300005290 Unclassified 628
23 Ga0065715_10000879 3300005293 Bacteria 12771
24 Ga0065715_10096891 3300005293 Bacteria 3801
25 Ga0065715_10100717 3300005293 Bacteria 3275
26 Ga0065715_10624584 3300005293 Unclassified 693
27 Ga0065715_10701154 3300005293 Bacteria 653
28 Ga0065715_11083627 3300005293 Unclassified 524
29 Ga0065707_10006295 3300005295 Bacteria 3125
30 Ga0065707_10023887 3300005295 Bacteria 2106
31 Ga0065707_10275714 3300005295 Bacteria 1043
32 Ga0065707_10628294 3300005295 Archaea 654
33 Ga0065707_10805685 3300005295 Unclassified 597
34 Ga0070658_10477958 3300005327 Bacteria 1075
35 Ga0070658_11265126 3300005327 Bacteria 641
36 Ga0070658_11305960 3300005327 Unclassified 630
37 Ga0070676_10004240 3300005328 Bacteria 7536
38 Ga0070676_10126212 3300005328 Bacteria 1612
39 Ga0070676_10333427 3300005328 Unclassified 1038
40 Ga0070676_10402252 3300005328 Bacteria 953
41 Ga0070676_10959672 3300005328 Unclassified 640
42 Ga0070683_100065328 3300005329 Bacteria 3388
43 Ga0070683_100734194 3300005329 Bacteria 946
44 Ga0070683_101725729 3300005329 Unclassified 602
45 Ga0070690_100013733 3300005330 Bacteria 4796
46 Ga0070690_100016453 3300005330 Bacteria 4431
47 Ga0070690_100041224 3300005330 Bacteria 2922
48 Ga0070690_101516938 3300005330 Unclassified 542
49 Ga0070670_100021219 3300005331 Bacteria 5588
50 Ga0070670_100062034 3300005331 Bacteria 3209
51 Ga0070670_100069094 3300005331 Bacteria 3032
52 Ga0070670_100183131 3300005331 Bacteria 1819
53 Ga0070670_100268336 3300005331 Bacteria 1489
54 Ga0070670_100387732 3300005331 Bacteria 1231
55 Ga0070670_101120704 3300005331 Bacteria 718
56 Ga0070670_101218015 3300005331 Archaea 688
57 Ga0070670_101273836 3300005331 Bacteria 673
58 Ga0070677_10010650 3300005333 Bacteria 3150
59 Ga0070677_10321537 3300005333 Bacteria 793
60 Ga0068869_100003236 3300005334 Bacteria 9954
61 Ga0068869_100173747 3300005334 Bacteria 1685
62 Ga0068869_100309489 3300005334 Bacteria 1278
63 Ga0068869_100520169 3300005334 Unclassified 996
64 Ga0068869_100688548 3300005334 Bacteria 871
65 Ga0068869_100955344 3300005334 Bacteria 744
66 Ga0070666_10019167 3300005335 Bacteria 4413
67 Ga0070666_10025313 3300005335 Bacteria 3867
68 Ga0070666_10056738 3300005335 Bacteria 2645
69 Ga0070666_10750475 3300005335 Unclassified 717
70 Ga0070680_100189453 3300005336 Bacteria 1733
71 Ga0070680_100290096 3300005336 Bacteria 1387
72 Ga0070680_101041765 3300005336 Bacteria 707
73 Ga0070682_100593957 3300005337 Archaea 873
74 Ga0070682_102066207 3300005337 Unclassified 502
75 Ga0068868_100007147 3300005338 Bacteria 7935
76 Ga0068868_100132565 3300005338 Bacteria 2040
77 Ga0068868_100300595 3300005338 Bacteria 1363
78 Ga0068868_101566876 3300005338 Unclassified 618
79 Ga0070660_101288933 3300005339 Unclassified 620
80 Ga0070689_100006102 3300005340 Bacteria 8305
81 Ga0070689_100008169 3300005340 Bacteria 7356
82 Ga0070689_100062418 3300005340 Bacteria 2899
83 Ga0070689_100444795 3300005340 Bacteria 1102
84 Ga0070691_10169574 3300005341 Bacteria 1130
85 Ga0070687_100136219 3300005343 Bacteria 1424
86 Ga0070687_100584483 3300005343 Bacteria 765
87 Ga0070687_100643985 3300005343 Unclassified 734
88 Ga0070661_100033797 3300005344 Bacteria 3707
89 Ga0070661_100044414 3300005344 Bacteria 3247
90 Ga0070661_100230524 3300005344 Unclassified 1423
91 Ga0070661_100425074 3300005344 Bacteria 1054
92 Ga0070692_10086280 3300005345 Bacteria 1699
93 Ga0070692_10477954 3300005345 Archaea 803
94 Ga0070668_100107964 3300005347 Bacteria 2213
95 Ga0070668_100125945 3300005347 Bacteria 2052
96 Ga0070668_100332063 3300005347 Bacteria 1282
97 Ga0070668_101342214 3300005347 Bacteria 651
98 Ga0070669_100004669 3300005353 Bacteria 9888
99 Ga0070669_100007056 3300005353 Bacteria 8073
100 Ga0070669_100016438 3300005353 Bacteria 5279
101 Ga0070669_100097839 3300005353 Bacteria 2209
102 Ga0070669_100156477 3300005353 Bacteria 1768
103 Ga0070669_100193327 3300005353 Bacteria 1597
104 Ga0070669_100249264 3300005353 Unclassified 1413
105 Ga0070669_100431899 3300005353 Bacteria 1083
106 Ga0070675_100000998 3300005354 Bacteria 20285
107 Ga0070675_100003145 3300005354 Bacteria 12491
108 Ga0070675_100005576 3300005354 Bacteria 9637
109 Ga0070675_100017262 3300005354 Bacteria 5733
110 Ga0070675_100056448 3300005354 Bacteria 3236
111 Ga0070675_100068099 3300005354 Bacteria 2947
112 Ga0070675_100103317 3300005354 Bacteria 2403
113 Ga0070675_100176359 3300005354 Bacteria 1846
114 Ga0070675_100348068 3300005354 Unclassified 1314
115 Ga0070675_100358438 3300005354 Bacteria 1294
116 Ga0070675_100418093 3300005354 Bacteria 1198
117 Ga0070675_100571563 3300005354 Bacteria 1023
118 Ga0070675_100914156 3300005354 Bacteria 804
119 Ga0070675_101343057 3300005354 Unclassified 659
120 Ga0070675_101746188 3300005354 Unclassified 574
121 Ga0070671_100154900 3300005355 Bacteria 1936
122 Ga0070671_100338502 3300005355 Bacteria 1283
123 Ga0070674_100001500 3300005356 Bacteria 12440
124 Ga0070674_100126837 3300005356 Unclassified 1897
125 Ga0070674_100677382 3300005356 Unclassified 879
126 Ga0070674_101023128 3300005356 Unclassified 726
127 Ga0070674_101318208 3300005356 Unclassified 644
128 Ga0070673_100011067 3300005364 Bacteria 6147
129 Ga0070673_100024542 3300005364 Bacteria 4423
130 Ga0070673_100094764 3300005364 Unclassified 2447
131 Ga0070673_100142705 3300005364 Bacteria 2022
132 Ga0070673_100203331 3300005364 Bacteria 1706
133 Ga0070673_100266332 3300005364 Bacteria 1498
134 Ga0070673_100409621 3300005364 Bacteria 1214
135 Ga0070688_100020189 3300005365 Bacteria 3870
136 Ga0070688_100092983 3300005365 Bacteria 1974
137 Ga0070688_100164937 3300005365 Bacteria 1525
138 Ga0070688_100188539 3300005365 Unclassified 1435
139 Ga0070688_100393658 3300005365 Bacteria 1024
140 Ga0070688_100537017 3300005365 Bacteria 887
141 Ga0070688_101304894 3300005365 Unclassified 586
142 Ga0070659_100016032 3300005366 Bacteria 5621
143 Ga0070659_100821816 3300005366 Unclassified 809
144 Ga0070667_100025321 3300005367 Bacteria 4932
145 Ga0070667_100169857 3300005367 Bacteria 1925
146 Ga0070667_101069016 3300005367 Unclassified 754
147 Ga0070667_101368857 3300005367 Bacteria 664
148 Ga0070701_10079984 3300005438 Bacteria 1767
149 Ga0070701_10116834 3300005438 Bacteria 1498
150 Ga0070701_10276904 3300005438 Archaea 1023
151 Ga0070701_10455345 3300005438 Bacteria 822
152 Ga0070705_100001006 3300005440 Bacteria 15697
153 Ga0070705_100065913 3300005440 Bacteria 2170
154 Ga0070705_100169270 3300005440 Bacteria 1469
155 Ga0070705_100615398 3300005440 Bacteria 842
156 Ga0070705_100767487 3300005440 Unclassified 764
157 Ga0070700_100089978 3300005441 Bacteria 2001
158 Ga0070700_100152172 3300005441 Bacteria 1583
159 Ga0070700_100296060 3300005441 Bacteria 1179
160 Ga0070700_100303262 3300005441 Bacteria 1167
161 Ga0070694_100001224 3300005444 Bacteria 14823
162 Ga0070694_100002510 3300005444 Bacteria 10833
163 Ga0070694_100886870 3300005444 Viruses 736
164 Ga0070678_100019465 3300005456 Bacteria 4426
165 Ga0070678_100120646 3300005456 Unclassified 2067
166 Ga0070678_100129534 3300005456 Bacteria 2002
167 Ga0070678_100207670 3300005456 Bacteria 1620
168 Ga0070678_100443188 3300005456 Unclassified 1136
169 Ga0070678_100602360 3300005456 Bacteria 981
170 Ga0070678_101572406 3300005456 Unclassified 617
171 Ga0070662_100054409 3300005457 Bacteria 2900
172 Ga0070662_100063348 3300005457 Bacteria 2704
173 Ga0070662_100302125 3300005457 Bacteria 1301
174 Ga0070662_100548831 3300005457 Unclassified 968
175 Ga0070681_10018905 3300005458 Bacteria 6894
176 Ga0068867_100000147 3300005459 Bacteria 45184
177 Ga0068867_100163313 3300005459 Bacteria 1758
178 Ga0068867_100512027 3300005459 Bacteria 1033
179 Ga0068867_100580038 3300005459 Bacteria 975
180 Ga0068867_101319548 3300005459 Archaea 667
181 Ga0068867_101459412 3300005459 Unclassified 636
182 Ga0070685_10523763 3300005466 Bacteria 842
183 Ga0070685_11257714 3300005466 Unclassified 564
184 Ga0070685_11294069 3300005466 Bacteria 557
185 Ga0070707_100177536 3300005468 Bacteria 2076
186 Ga0070707_100182523 3300005468 Bacteria 2046
187 Ga0070698_100047613 3300005471 Bacteria 4382
188 Ga0070698_100329574 3300005471 Bacteria 1458
189 Ga0070698_100458203 3300005471 Unclassified 1211
190 Ga0070699_100002298 3300005518 Bacteria 17202
191 Ga0070699_100181189 3300005518 Bacteria 1869
192 Ga0070699_100220060 3300005518 Bacteria 1692
193 Ga0070699_100463047 3300005518 Bacteria 1150
194 Ga0070699_100521705 3300005518 Bacteria 1080
195 Ga0070679_100795251 3300005530 Bacteria 889
196 Ga0070679_101079940 3300005530 Bacteria 747
197 Ga0070684_100205443 3300005535 Bacteria 1795
198 Ga0070684_101315427 3300005535 Bacteria 680
199 Ga0070684_101438109 3300005535 Unclassified 649
200 Ga0070697_100152879 3300005536 Bacteria 1946
201 Ga0070697_100552502 3300005536 Unclassified 1010
202 Ga0070697_100590928 3300005536 Unclassified 975
203 Ga0070697_101035731 3300005536 Bacteria 730
204 Ga0068853_101545535 3300005539 Bacteria 643
205 Ga0070672_100014870 3300005543 Bacteria 5525
206 Ga0070672_100066226 3300005543 Bacteria 2860
207 Ga0070672_100078828 3300005543 Bacteria 2636
208 Ga0070672_100134439 3300005543 Unclassified 2036
209 Ga0070672_100258503 3300005543 Unclassified 1468
210 Ga0070672_100902142 3300005543 Bacteria 781
211 Ga0070686_100005406 3300005544 Bacteria 7073
212 Ga0070686_100126426 3300005544 Bacteria 1762
213 Ga0070686_100164530 3300005544 Bacteria 1565
214 Ga0070695_100000425 3300005545 Bacteria 21837
215 Ga0070695_100549752 3300005545 Bacteria 900
216 Ga0070695_100744111 3300005545 Unclassified 781
217 Ga0070696_100008088 3300005546 Bacteria 7028
218 Ga0070696_100093207 3300005546 Bacteria 2147
219 Ga0070696_100093556 3300005546 Bacteria 2144
220 Ga0070665_100063029 3300005548 Bacteria 3717
221 Ga0070704_100002260 3300005549 Bacteria 10750
222 Ga0070704_100002570 3300005549 Bacteria 10234
223 Ga0070704_100128184 3300005549 Bacteria 1962
224 Ga0070704_100184255 3300005549 Bacteria 1673
225 Ga0070704_100855012 3300005549 Unclassified 816
226 Ga0070664_100044718 3300005564 Bacteria 3739
227 Ga0070664_100052952 3300005564 Bacteria 3439
228 Ga0070664_100162791 3300005564 Bacteria 1975
229 Ga0070664_100403114 3300005564 Bacteria 1251
230 Ga0070664_100410841 3300005564 Bacteria 1239
231 Ga0070664_101347338 3300005564 Bacteria 674
232 Ga0070664_102294566 3300005564 Bacteria 512
233 Ga0068857_100164472 3300005577 Bacteria 2014
234 Ga0068857_100270782 3300005577 Bacteria 1561
235 Ga0068857_100363994 3300005577 Bacteria 1341
236 Ga0068854_101606235 3300005578 Archaea 593
237 Ga0070702_100054578 3300005615 Bacteria 2300
238 Ga0070702_100604312 3300005615 Unclassified 823
239 Ga0070702_100617564 3300005615 Unclassified 815
240 Ga0070702_100949974 3300005615 Bacteria 677
241 Ga0068852_100955304 3300005616 Unclassified 875
242 Ga0068852_101595063 3300005616 Bacteria 675
243 Ga0068852_101730433 3300005616 Archaea 648
244 Ga0068859_100002071 3300005617 Bacteria 20473
245 Ga0068859_100002533 3300005617 Bacteria 18549
246 Ga0068859_100022922 3300005617 Bacteria 6260
247 Ga0068859_100069602 3300005617 Unclassified 3554
248 Ga0068859_100185587 3300005617 Unclassified 2163
249 Ga0068859_101290359 3300005617 Bacteria 805
250 Ga0068859_102563362 3300005617 Unclassified 561
251 Ga0068864_100043267 3300005618 Bacteria 3856
252 Ga0068864_100067309 3300005618 Bacteria 3110
253 Ga0068864_100369486 3300005618 Bacteria 1357
254 Ga0068864_100431660 3300005618 Bacteria 1257
255 Ga0068864_100499665 3300005618 Bacteria 1170
256 Ga0068864_100586708 3300005618 Bacteria 1080
257 Ga0068866_10447546 3300005718 Bacteria 844
258 Ga0068866_11108478 3300005718 Bacteria 567
259 Ga0068861_100001293 3300005719 Bacteria 15634
260 Ga0068861_101108998 3300005719 Bacteria 761
261 Ga0068851_10849134 3300005834 Archaea 570
262 Ga0068870_10008632 3300005840 Bacteria 4593
263 Ga0068870_10014068 3300005840 Bacteria 3773
264 Ga0068870_10017998 3300005840 Bacteria 3404
265 Ga0068870_10026411 3300005840 Bacteria 2895
266 Ga0068870_10314003 3300005840 Unclassified 993
267 Ga0068870_10456817 3300005840 Unclassified 843
268 Ga0068870_10752093 3300005840 Bacteria 677
269 Ga0068863_100019665 3300005841 Bacteria 6459
270 Ga0068863_100186579 3300005841 Bacteria 1992
271 Ga0068863_100751413 3300005841 Unclassified 971
272 Ga0068863_100948241 3300005841 Bacteria 862
273 Ga0068858_100015339 3300005842 Bacteria 7208
274 Ga0068858_100052144 3300005842 Bacteria 3784
275 Ga0068858_100094724 3300005842 Bacteria 2781
276 Ga0068858_100585933 3300005842 Bacteria 1081
277 Ga0068860_100006114 3300005843 Bacteria 12108
278 Ga0068860_100038938 3300005843 Bacteria 4548
279 Ga0068860_101260478 3300005843 Unclassified 760
280 Ga0068862_100001293 3300005844 Bacteria 23404
281 Ga0068862_100004501 3300005844 Bacteria 11752
282 Ga0068862_100345180 3300005844 Bacteria 1380
283 Ga0068862_100580042 3300005844 Bacteria 1074
284 Ga0068862_100698178 3300005844 Bacteria 983
285 Ga0068862_100717161 3300005844 Bacteria 970
286 Ga0068862_101781073 3300005844 Unclassified 625
287 Ga0081539_10000013 3300005985 Bacteria 432395
288 Ga0081539_10000164 3300005985 Bacteria 154639
289 Ga0081539_10013539 3300005985 Bacteria 6136
290 Ga0081539_10058268 3300005985 Bacteria 2132
291 Ga0075432_10061975 3300006058 Bacteria 1333
292 Ga0075432_10088489 3300006058 Bacteria 1131
293 Ga0070712_101446797 3300006175 Unclassified 600
294 Ga0097621_100092943 3300006237 Bacteria 2527
295 Ga0097621_100255420 3300006237 Bacteria 1536
296 Ga0097621_100309097 3300006237 Bacteria 1398
297 Ga0097621_100995095 3300006237 Unclassified 784
298 Ga0068871_100065374 3300006358 Bacteria 2979
299 Ga0068871_100192405 3300006358 Bacteria 1758
300 Ga0068871_100218569 3300006358 Bacteria 1650
301 Ga0068871_100230976 3300006358 Unclassified 1606
302 Ga0068871_101280608 3300006358 Bacteria 689
303 Ga0075428_100000869 3300006844 Bacteria 31758
304 Ga0075428_100026891 3300006844 Bacteria 6371
305 Ga0075428_100038755 3300006844 Bacteria 5244
306 Ga0075428_100169423 3300006844 Unclassified 2368
307 Ga0075428_100181984 3300006844 Bacteria 2274
308 Ga0075428_100192975 3300006844 Bacteria 2203
309 Ga0075428_100234100 3300006844 Bacteria 1982
310 Ga0075428_100572935 3300006844 Bacteria 1206
311 Ga0075428_100884459 3300006844 Bacteria 948
312 Ga0075428_101247363 3300006844 Bacteria 783
313 Ga0075428_101818621 3300006844 Unclassified 634
314 Ga0075430_100005569 3300006846 Bacteria 10638
315 Ga0075430_100010153 3300006846 Bacteria 7971
316 Ga0075430_100015622 3300006846 Bacteria 6465
317 Ga0075430_100114945 3300006846 Bacteria 2242
318 Ga0075430_100164103 3300006846 Bacteria 1849
319 Ga0075430_100225283 3300006846 Bacteria 1555
320 Ga0075430_100569743 3300006846 Bacteria 934
321 Ga0075431_100000533 3300006847 Bacteria 31908
322 Ga0075431_100058743 3300006847 Bacteria 3969
323 Ga0075431_100117491 3300006847 Bacteria 2745
324 Ga0075431_100117777 3300006847 Bacteria 2741
325 Ga0075431_100455459 3300006847 Bacteria 1274
326 Ga0075431_100809648 3300006847 Bacteria 910
327 Ga0075433_10014616 3300006852 Bacteria 6418
328 Ga0075433_10030688 3300006852 Bacteria 4588
329 Ga0075433_10036407 3300006852 Bacteria 4239
330 Ga0075433_10053367 3300006852 Bacteria 3524
331 Ga0075433_10054073 3300006852 Bacteria 3502
332 Ga0075433_10183185 3300006852 Bacteria 1863
333 Ga0075433_10227894 3300006852 Bacteria 1655
334 Ga0075434_100008828 3300006871 Bacteria 9381
335 Ga0075434_100054222 3300006871 Bacteria 3984
336 Ga0075434_100098176 3300006871 Unclassified 2934
337 Ga0075434_100107712 3300006871 Bacteria 2797
338 Ga0075434_100268093 3300006871 Bacteria 1727
339 Ga0075434_101096201 3300006871 Unclassified 809
340 Ga0075429_100038051 3300006880 Bacteria 4187
341 Ga0075429_100044382 3300006880 Bacteria 3867
342 Ga0075429_100062109 3300006880 Bacteria 3255
343 Ga0075429_100380944 3300006880 Bacteria 1235
344 Ga0075429_100391003 3300006880 Bacteria 1218
345 Ga0068865_100150804 3300006881 Bacteria 1763
346 Ga0068865_100297666 3300006881 Bacteria 1290
347 Ga0068865_100338176 3300006881 Bacteria 1216
348 Ga0068865_100855738 3300006881 Unclassified 788
349 Ga0068865_100978026 3300006881 Bacteria 740
350 Ga0068865_101042451 3300006881 Unclassified 718
351 Ga0097620_100002071 3300006931 Bacteria 20473
352 Ga0097620_100002533 3300006931 Bacteria 18549
353 Ga0097620_100022927 3300006931 Bacteria 6260
354 Ga0097620_100069604 3300006931 Unclassified 3554
355 Ga0097620_100185599 3300006931 Unclassified 2163
356 Ga0097620_101290289 3300006931 Bacteria 805
357 Ga0097620_102562974 3300006931 Unclassified 561
358 Ga0075435_100005714 3300007076 Bacteria 8719
359 Ga0075435_100060230 3300007076 Bacteria 3078
360 Ga0075435_100637741 3300007076 Bacteria 924
361 Ga0111539_10000044 3300009094 Bacteria 125347
362 Ga0111539_10000769 3300009094 Bacteria 41797
363 Ga0111539_10001774 3300009094 Bacteria 28680
364 Ga0111539_10010913 3300009094 Bacteria 11433
365 Ga0111539_10022455 3300009094 Bacteria 7752
366 Ga0111539_10026374 3300009094 Bacteria 7105
367 Ga0111539_10139223 3300009094 Bacteria 2842
368 Ga0111539_10360069 3300009094 Bacteria 1693
369 Ga0111539_10419078 3300009094 Bacteria 1559
370 Ga0111539_10516430 3300009094 Unclassified 1391
371 Ga0111539_10654940 3300009094 Bacteria 1223
372 Ga0111539_10915013 3300009094 Bacteria 1020
373 Ga0111539_10926144 3300009094 Bacteria 1013
374 Ga0111539_11208015 3300009094 Unclassified 878
375 Ga0111539_12329190 3300009094 Bacteria 621
376 Ga0111539_12498185 3300009094 Unclassified 599
377 Ga0111539_13317903 3300009094 Unclassified 518
378 Ga0105245_10457378 3300009098 Bacteria 1286
379 Ga0114129_10003276 3300009147 Bacteria 22724
380 Ga0114129_10006054 3300009147 Bacteria 17152
381 Ga0114129_10008048 3300009147 Bacteria 15021
382 Ga0114129_10074700 3300009147 Bacteria 4722
383 Ga0114129_10088180 3300009147 Bacteria 4302
384 Ga0114129_10109324 3300009147 Bacteria 3817
385 Ga0114129_10113438 3300009147 Bacteria 3737
386 Ga0114129_10431633 3300009147 Bacteria 1731
387 Ga0114129_10610543 3300009147 Bacteria 1412
388 Ga0114129_10641114 3300009147 Bacteria 1372
389 Ga0114129_11204322 3300009147 Bacteria 943
390 Ga0114129_11329002 3300009147 Bacteria 890
391 Ga0114129_11330908 3300009147 Bacteria 889
392 Ga0114129_11365552 3300009147 Archaea 876
393 Ga0114129_12868545 3300009147 Unclassified 571
394 Ga0105243_10039279 3300009148 Bacteria 3688
395 Ga0105243_10281598 3300009148 Bacteria 1498
396 Ga0105243_11884064 3300009148 Bacteria 630
397 Ga0105242_10246359 3300009176 Bacteria 1608
398 Ga0105242_10467408 3300009176 Bacteria 1192
399 Ga0105242_10611704 3300009176 Bacteria 1054
400 Ga0105248_10076791 3300009177 Bacteria 3754
401 Ga0105248_10089923 3300009177 Bacteria 3457
402 Ga0105248_10158064 3300009177 Bacteria 2558
403 Ga0105249_10001334 3300009553 Bacteria 21606
404 Ga0105249_10133236 3300009553 Bacteria 2375
405 Ga0105249_10170129 3300009553 Bacteria 2112
406 Ga0105249_11948953 3300009553 Bacteria 660
407 Ga0105246_10095338 3300011119 Bacteria 2154
408 Ga0105246_10214474 3300011119 Bacteria 1505
409 Ga0105246_10827539 3300011119 Bacteria 824
410 Ga0105246_10905180 3300011119 Bacteria 791
411 Ga0157346_1019322 3300012480 Unclassified 581
412 Ga0157323_1007328 3300012495 Unclassified 793
413 Ga0157373_10981274 3300013100 Bacteria 630
414 Ga0157374_10037760 3300013296 Bacteria 4435
415 Ga0157374_10199239 3300013296 Bacteria 1960
416 Ga0157374_10321343 3300013296 Unclassified 1534
417 Ga0157378_10059392 3300013297 Bacteria 3412
418 Ga0157378_10089613 3300013297 Bacteria 2794
419 Ga0157378_10372797 3300013297 Bacteria 1400
420 Ga0163162_10016085 3300013306 Bacteria 7313
421 Ga0163162_10589379 3300013306 Bacteria 1238
422 Ga0163162_10912523 3300013306 Bacteria 991
423 Ga0157375_10009638 3300013308 Bacteria 8487
424 Ga0157375_10027823 3300013308 Bacteria 5290
425 Ga0157375_10304445 3300013308 Bacteria 1758
426 Ga0157375_10370261 3300013308 Bacteria 1599
427 Ga0163163_10017755 3300014325 Bacteria 6641
428 Ga0163163_10255424 3300014325 Bacteria 1803
429 Ga0163163_10513067 3300014325 Unclassified 1261
430 Ga0157380_10005619 3300014326 Bacteria 8764
431 Ga0157380_10021207 3300014326 Bacteria 4870
432 Ga0157380_10204245 3300014326 Bacteria 1755
433 Ga0157380_10700305 3300014326 Bacteria 1018
434 Ga0157380_10757404 3300014326 Bacteria 983
435 Ga0157380_11914128 3300014326 Unclassified 654
436 Ga0157377_10002991 3300014745 Bacteria 7572
437 Ga0157377_10034044 3300014745 Bacteria 2785
438 Ga0157377_10048960 3300014745 Bacteria 2374
439 Ga0157377_10078417 3300014745 Bacteria 1925
440 Ga0157377_10140301 3300014745 Bacteria 1485
441 Ga0157377_10681957 3300014745 Bacteria 744
442 Ga0157377_11044006 3300014745 Bacteria 622
443 Ga0157377_11316128 3300014745 Bacteria 566
444 Ga0157379_10003739 3300014968 Bacteria 12939
445 Ga0157379_10087853 3300014968 Bacteria 2787
446 Ga0157376_10068589 3300014969 Bacteria 3004
447 Ga0157376_10310734 3300014969 Bacteria 1495
448 Ga0157376_10927609 3300014969 Bacteria 890
449 Ga0157376_11247253 3300014969 Bacteria 772
450 Ga0157376_11523918 3300014969 Unclassified 702
451 Ga0157376_11528060 3300014969 Unclassified 701
452 Ga0163161_10011766 3300017792 Bacteria 6067
453 Ga0163161_10478577 3300017792 Unclassified 1011
454 Ga0163161_10552852 3300017792 Unclassified 944
455 Ga0163161_10553520 3300017792 Bacteria 943
456 Ga0163161_10583739 3300017792 Bacteria 919
457 Ga0163161_11582325 3300017792 Bacteria 577
458 Ga0207666_1077723 3300025271 Archaea 536
459 Ga0207673_1004738 3300025290 Unclassified 1636
460 Ga0207697_10001621 3300025315 Bacteria 12145
461 Ga0207697_10102352 3300025315 Bacteria 1221
462 Ga0207682_10001841 3300025893 Bacteria 9661
463 Ga0207682_10010257 3300025893 Bacteria 3674
464 Ga0207682_10013530 3300025893 Bacteria 3178
465 Ga0207682_10052606 3300025893 Bacteria 1688
466 Ga0207682_10593655 3300025893 Unclassified 522
467 Ga0207642_10186498 3300025899 Bacteria 1135
468 Ga0207688_10001443 3300025901 Bacteria 12425
469 Ga0207688_10059067 3300025901 Bacteria 2159
470 Ga0207688_10132575 3300025901 Bacteria 1461
471 Ga0207688_10699274 3300025901 Unclassified 641
472 Ga0207680_10018186 3300025903 Bacteria 3730
473 Ga0207680_10060337 3300025903 Unclassified 2308
474 Ga0207647_10047580 3300025904 Bacteria 2667
475 Ga0207645_10001881 3300025907 Bacteria 16948
476 Ga0207645_10217224 3300025907 Bacteria 1260
477 Ga0207645_10245118 3300025907 Bacteria 1184
478 Ga0207645_10266359 3300025907 Bacteria 1136
479 Ga0207645_10529058 3300025907 Unclassified 799
480 Ga0207643_10004144 3300025908 Bacteria 7810
481 Ga0207643_10005748 3300025908 Bacteria 6631
482 Ga0207643_10053082 3300025908 Bacteria 2302
483 Ga0207643_10053648 3300025908 Bacteria 2290
484 Ga0207643_10076499 3300025908 Bacteria 1933
485 Ga0207643_10234149 3300025908 Unclassified 1127
486 Ga0207643_10605897 3300025908 Bacteria 705
487 Ga0207705_10224675 3300025909 Bacteria 1427
488 Ga0207684_10115149 3300025910 Bacteria 2302
489 Ga0207707_10084480 3300025912 Bacteria 2772
490 Ga0207693_10434261 3300025915 Bacteria 1026
491 Ga0207660_10129706 3300025917 Bacteria 1918
492 Ga0207660_10199381 3300025917 Bacteria 1563
493 Ga0207660_10513750 3300025917 Unclassified 972
494 Ga0207660_10725343 3300025917 Bacteria 811
495 Ga0207662_10002054 3300025918 Bacteria 9973
496 Ga0207662_10004271 3300025918 Bacteria 7500
497 Ga0207662_10028524 3300025918 Bacteria 3228
498 Ga0207662_10129801 3300025918 Bacteria 1588
499 Ga0207657_10899733 3300025919 Unclassified 682
500 Ga0207649_10023217 3300025920 Bacteria 3590
501 Ga0207649_10267003 3300025920 Bacteria 1239
502 Ga0207649_10466101 3300025920 Bacteria 956
503 Ga0207649_11297535 3300025920 Unclassified 576
504 Ga0207652_10701069 3300025921 Unclassified 903
505 Ga0207652_10750787 3300025921 Bacteria 868
506 Ga0207646_10020399 3300025922 Bacteria 6142
507 Ga0207646_10166267 3300025922 Bacteria 1991
508 Ga0207646_10177495 3300025922 Bacteria 1924
509 Ga0207646_10231923 3300025922 Bacteria 1668
510 Ga0207646_10270986 3300025922 Bacteria 1534
511 Ga0207681_10000566 3300025923 Bacteria 25276
512 Ga0207681_10077568 3300025923 Bacteria 2336
513 Ga0207681_10088862 3300025923 Bacteria 2201
514 Ga0207681_10210141 3300025923 Bacteria 1499
515 Ga0207681_10542263 3300025923 Unclassified 956
516 Ga0207650_10037192 3300025925 Bacteria 3546
517 Ga0207650_10126129 3300025925 Bacteria 1998
518 Ga0207650_10148492 3300025925 Bacteria 1848
519 Ga0207650_10182355 3300025925 Bacteria 1673
520 Ga0207650_10273829 3300025925 Bacteria 1373
521 Ga0207650_10437743 3300025925 Bacteria 1087
522 Ga0207650_10569237 3300025925 Bacteria 951
523 Ga0207650_11065203 3300025925 Bacteria 688
524 Ga0207650_11118654 3300025925 Bacteria 670
525 Ga0207659_10001222 3300025926 Bacteria 15363
526 Ga0207659_10002242 3300025926 Bacteria 11514
527 Ga0207659_10004787 3300025926 Bacteria 8206
528 Ga0207659_10007569 3300025926 Bacteria 6690
529 Ga0207659_10027161 3300025926 Bacteria 3871
530 Ga0207659_10032972 3300025926 Bacteria 3559
531 Ga0207659_10048877 3300025926 Bacteria 2998
532 Ga0207659_10071033 3300025926 Bacteria 2541
533 Ga0207659_10402165 3300025926 Unclassified 1146
534 Ga0207659_10510909 3300025926 Bacteria 1018
535 Ga0207687_10849320 3300025927 Archaea 780
536 Ga0207644_10154004 3300025931 Bacteria 1781
537 Ga0207644_10748292 3300025931 Bacteria 816
538 Ga0207644_10882921 3300025931 Unclassified 749
539 Ga0207690_10165282 3300025932 Bacteria 1653
540 Ga0207690_10184925 3300025932 Bacteria 1572
541 Ga0207690_10250642 3300025932 Bacteria 1368
542 Ga0207706_10003425 3300025933 Bacteria 15142
543 Ga0207706_10037583 3300025933 Bacteria 4298
544 Ga0207706_10057657 3300025933 Bacteria 3421
545 Ga0207706_10146880 3300025933 Bacteria 2074
546 Ga0207706_10336125 3300025933 Bacteria 1314
547 Ga0207706_10766219 3300025933 Unclassified 821
548 Ga0207706_10833559 3300025933 Bacteria 782
549 Ga0207686_10113634 3300025934 Bacteria 1831
550 Ga0207686_10552084 3300025934 Bacteria 901
551 Ga0207686_10822442 3300025934 Bacteria 746
552 Ga0207709_10161212 3300025935 Bacteria 1564
553 Ga0207670_10003736 3300025936 Bacteria 8086
554 Ga0207670_10006525 3300025936 Bacteria 6477
555 Ga0207670_10362549 3300025936 Bacteria 1150
556 Ga0207669_10001529 3300025937 Bacteria 9860
557 Ga0207669_10428381 3300025937 Bacteria 1043
558 Ga0207669_10833780 3300025937 Bacteria 766
559 Ga0207669_11139124 3300025937 Unclassified 659
560 Ga0207704_10053194 3300025938 Bacteria 2459
561 Ga0207704_11537265 3300025938 Bacteria 571
562 Ga0207691_10012691 3300025940 Bacteria 8070
563 Ga0207691_10050039 3300025940 Bacteria 3826
564 Ga0207691_10055581 3300025940 Bacteria 3607
565 Ga0207691_10085089 3300025940 Bacteria 2838
566 Ga0207691_10088306 3300025940 Bacteria 2780
567 Ga0207691_10180664 3300025940 Bacteria 1844
568 Ga0207691_10256872 3300025940 Unclassified 1507
569 Ga0207691_10365531 3300025940 Bacteria 1233
570 Ga0207691_10817532 3300025940 Bacteria 782
571 Ga0207711_10083185 3300025941 Bacteria 2799
572 Ga0207711_10169955 3300025941 Unclassified 1978
573 Ga0207711_10242585 3300025941 Bacteria 1652
574 Ga0207689_10000831 3300025942 Bacteria 29759
575 Ga0207689_10048175 3300025942 Bacteria 3515
576 Ga0207689_10084887 3300025942 Bacteria 2603
577 Ga0207661_10028828 3300025944 Bacteria 4256
578 Ga0207679_10029892 3300025945 Bacteria 3798
579 Ga0207679_10082888 3300025945 Bacteria 2456
580 Ga0207679_10294889 3300025945 Bacteria 1395
581 Ga0207679_10586087 3300025945 Bacteria 1003
582 Ga0207679_10757637 3300025945 Bacteria 883
583 Ga0207679_11454145 3300025945 Bacteria 629
584 Ga0207651_10025082 3300025960 Bacteria 3701
585 Ga0207651_10096190 3300025960 Bacteria 2183
586 Ga0207651_10125337 3300025960 Bacteria 1956
587 Ga0207651_10180642 3300025960 Bacteria 1673
588 Ga0207651_10244533 3300025960 Bacteria 1464
589 Ga0207651_10380877 3300025960 Bacteria 1195
590 Ga0207651_10622228 3300025960 Bacteria 946
591 Ga0207651_10709019 3300025960 Bacteria 887
592 Ga0207712_10002418 3300025961 Bacteria 12069
593 Ga0207712_10464140 3300025961 Bacteria 1076
594 Ga0207668_10118148 3300025972 Bacteria 2003
595 Ga0207668_10150849 3300025972 Bacteria 1799
596 Ga0207668_10159885 3300025972 Bacteria 1754
597 Ga0207668_10269874 3300025972 Bacteria 1390
598 Ga0207668_11030614 3300025972 Bacteria 736
599 Ga0207640_10067322 3300025981 Bacteria 2396
600 Ga0207640_10250656 3300025981 Bacteria 1374
601 Ga0207640_11766552 3300025981 Unclassified 559
602 Ga0207640_12203733 3300025981 Unclassified 500
603 Ga0207658_10012438 3300025986 Bacteria 5814
604 Ga0207658_10346730 3300025986 Bacteria 1292
605 Ga0207658_11138384 3300025986 Unclassified 713
606 Ga0207658_11145954 3300025986 Unclassified 711
607 Ga0207677_10063258 3300026023 Bacteria 2571
608 Ga0207677_10145249 3300026023 Bacteria 1822
609 Ga0207677_10603857 3300026023 Unclassified 963
610 Ga0207703_10042317 3300026035 Bacteria 3654
611 Ga0207703_10141518 3300026035 Bacteria 2088
612 Ga0207703_10289415 3300026035 Unclassified 1490
613 Ga0207703_10472240 3300026035 Bacteria 1174
614 Ga0207639_11705257 3300026041 Bacteria 590
615 Ga0207708_10017222 3300026075 Bacteria 5439
616 Ga0207708_10095321 3300026075 Bacteria 2298
617 Ga0207708_10159192 3300026075 Bacteria 1782
618 Ga0207708_10269838 3300026075 Bacteria 1376
619 Ga0207708_11023236 3300026075 Bacteria 718
620 Ga0207641_10097682 3300026088 Bacteria 2582
621 Ga0207641_10105045 3300026088 Bacteria 2494
622 Ga0207641_10792093 3300026088 Bacteria 937
623 Ga0207641_11460006 3300026088 Bacteria 685
624 Ga0207641_11546920 3300026088 Unclassified 665
625 Ga0207648_10000446 3300026089 Bacteria 45706
626 Ga0207648_10046637 3300026089 Bacteria 3800
627 Ga0207648_10062997 3300026089 Unclassified 3232
628 Ga0207648_10410519 3300026089 Bacteria 1228
629 Ga0207648_10474768 3300026089 Unclassified 1141
630 Ga0207648_10708929 3300026089 Unclassified 933
631 Ga0207648_11114991 3300026089 Bacteria 740
632 Ga0207676_10010914 3300026095 Bacteria 6481
633 Ga0207676_10026175 3300026095 Bacteria 4337
634 Ga0207676_10306404 3300026095 Bacteria 1452
635 Ga0207676_11021163 3300026095 Bacteria 815
636 Ga0207676_11105762 3300026095 Bacteria 784
637 Ga0207674_10176364 3300026116 Bacteria 2089
638 Ga0207674_10185565 3300026116 Bacteria 2030
639 Ga0207674_10465004 3300026116 Bacteria 1223
640 Ga0207674_10633889 3300026116 Bacteria 1032
641 Ga0207674_11192251 3300026116 Archaea 731
642 Ga0207674_11281744 3300026116 Unclassified 702
643 Ga0207675_100001058 3300026118 Bacteria 27297
644 Ga0207675_100004015 3300026118 Bacteria 14272
645 Ga0207675_100094653 3300026118 Unclassified 2810
646 Ga0207675_100770580 3300026118 Bacteria 974
647 Ga0207675_100794938 3300026118 Unclassified 959
648 Ga0207675_101820305 3300026118 Bacteria 628
649 Ga0207683_10021244 3300026121 Bacteria 5554
650 Ga0207683_10128891 3300026121 Unclassified 2275
651 Ga0207683_10135522 3300026121 Bacteria 2216
652 Ga0207683_10451795 3300026121 Bacteria 1185
653 Ga0207683_10624160 3300026121 Bacteria 998
654 Ga0207683_10670690 3300026121 Unclassified 961
655 Ga0207683_10808344 3300026121 Bacteria 870
656 Ga0207683_10814772 3300026121 Bacteria 867
657 Ga0207698_10509518 3300026142 Unclassified 1172
658 Ga0209968_1053945 3300027526 Unclassified 702
659 Ga0210002_1084402 3300027617 Bacteria 567
660 Ga0207428_10000224 3300027907 Bacteria 78533
661 Ga0207428_10000353 3300027907 Bacteria 59325
662 Ga0207428_10004706 3300027907 Bacteria 12908
663 Ga0207428_10005989 3300027907 Bacteria 11257
664 Ga0207428_10010077 3300027907 Bacteria 8459
665 Ga0207428_10304822 3300027907 Bacteria 1178
666 Ga0207428_10465962 3300027907 Bacteria 920
667 Ga0268266_10312547 3300028379 Bacteria 1469
668 Ga0268265_10000540 3300028380 Bacteria 38471
669 Ga0268265_10055567 3300028380 Bacteria 3008
670 Ga0268265_10374861 3300028380 Bacteria 1307
671 Ga0268265_10622631 3300028380 Bacteria 1034
672 Ga0268265_10913339 3300028380 Bacteria 863
673 Ga0268265_11372760 3300028380 Unclassified 708
674 Ga0268265_12172198 3300028380 Unclassified 562
675 Ga0268264_10012807 3300028381 Bacteria 6902
676 Ga0268264_10115573 3300028381 Bacteria 2357
677 Ga0268264_10879495 3300028381 Unclassified 898
678 Ga0268264_11413075 3300028381 Unclassified 706
679 Ga0307408_100364100 3300031548 Unclassified 1231
680 Ga0307408_100388393 3300031548 Bacteria 1195
681 Ga0307408_101045124 3300031548 Unclassified 755
682 Ga0307405_10003692 3300031731 Bacteria 7100
683 Ga0307405_10091958 3300031731 Bacteria 2011
684 Ga0307405_10751537 3300031731 Unclassified 812
685 Ga0307413_10045918 3300031824 Bacteria 2593
686 Ga0307413_10140375 3300031824 Bacteria 1669
687 Ga0307413_11234604 3300031824 Unclassified 651
688 Ga0307413_11805844 3300031824 Unclassified 547
689 Ga0307410_10005392 3300031852 Bacteria 6761
690 Ga0307410_10123448 3300031852 Bacteria 1892
691 Ga0307410_10141882 3300031852 Bacteria 1778
692 Ga0307410_11728725 3300031852 Bacteria 555
693 Ga0307406_10041702 3300031901 Bacteria 2861
694 Ga0307406_11405123 3300031901 Bacteria 612
695 Ga0307407_10004637 3300031903 Bacteria 5864
696 Ga0307407_10060573 3300031903 Bacteria 2209
697 Ga0307407_10968281 3300031903 Bacteria 656
698 Ga0307412_10009853 3300031911 Bacteria 5490
699 Ga0307412_10083761 3300031911 Bacteria 2212
700 Ga0307412_10671720 3300031911 Bacteria 886
701 Ga0307412_10934579 3300031911 Bacteria 762
702 Ga0307409_100004850 3300031995 Bacteria 7639
703 Ga0307409_100018258 3300031995 Bacteria 4708
704 Ga0307409_100104257 3300031995 Bacteria 2361
705 Ga0307409_100115339 3300031995 Bacteria 2261
706 Ga0307409_100147164 3300031995 Bacteria 2039
707 Ga0307409_100334185 3300031995 Bacteria 1423
708 Ga0307409_100927127 3300031995 Bacteria 886
709 Ga0307416_100004482 3300032002 Bacteria 8423
710 Ga0307416_100012439 3300032002 Bacteria 5733
711 Ga0307416_100072394 3300032002 Bacteria 2868
712 Ga0307416_100119105 3300032002 Bacteria 2348
713 Ga0307416_100290128 3300032002 Bacteria 1619
714 Ga0307416_100530497 3300032002 Bacteria 1247
715 Ga0307416_100791711 3300032002 Bacteria 1043
716 Ga0307416_101584211 3300032002 Unclassified 760
717 Ga0307416_101974363 3300032002 Bacteria 686
718 Ga0307416_102130950 3300032002 Unclassified 662
719 Ga0307416_102784627 3300032002 Unclassified 585
720 Ga0307416_103018112 3300032002 Unclassified 563
721 Ga0307416_103157408 3300032002 Unclassified 551
722 Ga0307414_10366728 3300032004 Bacteria 1241
723 Ga0307414_10418639 3300032004 Bacteria 1168
724 Ga0307414_10549306 3300032004 Bacteria 1029
725 Ga0307411_10003247 3300032005 Bacteria 7497
726 Ga0307411_10029786 3300032005 Bacteria 3339
727 Ga0307411_10819408 3300032005 Bacteria 821
728 Ga0307411_12312917 3300032005 Bacteria 505
729 Ga0307415_100007237 3300032126 Bacteria 6058
730 Ga0307415_100068095 3300032126 Unclassified 2490
731 Ga0307415_100134002 3300032126 Bacteria 1880
732 Ga0307415_101561037 3300032126 Unclassified 633
733 Ga0373958_0149005 3300034819 Archaea 584
734 Ga0373940_0089324 3300035088 Bacteria 921
735 Ga0373939_0279073 3300035114 Unclassified 659
736 Ga0373941_0201517 3300035115 Unclassified 757
737 Ga0373941_0428774 3300035115 Archaea 551
738 Ga0373961_0222983 3300035241 Unclassified 673
739 Ga0242420_143832 3300038996 Unclassified 532
740 Ga0451853_1692674 3300041512 Unclassified 774
741 Ga0451853_3527350 3300041512 Unclassified 983
742 Ga0439442_126911 3300042002 Unclassified 560
743 Ga0439454_116389 3300042011 Archaea 514
744 Ga0439434_0071318 3300042435 Bacteria 1094
745 Ga0439444_0009088 3300042437 Bacteria 1560
746 Ga0439460_0244470 3300042461 Bacteria 619
747 Ga0451577_0607601 3300042876 Bacteria 992
748 Ga0439440_0104320 3300042993 Bacteria 774
749 Ga0451576_0007819 3300045051 Bacteria 12670
750 Ga0451576_0013731 3300045051 Bacteria 9047
751 Ga0451576_0067399 3300045051 Bacteria 3726
752 Ga0451576_0079338 3300045051 Bacteria 3415
753 Ga0451576_0186928 3300045051 Bacteria 2163
754 Ga0451576_0705066 3300045051 Bacteria 1060
755 Ga0495603_0188771 3300046455 Bacteria 1192
756 Ga0495629_0057974 3300046459 Bacteria 2707
757 Ga0495580_0339705 3300046472 Bacteria 1019
758 Ga0495580_0532991 3300046472 Bacteria 781
759 Ga0495585_0147225 3300046492 Unclassified 1230
760 Ga0495594_0028254 3300046499 Bacteria 3026
761 Ga0495643_0001548 3300046522 Bacteria 20538
762 Ga0495644_0019673 3300046523 Bacteria 2578
763 Ga0495642_0046137 3300046528 Bacteria 1782
764 Ga0495642_0048601 3300046528 Bacteria 1741
765 Ga0495598_0240921 3300046537 Bacteria 667
766 Ga0495598_0383849 3300046537 Bacteria 546
767 Ga0495609_0147241 3300046538 Bacteria 1003
768 Ga0495621_0015340 3300046539 Bacteria 2442
769 Ga0495621_0107764 3300046539 Bacteria 1066
770 Ga0495621_0177265 3300046539 Unclassified 849
771 Ga0495656_0059120 3300046615 Bacteria 1666
772 Ga0495659_0003442 3300046664 Bacteria 5051
773 Ga0495659_0013145 3300046664 Bacteria 2693
774 Ga0495659_0190341 3300046664 Unclassified 838
775 Ga0495659_0308799 3300046664 Unclassified 669
776 Ga0495659_0348468 3300046664 Unclassified 632
777 Ga0495588_0024382 3300046674 Bacteria 3005
778 Ga0495658_0097707 3300046683 Bacteria 1748
779 Ga0495669_0462621 3300046684 Bacteria 616
780 Ga0495670_0118046 3300046691 Bacteria 1377
781 Ga0495670_0173556 3300046691 Unclassified 1136
782 Ga0495670_0483775 3300046691 Bacteria 672
783 Ga0495589_0492716 3300046794 Unclassified 560
784 Ga0495636_0063710 3300047318 Bacteria 1563
785 Ga0495677_0028335 3300047445 Bacteria 2034
786 Ga0495677_0195527 3300047445 Bacteria 786
787 Ga0496104_0815228 3300048907 Bacteria 839
788 Ga0496108_1280058 3300048911 Bacteria 617
789 Ga0496110_0387822 3300048913 Bacteria 1273
790 Ga0496112_1640137 3300048915 Unclassified 556
791 Ga0501290_071205 3300049513 Bacteria 577
792 Ga0501298_154992 3300049521 Unclassified 562
793 Ga0501031_0284762 3300049568 Unclassified 1072
794 Ga0501033_0768025 3300049570 Unclassified 653
795 Ga0501036_0315208 3300049572 Bacteria 1307
796 Ga0501036_0665359 3300049572 Unclassified 862
797 Ga0501037_0599418 3300049573 Unclassified 740
798 Ga0501037_0639497 3300049573 Unclassified 712
799 Ga0501038_0856032 3300049574 Bacteria 673
800 Ga0501038_1061858 3300049574 Unclassified 593
801 Ga0501039_0007557 3300049575 Bacteria 8303
802 Ga0501039_0056186 3300049575 Bacteria 3049
803 Ga0501039_0299496 3300049575 Bacteria 1264
804 Ga0501040_0012945 3300049576 Bacteria 5483
805 Ga0501041_0135843 3300049577 Bacteria 1532
806 Ga0501041_0227101 3300049577 Bacteria 1172
807 Ga0501042_0003889 3300049578 Bacteria 9445
808 Ga0501042_0286231 3300049578 Bacteria 1190
809 Ga0501042_0632904 3300049578 Bacteria 778
810 Ga0501043_0936479 3300049579 Unclassified 619
811 Ga0501046_0074757 3300049580 Bacteria 2628
812 Ga0501048_0035520 3300049582 Bacteria 3588
813 Ga0501048_0107006 3300049582 Bacteria 1974
814 Ga0501067_0296343 3300049583 Unclassified 900
815 Ga0501068_0368144 3300049584 Unclassified 925
816 Ga0501069_0586049 3300049585 Unclassified 669
817 Ga0501071_0821372 3300049587 Unclassified 717
818 Ga0501072_0008859 3300049588 Bacteria 7644
819 Ga0501072_0027578 3300049588 Bacteria 4430
820 Ga0501072_0205831 3300049588 Bacteria 1569
821 Ga0501072_0352631 3300049588 Bacteria 1168
822 Ga0501072_0392733 3300049588 Unclassified 1101
823 Ga0501075_0098439 3300049591 Bacteria 2220
824 Ga0501075_0156761 3300049591 Bacteria 1736
825 Ga0501075_0293114 3300049591 Bacteria 1239
826 Ga0501075_0502202 3300049591 Bacteria 925
827 Ga0501076_0009175 3300049592 Bacteria 7291
828 Ga0501076_0044775 3300049592 Bacteria 3491
829 Ga0501076_0156572 3300049592 Bacteria 1855
830 Ga0501076_0214437 3300049592 Bacteria 1574
831 Ga0501076_0311423 3300049592 Bacteria 1291
832 Ga0501076_1659100 3300049592 Bacteria 524
833 Ga0501208_041509 3300049655 Bacteria 851
834 Ga0501249_016262 3300049679 Bacteria 1597
835 Ga0501249_200628 3300049679 Unclassified 523
836 Ga0501221_137825 3300049704 Bacteria 637
837 Ga0501245_059587 3300049708 Bacteria 695
838 Ga0501079_0034154 3300049741 Bacteria 3913
839 Ga0501079_0075401 3300049741 Bacteria 2608
840 Ga0501079_0133364 3300049741 Bacteria 1933
841 Ga0501079_0445534 3300049741 Bacteria 1017
842 Ga0501079_0480084 3300049741 Bacteria 977
843 Ga0501080_0553263 3300049742 Unclassified 1025
844 Ga0501080_0994261 3300049742 Unclassified 728
845 Ga0501081_0048284 3300049743 Bacteria 2929
846 Ga0501081_0190447 3300049743 Bacteria 1485
847 Ga0501081_0224269 3300049743 Bacteria 1367
848 Ga0501081_0339545 3300049743 Bacteria 1106
849 Ga0501081_0384370 3300049743 Bacteria 1038
850 Ga0501081_0386495 3300049743 Unclassified 1035
851 Ga0501081_0625649 3300049743 Unclassified 806
852 Ga0501081_0869432 3300049743 Bacteria 679
853 Ga0501083_0641713 3300049744 Unclassified 691
854 Ga0501272_020596 3300049769 Unclassified 791
855 Ga0501283_035584 3300049779 Unclassified 848
856 Ga0501045_0024405 3300049824 Bacteria 4341
857 Ga0501045_0157688 3300049824 Unclassified 1689
858 nmdc:mga05p37_1167638_c1 3300050507 Bacteria 799
859 nmdc:mga05p37_155524_c1 3300050507 Bacteria 2795
860 nmdc:mga05p37_1654227_c1 3300050507 Unclassified 627
861 nmdc:mga05p37_1656263_c1 3300050507 Unclassified 627
862 nmdc:mga05p37_17011_c1 3300050507 Bacteria 8770
863 nmdc:mga05p37_200071_c1 3300050507 Bacteria 2420
864 nmdc:mga05p37_244730_c1 3300050507 Bacteria 2154
865 nmdc:mga05p37_395165_c1 3300050507 Bacteria 1616
866 nmdc:mga05p37_503469_c1 3300050507 Unclassified 1389
867 nmdc:mga05p37_56561_c1 3300050507 Bacteria 4830
868 nmdc:mga05p37_70703_c1 3300050507 Bacteria 4293
869 nmdc:mga05p37_974417_c1 3300050507 Bacteria 904
870 nmdc:mga09592_240558_c1 3300050508 Bacteria 1568
871 nmdc:mga09592_275748_c1 3300050508 Bacteria 1459
872 nmdc:mga09592_29049_c1 3300050508 Bacteria 4598
873 nmdc:mga09592_334982_c1 3300050508 Bacteria 1310
874 nmdc:mga09592_504093_c1 3300050508 Unclassified 1042
875 nmdc:mga09592_61109_c1 3300050508 Bacteria 3186
876 nmdc:mga09592_80073_c1 3300050508 Bacteria 2781
877 nmdc:mga0qj67_280529_c1 3300050509 Bacteria 1350
878 nmdc:mga0qj67_526_c1 3300050509 Bacteria 26048
879 nmdc:mga0qj67_5293_c1 3300050509 Bacteria 9413
880 nmdc:mga0qj67_541447_c1 3300050509 Bacteria 934
881 nmdc:mga0qj67_5798_c1 3300050509 Bacteria 9039
882 nmdc:mga06r32_107386_c1 3300050510 Bacteria 2743
883 nmdc:mga06r32_127805_c1 3300050510 Unclassified 2511
884 nmdc:mga06r32_18027_c1 3300050510 Bacteria 6456
885 nmdc:mga06r32_24815_c1 3300050510 Bacteria 5572
886 nmdc:mga06r32_310457_c1 3300050510 Bacteria 1563
887 nmdc:mga06r32_610525_c1 3300050510 Bacteria 1061
888 nmdc:mga08y16_15575_c1 3300050511 Bacteria 7995
889 nmdc:mga08y16_167360_c1 3300050511 Bacteria 2284
890 nmdc:mga08y16_168786_c1 3300050511 Bacteria 2273
891 nmdc:mga08y16_1836417_c1 3300050511 Unclassified 558
892 nmdc:mga08y16_41616_c1 3300050511 Bacteria 4813
893 nmdc:mga08y16_467911_c1 3300050511 Bacteria 1284
894 nmdc:mga08y16_575165_c1 3300050511 Bacteria 1138
895 nmdc:mga08y16_5828_c1 3300050511 Bacteria 12911
896 nmdc:mga08y16_60586_c1 3300050511 Bacteria 3953
897 nmdc:mga08y16_684391_c1 3300050511 Unclassified 1027
898 nmdc:mga08y16_945_c1 3300050511 Bacteria 28237
899 nmdc:mga08y16_958632_c1 3300050511 Bacteria 838
900 nmdc:mga08y16_979410_c1 3300050511 Bacteria 827
901 nmdc:mga0n895_1446644_c1 3300050512 Unclassified 655
902 nmdc:mga0n895_32666_c1 3300050512 Bacteria 4996
903 nmdc:mga0n895_465314_c1 3300050512 Bacteria 1276
904 nmdc:mga0n895_65768_c1 3300050512 Bacteria 3589
905 nmdc:mga0n895_809892_c1 3300050512 Unclassified 927
906 nmdc:mga0n895_88881_c1 3300050512 Bacteria 3090
907 nmdc:mga0n895_90365_c1 3300050512 Bacteria 3064
908 nmdc:mga0rr50_102607_c1 3300050513 Bacteria 2250
909 nmdc:mga0rr50_111579_c1 3300050513 Bacteria 2164
910 nmdc:mga0rr50_1506752_c1 3300050513 Bacteria 569
911 nmdc:mga0rr50_63989_c1 3300050513 Bacteria 2780
912 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
913 nmdc:mga0a205_107387_c1 3300050515 Bacteria 2689
914 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
915 nmdc:mga0a205_161479_c1 3300050515 Bacteria 2137
916 nmdc:mga0a205_422640_c1 3300050515 Unclassified 1195
917 nmdc:mga0a205_55600_c1 3300050515 Bacteria 3822
918 nmdc:mga0a205_68363_c1 3300050515 Bacteria 3431
919 nmdc:mga0a205_91795_c1 3300050515 Bacteria 2934
920 nmdc:mga0a205_94654_c1 3300050515 Bacteria 2886
921 Ga0500556_0007638 3300053104 Bacteria 3095
922 Ga0501084_0148547 3300054114 Bacteria 1975
923 Ga0501084_0250372 3300054114 Bacteria 1496
924 Ga0501084_0465655 3300054114 Unclassified 1069
925 Ga0501084_0764188 3300054114 Bacteria 814
926 Ga0590071_000198 3300059421 Bacteria 17604
927 Ga0590071_001421 3300059421 Bacteria 6337
928 Ga0590071_007060 3300059421 Bacteria 2658
929 Ga0590074_009905 3300059423 Bacteria 1591
930 Ga0590075_000275 3300059424 Bacteria 14557
931 Ga0590075_007624 3300059424 Bacteria 2576
932 Ga0590077_000049 3300059426 Bacteria 28044
933 Ga0590077_001543 3300059426 Bacteria 5322
934 Ga0501082_0010321 3300060353 Bacteria 8043
935 Ga0501082_0211640 3300060353 Bacteria 1687
936 Ga0530510_0001774 3300061734 Bacteria 14711
937 Ga0530510_0173337 3300061734 Bacteria 1598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100225283 Ga0075430_1002252832 121
2 3300006844 Ga0075428_101818621 Ga0075428_1018186212 126
3 3300049579 Ga0501043_0936479 Ga0501043_0936479_27_410 127
4 3300006844 Ga0075428_100192975 Ga0075428_1001929752 128
5 3300006058 Ga0075432_10088489 Ga0075432_100884891 129
6 3300006846 Ga0075430_100114945 Ga0075430_1001149452 129
7 3300006852 Ga0075433_10227894 Ga0075433_102278942 129
8 3300006880 Ga0075429_100044382 Ga0075429_1000443826 129
9 3300009094 Ga0111539_10001774 Ga0111539_1000177429 129
10 3300009147 Ga0114129_10074700 Ga0114129_100747006 129
11 3300009147 Ga0114129_11330908 Ga0114129_113309082 129
12 3300027907 Ga0207428_10000353 Ga0207428_1000035325 129
13 3300041512 Ga0451853_1692674 Ga0451853_1692674_24_413 129
14 3300049521 Ga0501298_154992 Ga0501298_154992_153_542 129
15 3300049679 Ga0501249_200628 Ga0501249_200628_54_443 129
16 3300049769 Ga0501272_020596 Ga0501272_020596_265_654 129
17 3300050507 nmdc:mga05p37_1167638_c1 nmdc:mga05p37_1167638_c1_109_498 129
18 3300050507 nmdc:mga05p37_155524_c1 nmdc:mga05p37_155524_c1_2374_2763 129
19 3300050511 nmdc:mga08y16_167360_c1 nmdc:mga08y16_167360_c1_1360_1749 129
20 3300050515 nmdc:mga0a205_161479_c1 nmdc:mga0a205_161479_c1_1525_1914 129
21 3300049744 Ga0501083_0641713 Ga0501083_0641713_75_473 132
22 3300004801 Ga0058860_11970884 Ga0058860_119708841 136
23 3300005290 Ga0065712_10088620 Ga0065712_100886201 136
24 3300005338 Ga0068868_101566876 Ga0068868_1015668761 136
25 3300005457 Ga0070662_100548831 Ga0070662_1005488312 136
26 3300005546 Ga0070696_100093556 Ga0070696_1000935562 136
27 3300005618 Ga0068864_100369486 Ga0068864_1003694863 136
28 3300005840 Ga0068870_10026411 Ga0068870_100264112 136
29 3300005844 Ga0068862_100698178 Ga0068862_1006981782 136
30 3300006844 Ga0075428_100884459 Ga0075428_1008844592 136
31 3300006852 Ga0075433_10014616 Ga0075433_100146167 136
32 3300006871 Ga0075434_100098176 Ga0075434_1000981765 136
33 3300009094 Ga0111539_10139223 Ga0111539_101392232 136
34 3300009147 Ga0114129_10109324 Ga0114129_101093242 136
35 3300014745 Ga0157377_10048960 Ga0157377_100489603 136
36 3300025908 Ga0207643_10076499 Ga0207643_100764992 136
37 3300025960 Ga0207651_10709019 Ga0207651_107090191 136
38 3300026095 Ga0207676_10306404 Ga0207676_103064043 136
39 3300027907 Ga0207428_10465962 Ga0207428_104659622 136
40 3300049568 Ga0501031_0284762 Ga0501031_0284762_541_951 136
41 3300049572 Ga0501036_0315208 Ga0501036_0315208_360_770 136
42 3300049573 Ga0501037_0599418 Ga0501037_0599418_49_459 136
43 3300049575 Ga0501039_0056186 Ga0501039_0056186_1750_2160 136
44 3300049578 Ga0501042_0003889 Ga0501042_0003889_3233_3643 136
45 3300049582 Ga0501048_0107006 Ga0501048_0107006_977_1387 136
46 3300049585 Ga0501069_0586049 Ga0501069_0586049_182_592 136
47 3300049588 Ga0501072_0352631 Ga0501072_0352631_697_1107 136
48 3300049591 Ga0501075_0156761 Ga0501075_0156761_572_982 136
49 3300049592 Ga0501076_0009175 Ga0501076_0009175_1959_2369 136
50 3300049741 Ga0501079_0034154 Ga0501079_0034154_1366_1776 136
51 3300049743 Ga0501081_0048284 Ga0501081_0048284_638_1048 136
52 3300050508 nmdc:mga09592_240558_c1 nmdc:mga09592_240558_c1_727_1137 136
53 3300050511 nmdc:mga08y16_168786_c1 nmdc:mga08y16_168786_c1_1370_1780 136
54 3300050512 nmdc:mga0n895_65768_c1 nmdc:mga0n895_65768_c1_462_872 136
55 3300050515 nmdc:mga0a205_68363_c1 nmdc:mga0a205_68363_c1_2449_2859 136
56 3300054114 Ga0501084_0465655 Ga0501084_0465655_629_1039 136
57 3300060353 Ga0501082_0211640 Ga0501082_0211640_545_955 136
58 3300005335 Ga0070666_10056738 Ga0070666_100567384 137
59 3300005336 Ga0070680_101041765 Ga0070680_1010417652 137
60 3300005343 Ga0070687_100136219 Ga0070687_1001362192 137
61 3300005344 Ga0070661_100230524 Ga0070661_1002305241 137
62 3300005347 Ga0070668_101342214 Ga0070668_1013422141 137
63 3300005354 Ga0070675_100005576 Ga0070675_1000055766 137
64 3300005354 Ga0070675_100571563 Ga0070675_1005715632 137
65 3300005356 Ga0070674_100677382 Ga0070674_1006773822 137
66 3300005356 Ga0070674_101023128 Ga0070674_1010231281 137
67 3300005364 Ga0070673_100011067 Ga0070673_1000110677 137
68 3300005365 Ga0070688_100164937 Ga0070688_1001649373 137
69 3300005441 Ga0070700_100303262 Ga0070700_1003032622 137
70 3300005456 Ga0070678_101572406 Ga0070678_1015724062 137
71 3300005544 Ga0070686_100164530 Ga0070686_1001645302 137
72 3300005617 Ga0068859_101290359 Ga0068859_1012903592 137
73 3300005618 Ga0068864_100499665 Ga0068864_1004996652 137
74 3300005719 Ga0068861_101108998 Ga0068861_1011089982 137
75 3300005841 Ga0068863_100948241 Ga0068863_1009482412 137
76 3300005844 Ga0068862_100345180 Ga0068862_1003451802 137
77 3300006844 Ga0075428_100181984 Ga0075428_1001819842 137
78 3300006846 Ga0075430_100005569 Ga0075430_1000055692 137
79 3300006846 Ga0075430_100164103 Ga0075430_1001641032 137
80 3300006847 Ga0075431_100455459 Ga0075431_1004554591 137
81 3300006847 Ga0075431_100809648 Ga0075431_1008096482 137
82 3300006880 Ga0075429_100038051 Ga0075429_1000380514 137
83 3300006881 Ga0068865_100978026 Ga0068865_1009780262 137
84 3300006931 Ga0097620_101290289 Ga0097620_1012902891 137
85 3300009094 Ga0111539_10000044 Ga0111539_1000004475 137
86 3300009094 Ga0111539_10010913 Ga0111539_100109132 137
87 3300009094 Ga0111539_10915013 Ga0111539_109150131 137
88 3300009147 Ga0114129_10008048 Ga0114129_100080483 137
89 3300009147 Ga0114129_11204322 Ga0114129_112043222 137
90 3300013306 Ga0163162_10912523 Ga0163162_109125232 137
91 3300013308 Ga0157375_10304445 Ga0157375_103044454 137
92 3300014326 Ga0157380_10204245 Ga0157380_102042452 137
93 3300014745 Ga0157377_10681957 Ga0157377_106819572 137
94 3300017792 Ga0163161_10553520 Ga0163161_105535202 137
95 3300025903 Ga0207680_10060337 Ga0207680_100603372 137
96 3300025918 Ga0207662_10028524 Ga0207662_100285242 137
97 3300025920 Ga0207649_10466101 Ga0207649_104661011 137
98 3300025926 Ga0207659_10032972 Ga0207659_100329723 137
99 3300025926 Ga0207659_10510909 Ga0207659_105109092 137
100 3300025933 Ga0207706_10336125 Ga0207706_103361252 137
101 3300025938 Ga0207704_11537265 Ga0207704_115372652 137
102 3300025940 Ga0207691_10365531 Ga0207691_103655312 137
103 3300025960 Ga0207651_10025082 Ga0207651_100250823 137
104 3300025972 Ga0207668_11030614 Ga0207668_110306141 137
105 3300025986 Ga0207658_10346730 Ga0207658_103467301 137
106 3300026075 Ga0207708_10159192 Ga0207708_101591921 137
107 3300026088 Ga0207641_10792093 Ga0207641_107920932 137
108 3300026089 Ga0207648_10410519 Ga0207648_104105192 137
109 3300026116 Ga0207674_10633889 Ga0207674_106338892 137
110 3300026121 Ga0207683_10670690 Ga0207683_106706902 137
111 3300027907 Ga0207428_10005989 Ga0207428_1000598911 137
112 3300028380 Ga0268265_10913339 Ga0268265_109133392 137
113 3300028381 Ga0268264_11413075 Ga0268264_114130752 137
114 3300042011 Ga0439454_116389 Ga0439454_116389_35_448 137
115 3300042993 Ga0439440_0104320 Ga0439440_0104320_114_527 137
116 3300046615 Ga0495656_0059120 Ga0495656_0059120_65_478 137
117 3300046684 Ga0495669_0462621 Ga0495669_0462621_48_461 137
118 3300050507 nmdc:mga05p37_503469_c1 nmdc:mga05p37_503469_c1_369_782 137
119 3300050507 nmdc:mga05p37_56561_c1 nmdc:mga05p37_56561_c1_381_794 137
120 3300050508 nmdc:mga09592_275748_c1 nmdc:mga09592_275748_c1_184_597 137
121 3300050509 nmdc:mga0qj67_280529_c1 nmdc:mga0qj67_280529_c1_311_724 137
122 3300050509 nmdc:mga0qj67_5293_c1 nmdc:mga0qj67_5293_c1_7106_7519 137
123 3300050510 nmdc:mga06r32_310457_c1 nmdc:mga06r32_310457_c1_163_576 137
124 3300050510 nmdc:mga06r32_610525_c1 nmdc:mga06r32_610525_c1_104_517 137
125 3300050511 nmdc:mga08y16_41616_c1 nmdc:mga08y16_41616_c1_337_750 137
126 3300050511 nmdc:mga08y16_945_c1 nmdc:mga08y16_945_c1_23172_23585 137
127 3300005459 Ga0068867_100580038 Ga0068867_1005800382 138
128 3300006844 Ga0075428_100169423 Ga0075428_1001694235 138
129 3300006847 Ga0075431_100117777 Ga0075431_1001177772 138
130 3300006880 Ga0075429_100380944 Ga0075429_1003809442 138
131 3300009094 Ga0111539_12329190 Ga0111539_123291901 138
132 3300050508 nmdc:mga09592_334982_c1 nmdc:mga09592_334982_c1_198_614 138
133 3300050510 nmdc:mga06r32_127805_c1 nmdc:mga06r32_127805_c1_1577_1993 138
134 3300026116 Ga0207674_11281744 Ga0207674_112817441 140
135 3300004801 Ga0058860_11692652 Ga0058860_116926521 141
136 3300004801 Ga0058860_12184011 Ga0058860_121840111 141
137 3300005290 Ga0065712_10012047 Ga0065712_100120472 141
138 3300005290 Ga0065712_10019331 Ga0065712_100193312 141
139 3300005295 Ga0065707_10275714 Ga0065707_102757142 141
140 3300005328 Ga0070676_10126212 Ga0070676_101262123 141
141 3300005331 Ga0070670_100387732 Ga0070670_1003877323 141
142 3300005331 Ga0070670_101273836 Ga0070670_1012738361 141
143 3300005334 Ga0068869_100173747 Ga0068869_1001737472 141
144 3300005335 Ga0070666_10019167 Ga0070666_100191671 141
145 3300005336 Ga0070680_100189453 Ga0070680_1001894533 141
146 3300005340 Ga0070689_100444795 Ga0070689_1004447952 141
147 3300005347 Ga0070668_100332063 Ga0070668_1003320632 141
148 3300005353 Ga0070669_100097839 Ga0070669_1000978394 141
149 3300005353 Ga0070669_100249264 Ga0070669_1002492643 141
150 3300005354 Ga0070675_100056448 Ga0070675_1000564484 141
151 3300005356 Ga0070674_100001500 Ga0070674_1000015005 141
152 3300005364 Ga0070673_100266332 Ga0070673_1002663323 141
153 3300005365 Ga0070688_100537017 Ga0070688_1005370172 141
154 3300005367 Ga0070667_101368857 Ga0070667_1013688571 141
155 3300005456 Ga0070678_100129534 Ga0070678_1001295342 141
156 3300005456 Ga0070678_100207670 Ga0070678_1002076702 141
157 3300005456 Ga0070678_100443188 Ga0070678_1004431882 141
158 3300005457 Ga0070662_100063348 Ga0070662_1000633482 141
159 3300005459 Ga0068867_100163313 Ga0068867_1001633131 141
160 3300005564 Ga0070664_102294566 Ga0070664_1022945661 141
161 3300005615 Ga0070702_100949974 Ga0070702_1009499741 141
162 3300009176 Ga0105242_10611704 Ga0105242_106117042 141
163 3300009553 Ga0105249_11948953 Ga0105249_119489532 141
164 3300014325 Ga0163163_10513067 Ga0163163_105130672 141
165 3300014326 Ga0157380_10700305 Ga0157380_107003051 141
166 3300017792 Ga0163161_10478577 Ga0163161_104785771 141
167 3300025893 Ga0207682_10010257 Ga0207682_100102575 141
168 3300025899 Ga0207642_10186498 Ga0207642_101864982 141
169 3300025901 Ga0207688_10059067 Ga0207688_100590671 141
170 3300025903 Ga0207680_10018186 Ga0207680_100181864 141
171 3300025907 Ga0207645_10245118 Ga0207645_102451181 141
172 3300025907 Ga0207645_10266359 Ga0207645_102663592 141
173 3300025908 Ga0207643_10053648 Ga0207643_100536482 141
174 3300025917 Ga0207660_10129706 Ga0207660_101297063 141
175 3300025923 Ga0207681_10542263 Ga0207681_105422631 141
176 3300025925 Ga0207650_10182355 Ga0207650_101823552 141
177 3300025925 Ga0207650_11065203 Ga0207650_110652031 141
178 3300025926 Ga0207659_10048877 Ga0207659_100488771 141
179 3300025932 Ga0207690_10250642 Ga0207690_102506422 141
180 3300025933 Ga0207706_10057657 Ga0207706_100576572 141
181 3300025934 Ga0207686_10552084 Ga0207686_105520842 141
182 3300025937 Ga0207669_10001529 Ga0207669_100015299 141
183 3300025937 Ga0207669_10833780 Ga0207669_108337802 141
184 3300025938 Ga0207704_10053194 Ga0207704_100531944 141
185 3300025940 Ga0207691_10180664 Ga0207691_101806642 141
186 3300025942 Ga0207689_10048175 Ga0207689_100481752 141
187 3300025945 Ga0207679_10586087 Ga0207679_105860871 141
188 3300025972 Ga0207668_10118148 Ga0207668_101181483 141
189 3300025981 Ga0207640_11766552 Ga0207640_117665521 141
190 3300026075 Ga0207708_11023236 Ga0207708_110232361 141
191 3300026089 Ga0207648_10046637 Ga0207648_100466372 141
192 3300026089 Ga0207648_10708929 Ga0207648_107089292 141
193 3300026095 Ga0207676_11105762 Ga0207676_111057622 141
194 3300026118 Ga0207675_100094653 Ga0207675_1000946532 141
195 3300026118 Ga0207675_101820305 Ga0207675_1018203051 141
196 3300026121 Ga0207683_10135522 Ga0207683_101355222 141
197 3300026121 Ga0207683_10451795 Ga0207683_104517952 141
198 3300026121 Ga0207683_10814772 Ga0207683_108147721 141
199 3300028380 Ga0268265_11372760 Ga0268265_113727601 141
200 3300046537 Ga0495598_0240921 Ga0495598_0240921_36_461 141
201 3300050511 nmdc:mga08y16_979410_c1 nmdc:mga08y16_979410_c1_372_797 141
202 3300049743 Ga0501081_0384370 Ga0501081_0384370_38_481 142
203 3300049592 Ga0501076_0311423 Ga0501076_0311423_363_839 144
204 3300050514 nmdc:mga08x19_2_c1 nmdc:mga08x19_2_c1_322739_323383 144
205 3300005718 Ga0068866_11108478 Ga0068866_111084782 145
206 3300006846 Ga0075430_100569743 Ga0075430_1005697432 145
207 3300049574 Ga0501038_0856032 Ga0501038_0856032_189_629 145
208 3300049575 Ga0501039_0299496 Ga0501039_0299496_681_1121 145
209 3300049577 Ga0501041_0135843 Ga0501041_0135843_869_1309 145
210 3300049578 Ga0501042_0286231 Ga0501042_0286231_303_743 145
211 3300049582 Ga0501048_0035520 Ga0501048_0035520_2257_2697 145
212 3300049588 Ga0501072_0027578 Ga0501072_0027578_2534_2974 145
213 3300049591 Ga0501075_0293114 Ga0501075_0293114_564_1004 145
214 3300049592 Ga0501076_1659100 Ga0501076_1659100_55_495 145
215 3300049741 Ga0501079_0133364 Ga0501079_0133364_102_542 145
216 3300049743 Ga0501081_0224269 Ga0501081_0224269_155_595 145
217 3300049743 Ga0501081_0869432 Ga0501081_0869432_42_482 145
218 3300049824 Ga0501045_0024405 Ga0501045_0024405_2593_3033 145
219 3300050509 nmdc:mga0qj67_541447_c1 nmdc:mga0qj67_541447_c1_37_477 145
220 3300054114 Ga0501084_0148547 Ga0501084_0148547_703_1143 145
221 3300061734 Ga0530510_0173337 Ga0530510_0173337_1103_1543 145
222 3300005328 Ga0070676_10959672 Ga0070676_109596721 146
223 3300005331 Ga0070670_101120704 Ga0070670_1011207041 146
224 3300005338 Ga0068868_100132565 Ga0068868_1001325653 146
225 3300005353 Ga0070669_100431899 Ga0070669_1004318992 146
226 3300005354 Ga0070675_101343057 Ga0070675_1013430571 146
227 3300005618 Ga0068864_100586708 Ga0068864_1005867081 146
228 3300005841 Ga0068863_100186579 Ga0068863_1001865792 146
229 3300005842 Ga0068858_100585933 Ga0068858_1005859332 146
230 3300005844 Ga0068862_100580042 Ga0068862_1005800421 146
231 3300006237 Ga0097621_100092943 Ga0097621_1000929434 146
232 3300006358 Ga0068871_100218569 Ga0068871_1002185691 146
233 3300009094 Ga0111539_10926144 Ga0111539_109261442 146
234 3300009177 Ga0105248_10089923 Ga0105248_100899234 146
235 3300013296 Ga0157374_10321343 Ga0157374_103213432 146
236 3300013297 Ga0157378_10372797 Ga0157378_103727972 146
237 3300025907 Ga0207645_10217224 Ga0207645_102172242 146
238 3300025926 Ga0207659_10402165 Ga0207659_104021652 146
239 3300025941 Ga0207711_10169955 Ga0207711_101699553 146
240 3300026023 Ga0207677_10145249 Ga0207677_101452493 146
241 3300026035 Ga0207703_10472240 Ga0207703_104722402 146
242 3300026089 Ga0207648_10474768 Ga0207648_104747682 146
243 3300026095 Ga0207676_11021163 Ga0207676_110211631 146
244 3300028380 Ga0268265_10622631 Ga0268265_106226311 146
245 3300049570 Ga0501033_0768025 Ga0501033_0768025_24_467 146
246 3300049574 Ga0501038_1061858 Ga0501038_1061858_101_544 146
247 3300049587 Ga0501071_0821372 Ga0501071_0821372_187_630 146
248 3300049592 Ga0501076_0156572 Ga0501076_0156572_63_506 146
249 3300049741 Ga0501079_0480084 Ga0501079_0480084_13_456 146
250 3300049824 Ga0501045_0157688 Ga0501045_0157688_272_715 146
251 3300002459 JGI24751J29686_10093352 JGI24751J29686_100933521 147
252 3300005290 Ga0065712_10223940 Ga0065712_102239402 147
253 3300005290 Ga0065712_10375391 Ga0065712_103753912 147
254 3300005293 Ga0065715_10624584 Ga0065715_106245841 147
255 3300005327 Ga0070658_11265126 Ga0070658_112651262 147
256 3300005327 Ga0070658_11305960 Ga0070658_113059601 147
257 3300005328 Ga0070676_10333427 Ga0070676_103334272 147
258 3300005330 Ga0070690_100013733 Ga0070690_1000137336 147
259 3300005331 Ga0070670_100062034 Ga0070670_1000620343 147
260 3300005331 Ga0070670_100268336 Ga0070670_1002683361 147
261 3300005337 Ga0070682_102066207 Ga0070682_1020662071 147
262 3300005338 Ga0068868_100300595 Ga0068868_1003005951 147
263 3300005340 Ga0070689_100062418 Ga0070689_1000624182 147
264 3300005341 Ga0070691_10169574 Ga0070691_101695742 147
265 3300005343 Ga0070687_100643985 Ga0070687_1006439851 147
266 3300005344 Ga0070661_100044414 Ga0070661_1000444142 147
267 3300005353 Ga0070669_100016438 Ga0070669_1000164383 147
268 3300005354 Ga0070675_100003145 Ga0070675_1000031456 147
269 3300005354 Ga0070675_100348068 Ga0070675_1003480681 147
270 3300005354 Ga0070675_100358438 Ga0070675_1003584381 147
271 3300005355 Ga0070671_100154900 Ga0070671_1001549002 147
272 3300005356 Ga0070674_100126837 Ga0070674_1001268371 147
273 3300005364 Ga0070673_100203331 Ga0070673_1002033312 147
274 3300005440 Ga0070705_100001006 Ga0070705_1000010065 147
275 3300005441 Ga0070700_100296060 Ga0070700_1002960601 147
276 3300005444 Ga0070694_100001224 Ga0070694_10000122414 147
277 3300005456 Ga0070678_100602360 Ga0070678_1006023602 147
278 3300005459 Ga0068867_100512027 Ga0068867_1005120271 147
279 3300005459 Ga0068867_101459412 Ga0068867_1014594121 147
280 3300005466 Ga0070685_11257714 Ga0070685_112577141 147
281 3300005471 Ga0070698_100458203 Ga0070698_1004582032 147
282 3300005535 Ga0070684_101438109 Ga0070684_1014381091 147
283 3300005536 Ga0070697_101035731 Ga0070697_1010357311 147
284 3300005543 Ga0070672_100014870 Ga0070672_1000148702 147
285 3300005543 Ga0070672_100066226 Ga0070672_1000662262 147
286 3300005543 Ga0070672_100902142 Ga0070672_1009021421 147
287 3300005544 Ga0070686_100126426 Ga0070686_1001264262 147
288 3300005545 Ga0070695_100000425 Ga0070695_10000042522 147
289 3300005546 Ga0070696_100008088 Ga0070696_1000080883 147
290 3300005564 Ga0070664_100410841 Ga0070664_1004108412 147
291 3300005615 Ga0070702_100054578 Ga0070702_1000545782 147
292 3300005616 Ga0068852_100955304 Ga0068852_1009553041 147
293 3300005617 Ga0068859_100185587 Ga0068859_1001855872 147
294 3300005618 Ga0068864_100043267 Ga0068864_1000432674 147
295 3300005718 Ga0068866_10447546 Ga0068866_104475462 147
296 3300005840 Ga0068870_10314003 Ga0068870_103140031 147
297 3300005841 Ga0068863_100751413 Ga0068863_1007514132 147
298 3300005842 Ga0068858_100094724 Ga0068858_1000947244 147
299 3300005844 Ga0068862_101781073 Ga0068862_1017810732 147
300 3300006358 Ga0068871_101280608 Ga0068871_1012806081 147
301 3300006881 Ga0068865_100297666 Ga0068865_1002976662 147
302 3300006881 Ga0068865_101042451 Ga0068865_1010424511 147
303 3300006931 Ga0097620_100185599 Ga0097620_1001855992 147
304 3300009094 Ga0111539_10026374 Ga0111539_100263745 147
305 3300009094 Ga0111539_10419078 Ga0111539_104190782 147
306 3300009094 Ga0111539_10516430 Ga0111539_105164302 147
307 3300009147 Ga0114129_11365552 Ga0114129_113655522 147
308 3300009148 Ga0105243_10281598 Ga0105243_102815982 147
309 3300009176 Ga0105242_10246359 Ga0105242_102463593 147
310 3300009553 Ga0105249_10133236 Ga0105249_101332362 147
311 3300013296 Ga0157374_10037760 Ga0157374_100377604 147
312 3300014325 Ga0163163_10017755 Ga0163163_100177558 147
313 3300014326 Ga0157380_10021207 Ga0157380_100212075 147
314 3300014326 Ga0157380_11914128 Ga0157380_119141281 147
315 3300014745 Ga0157377_10140301 Ga0157377_101403011 147
316 3300014745 Ga0157377_11044006 Ga0157377_110440061 147
317 3300014745 Ga0157377_11316128 Ga0157377_113161281 147
318 3300014969 Ga0157376_10927609 Ga0157376_109276091 147
319 3300014969 Ga0157376_11523918 Ga0157376_115239181 147
320 3300017792 Ga0163161_10552852 Ga0163161_105528522 147
321 3300017792 Ga0163161_10583739 Ga0163161_105837392 147
322 3300017792 Ga0163161_11582325 Ga0163161_115823251 147
323 3300025893 Ga0207682_10052606 Ga0207682_100526062 147
324 3300025917 Ga0207660_10725343 Ga0207660_107253432 147
325 3300025918 Ga0207662_10004271 Ga0207662_100042712 147
326 3300025925 Ga0207650_10148492 Ga0207650_101484923 147
327 3300025925 Ga0207650_11118654 Ga0207650_111186541 147
328 3300025926 Ga0207659_10007569 Ga0207659_100075697 147
329 3300025931 Ga0207644_10154004 Ga0207644_101540042 147
330 3300025931 Ga0207644_10882921 Ga0207644_108829211 147
331 3300025932 Ga0207690_10184925 Ga0207690_101849252 147
332 3300025933 Ga0207706_10766219 Ga0207706_107662191 147
333 3300025934 Ga0207686_10113634 Ga0207686_101136342 147
334 3300025935 Ga0207709_10161212 Ga0207709_101612123 147
335 3300025936 Ga0207670_10362549 Ga0207670_103625491 147
336 3300025937 Ga0207669_11139124 Ga0207669_111391241 147
337 3300025940 Ga0207691_10055581 Ga0207691_100555815 147
338 3300025940 Ga0207691_10085089 Ga0207691_100850894 147
339 3300025940 Ga0207691_10817532 Ga0207691_108175322 147
340 3300025945 Ga0207679_10294889 Ga0207679_102948892 147
341 3300025960 Ga0207651_10244533 Ga0207651_102445332 147
342 3300025960 Ga0207651_10622228 Ga0207651_106222282 147
343 3300025972 Ga0207668_10159885 Ga0207668_101598852 147
344 3300025981 Ga0207640_12203733 Ga0207640_122037331 147
345 3300025986 Ga0207658_11145954 Ga0207658_111459541 147
346 3300026035 Ga0207703_10289415 Ga0207703_102894154 147
347 3300026075 Ga0207708_10269838 Ga0207708_102698382 147
348 3300026088 Ga0207641_11460006 Ga0207641_114600061 147
349 3300026116 Ga0207674_11192251 Ga0207674_111922511 147
350 3300026118 Ga0207675_100770580 Ga0207675_1007705801 147
351 3300026121 Ga0207683_10624160 Ga0207683_106241602 147
352 3300027526 Ga0209968_1053945 Ga0209968_10539451 147
353 3300027907 Ga0207428_10004706 Ga0207428_100047065 147
354 3300028380 Ga0268265_12172198 Ga0268265_121721981 147
355 3300031548 Ga0307408_100364100 Ga0307408_1003641002 147
356 3300031731 Ga0307405_10003692 Ga0307405_100036925 147
357 3300031824 Ga0307413_11805844 Ga0307413_118058441 147
358 3300031852 Ga0307410_11728725 Ga0307410_117287251 147
359 3300031903 Ga0307407_10004637 Ga0307407_100046371 147
360 3300031911 Ga0307412_10009853 Ga0307412_100098536 147
361 3300031995 Ga0307409_100004850 Ga0307409_1000048505 147
362 3300031995 Ga0307409_100334185 Ga0307409_1003341851 147
363 3300032002 Ga0307416_100004482 Ga0307416_1000044827 147
364 3300032002 Ga0307416_100290128 Ga0307416_1002901282 147
365 3300032002 Ga0307416_102784627 Ga0307416_1027846271 147
366 3300032005 Ga0307411_12312917 Ga0307411_123129171 147
367 3300032126 Ga0307415_100068095 Ga0307415_1000680955 147
368 3300041512 Ga0451853_3527350 Ga0451853_3527350_333_776 147
369 3300042435 Ga0439434_0071318 Ga0439434_0071318_350_793 147
370 3300046472 Ga0495580_0339705 Ga0495580_0339705_557_1000 147
371 3300046537 Ga0495598_0383849 Ga0495598_0383849_15_458 147
372 3300046539 Ga0495621_0177265 Ga0495621_0177265_202_645 147
373 3300046683 Ga0495658_0097707 Ga0495658_0097707_429_872 147
374 3300046691 Ga0495670_0118046 Ga0495670_0118046_180_623 147
375 3300046794 Ga0495589_0492716 Ga0495589_0492716_61_504 147
376 3300049592 Ga0501076_0214437 Ga0501076_0214437_441_887 147
377 3300050508 nmdc:mga09592_504093_c1 nmdc:mga09592_504093_c1_481_924 147
378 3300050511 nmdc:mga08y16_5828_c1 nmdc:mga08y16_5828_c1_2473_2916 147
379 3300050511 nmdc:mga08y16_958632_c1 nmdc:mga08y16_958632_c1_381_824 147
380 3300053104 Ga0500556_0007638 Ga0500556_0007638_1292_1744 147
381 3300001977 JGI24746J21847_1000909 JGI24746J21847_10009091 148
382 3300002070 JGI24750J21931_1027064 JGI24750J21931_10270642 148
383 3300002076 JGI24749J21850_1010328 JGI24749J21850_10103281 148
384 3300002126 JGI24035J26624_1029462 JGI24035J26624_10294621 148
385 3300003203 JGI25406J46586_10012672 JGI25406J46586_100126726 148
386 3300005288 Ga0065714_10342292 Ga0065714_103422921 148
387 3300005289 Ga0065704_10077157 Ga0065704_100771572 148
388 3300005289 Ga0065704_10246247 Ga0065704_102462471 148
389 3300005289 Ga0065704_10347472 Ga0065704_103474722 148
390 3300005289 Ga0065704_10483285 Ga0065704_104832851 148
391 3300005290 Ga0065712_10085635 Ga0065712_100856352 148
392 3300005290 Ga0065712_10086488 Ga0065712_100864882 148
393 3300005290 Ga0065712_10534061 Ga0065712_105340611 148
394 3300005293 Ga0065715_10000879 Ga0065715_100008794 148
395 3300005293 Ga0065715_10096891 Ga0065715_100968913 148
396 3300005293 Ga0065715_10100717 Ga0065715_101007171 148
397 3300005293 Ga0065715_10701154 Ga0065715_107011541 148
398 3300005293 Ga0065715_11083627 Ga0065715_110836271 148
399 3300005295 Ga0065707_10006295 Ga0065707_100062951 148
400 3300005295 Ga0065707_10023887 Ga0065707_100238872 148
401 3300005295 Ga0065707_10628294 Ga0065707_106282941 148
402 3300005295 Ga0065707_10805685 Ga0065707_108056851 148
403 3300005327 Ga0070658_10477958 Ga0070658_104779581 148
404 3300005328 Ga0070676_10004240 Ga0070676_100042402 148
405 3300005328 Ga0070676_10402252 Ga0070676_104022521 148
406 3300005329 Ga0070683_100065328 Ga0070683_1000653282 148
407 3300005329 Ga0070683_100734194 Ga0070683_1007341942 148
408 3300005329 Ga0070683_101725729 Ga0070683_1017257291 148
409 3300005330 Ga0070690_100016453 Ga0070690_1000164535 148
410 3300005330 Ga0070690_100041224 Ga0070690_1000412242 148
411 3300005330 Ga0070690_101516938 Ga0070690_1015169381 148
412 3300005331 Ga0070670_100021219 Ga0070670_1000212192 148
413 3300005331 Ga0070670_100069094 Ga0070670_1000690944 148
414 3300005331 Ga0070670_100183131 Ga0070670_1001831313 148
415 3300005331 Ga0070670_101218015 Ga0070670_1012180151 148
416 3300005333 Ga0070677_10010650 Ga0070677_100106505 148
417 3300005333 Ga0070677_10321537 Ga0070677_103215372 148
418 3300005334 Ga0068869_100003236 Ga0068869_1000032365 148
419 3300005334 Ga0068869_100309489 Ga0068869_1003094892 148
420 3300005334 Ga0068869_100520169 Ga0068869_1005201692 148
421 3300005334 Ga0068869_100688548 Ga0068869_1006885482 148
422 3300005334 Ga0068869_100955344 Ga0068869_1009553441 148
423 3300005335 Ga0070666_10025313 Ga0070666_100253132 148
424 3300005335 Ga0070666_10750475 Ga0070666_107504751 148
425 3300005336 Ga0070680_100290096 Ga0070680_1002900962 148
426 3300005337 Ga0070682_100593957 Ga0070682_1005939571 148
427 3300005338 Ga0068868_100007147 Ga0068868_1000071478 148
428 3300005339 Ga0070660_101288933 Ga0070660_1012889331 148
429 3300005340 Ga0070689_100006102 Ga0070689_10000610211 148
430 3300005340 Ga0070689_100008169 Ga0070689_10000816910 148
431 3300005343 Ga0070687_100584483 Ga0070687_1005844832 148
432 3300005344 Ga0070661_100033797 Ga0070661_1000337975 148
433 3300005344 Ga0070661_100425074 Ga0070661_1004250742 148
434 3300005345 Ga0070692_10086280 Ga0070692_100862802 148
435 3300005345 Ga0070692_10477954 Ga0070692_104779542 148
436 3300005347 Ga0070668_100107964 Ga0070668_1001079644 148
437 3300005347 Ga0070668_100125945 Ga0070668_1001259453 148
438 3300005353 Ga0070669_100004669 Ga0070669_1000046692 148
439 3300005353 Ga0070669_100007056 Ga0070669_1000070566 148
440 3300005353 Ga0070669_100156477 Ga0070669_1001564773 148
441 3300005353 Ga0070669_100193327 Ga0070669_1001933272 148
442 3300005354 Ga0070675_100000998 Ga0070675_10000099819 148
443 3300005354 Ga0070675_100017262 Ga0070675_1000172625 148
444 3300005354 Ga0070675_100068099 Ga0070675_1000680993 148
445 3300005354 Ga0070675_100103317 Ga0070675_1001033172 148
446 3300005354 Ga0070675_100176359 Ga0070675_1001763593 148
447 3300005354 Ga0070675_100418093 Ga0070675_1004180931 148
448 3300005354 Ga0070675_100914156 Ga0070675_1009141561 148
449 3300005354 Ga0070675_101746188 Ga0070675_1017461881 148
450 3300005355 Ga0070671_100338502 Ga0070671_1003385021 148
451 3300005356 Ga0070674_101318208 Ga0070674_1013182081 148
452 3300005364 Ga0070673_100024542 Ga0070673_1000245422 148
453 3300005364 Ga0070673_100094764 Ga0070673_1000947644 148
454 3300005364 Ga0070673_100142705 Ga0070673_1001427054 148
455 3300005364 Ga0070673_100409621 Ga0070673_1004096212 148
456 3300005365 Ga0070688_100020189 Ga0070688_1000201895 148
457 3300005365 Ga0070688_100092983 Ga0070688_1000929832 148
458 3300005365 Ga0070688_100188539 Ga0070688_1001885393 148
459 3300005365 Ga0070688_100393658 Ga0070688_1003936581 148
460 3300005365 Ga0070688_101304894 Ga0070688_1013048941 148
461 3300005366 Ga0070659_100016032 Ga0070659_1000160323 148
462 3300005366 Ga0070659_100821816 Ga0070659_1008218161 148
463 3300005367 Ga0070667_100025321 Ga0070667_1000253212 148
464 3300005367 Ga0070667_100169857 Ga0070667_1001698572 148
465 3300005367 Ga0070667_101069016 Ga0070667_1010690161 148
466 3300005438 Ga0070701_10079984 Ga0070701_100799841 148
467 3300005438 Ga0070701_10116834 Ga0070701_101168341 148
468 3300005438 Ga0070701_10276904 Ga0070701_102769041 148
469 3300005438 Ga0070701_10455345 Ga0070701_104553451 148
470 3300005440 Ga0070705_100065913 Ga0070705_1000659133 148
471 3300005440 Ga0070705_100169270 Ga0070705_1001692701 148
472 3300005440 Ga0070705_100615398 Ga0070705_1006153982 148
473 3300005440 Ga0070705_100767487 Ga0070705_1007674871 148
474 3300005441 Ga0070700_100089978 Ga0070700_1000899783 148
475 3300005441 Ga0070700_100152172 Ga0070700_1001521722 148
476 3300005444 Ga0070694_100002510 Ga0070694_1000025104 148
477 3300005444 Ga0070694_100886870 Ga0070694_1008868701 148
478 3300005456 Ga0070678_100019465 Ga0070678_1000194654 148
479 3300005456 Ga0070678_100120646 Ga0070678_1001206462 148
480 3300005457 Ga0070662_100054409 Ga0070662_1000544092 148
481 3300005457 Ga0070662_100302125 Ga0070662_1003021252 148
482 3300005458 Ga0070681_10018905 Ga0070681_100189057 148
483 3300005459 Ga0068867_100000147 Ga0068867_10000014730 148
484 3300005459 Ga0068867_101319548 Ga0068867_1013195481 148
485 3300005466 Ga0070685_10523763 Ga0070685_105237632 148
486 3300005466 Ga0070685_11294069 Ga0070685_112940691 148
487 3300005468 Ga0070707_100177536 Ga0070707_1001775364 148
488 3300005468 Ga0070707_100182523 Ga0070707_1001825232 148
489 3300005471 Ga0070698_100047613 Ga0070698_1000476136 148
490 3300005471 Ga0070698_100329574 Ga0070698_1003295742 148
491 3300005518 Ga0070699_100002298 Ga0070699_1000022987 148
492 3300005518 Ga0070699_100181189 Ga0070699_1001811892 148
493 3300005518 Ga0070699_100220060 Ga0070699_1002200603 148
494 3300005518 Ga0070699_100463047 Ga0070699_1004630471 148
495 3300005518 Ga0070699_100521705 Ga0070699_1005217052 148
496 3300005530 Ga0070679_100795251 Ga0070679_1007952511 148
497 3300005530 Ga0070679_101079940 Ga0070679_1010799401 148
498 3300005535 Ga0070684_100205443 Ga0070684_1002054432 148
499 3300005535 Ga0070684_101315427 Ga0070684_1013154271 148
500 3300005536 Ga0070697_100152879 Ga0070697_1001528792 148
501 3300005536 Ga0070697_100552502 Ga0070697_1005525021 148
502 3300005536 Ga0070697_100590928 Ga0070697_1005909282 148
503 3300005539 Ga0068853_101545535 Ga0068853_1015455351 148
504 3300005543 Ga0070672_100078828 Ga0070672_1000788284 148
505 3300005543 Ga0070672_100134439 Ga0070672_1001344393 148
506 3300005543 Ga0070672_100258503 Ga0070672_1002585033 148
507 3300005544 Ga0070686_100005406 Ga0070686_1000054067 148
508 3300005545 Ga0070695_100549752 Ga0070695_1005497522 148
509 3300005545 Ga0070695_100744111 Ga0070695_1007441111 148
510 3300005546 Ga0070696_100093207 Ga0070696_1000932072 148
511 3300005548 Ga0070665_100063029 Ga0070665_1000630295 148
512 3300005549 Ga0070704_100002260 Ga0070704_1000022602 148
513 3300005549 Ga0070704_100002570 Ga0070704_1000025707 148
514 3300005549 Ga0070704_100128184 Ga0070704_1001281843 148
515 3300005549 Ga0070704_100184255 Ga0070704_1001842552 148
516 3300005549 Ga0070704_100855012 Ga0070704_1008550121 148
517 3300005564 Ga0070664_100044718 Ga0070664_1000447182 148
518 3300005564 Ga0070664_100052952 Ga0070664_1000529524 148
519 3300005564 Ga0070664_100162791 Ga0070664_1001627912 148
520 3300005564 Ga0070664_100403114 Ga0070664_1004031142 148
521 3300005564 Ga0070664_101347338 Ga0070664_1013473381 148
522 3300005577 Ga0068857_100164472 Ga0068857_1001644722 148
523 3300005577 Ga0068857_100270782 Ga0068857_1002707822 148
524 3300005577 Ga0068857_100363994 Ga0068857_1003639942 148
525 3300005578 Ga0068854_101606235 Ga0068854_1016062351 148
526 3300005615 Ga0070702_100604312 Ga0070702_1006043122 148
527 3300005615 Ga0070702_100617564 Ga0070702_1006175642 148
528 3300005616 Ga0068852_101595063 Ga0068852_1015950631 148
529 3300005616 Ga0068852_101730433 Ga0068852_1017304331 148
530 3300005617 Ga0068859_100002071 Ga0068859_1000020712 148
531 3300005617 Ga0068859_100002533 Ga0068859_1000025335 148
532 3300005617 Ga0068859_100022922 Ga0068859_1000229227 148
533 3300005617 Ga0068859_100069602 Ga0068859_1000696021 148
534 3300005617 Ga0068859_102563362 Ga0068859_1025633621 148
535 3300005618 Ga0068864_100067309 Ga0068864_1000673092 148
536 3300005618 Ga0068864_100431660 Ga0068864_1004316603 148
537 3300005719 Ga0068861_100001293 Ga0068861_10000129313 148
538 3300005834 Ga0068851_10849134 Ga0068851_108491341 148
539 3300005840 Ga0068870_10008632 Ga0068870_100086326 148
540 3300005840 Ga0068870_10014068 Ga0068870_100140682 148
541 3300005840 Ga0068870_10017998 Ga0068870_100179985 148
542 3300005840 Ga0068870_10456817 Ga0068870_104568171 148
543 3300005840 Ga0068870_10752093 Ga0068870_107520931 148
544 3300005841 Ga0068863_100019665 Ga0068863_1000196654 148
545 3300005842 Ga0068858_100015339 Ga0068858_10001533910 148
546 3300005842 Ga0068858_100052144 Ga0068858_1000521444 148
547 3300005843 Ga0068860_100006114 Ga0068860_1000061142 148
548 3300005843 Ga0068860_100038938 Ga0068860_1000389385 148
549 3300005843 Ga0068860_101260478 Ga0068860_1012604781 148
550 3300005844 Ga0068862_100001293 Ga0068862_10000129322 148
551 3300005844 Ga0068862_100004501 Ga0068862_1000045018 148
552 3300005844 Ga0068862_100717161 Ga0068862_1007171612 148
553 3300005985 Ga0081539_10000013 Ga0081539_10000013358 148
554 3300005985 Ga0081539_10000164 Ga0081539_1000016457 148
555 3300005985 Ga0081539_10013539 Ga0081539_100135396 148
556 3300005985 Ga0081539_10058268 Ga0081539_100582681 148
557 3300006058 Ga0075432_10061975 Ga0075432_100619752 148
558 3300006175 Ga0070712_101446797 Ga0070712_1014467971 148
559 3300006237 Ga0097621_100255420 Ga0097621_1002554202 148
560 3300006237 Ga0097621_100309097 Ga0097621_1003090972 148
561 3300006237 Ga0097621_100995095 Ga0097621_1009950952 148
562 3300006358 Ga0068871_100065374 Ga0068871_1000653742 148
563 3300006358 Ga0068871_100192405 Ga0068871_1001924052 148
564 3300006358 Ga0068871_100230976 Ga0068871_1002309763 148
565 3300006844 Ga0075428_100000869 Ga0075428_10000086918 148
566 3300006844 Ga0075428_100026891 Ga0075428_1000268911 148
567 3300006844 Ga0075428_100038755 Ga0075428_1000387555 148
568 3300006844 Ga0075428_100234100 Ga0075428_1002341002 148
569 3300006844 Ga0075428_100572935 Ga0075428_1005729351 148
570 3300006844 Ga0075428_101247363 Ga0075428_1012473632 148
571 3300006846 Ga0075430_100010153 Ga0075430_1000101537 148
572 3300006846 Ga0075430_100015622 Ga0075430_1000156225 148
573 3300006847 Ga0075431_100000533 Ga0075431_10000053311 148
574 3300006847 Ga0075431_100058743 Ga0075431_1000587432 148
575 3300006847 Ga0075431_100117491 Ga0075431_1001174912 148
576 3300006852 Ga0075433_10030688 Ga0075433_100306883 148
577 3300006852 Ga0075433_10036407 Ga0075433_100364076 148
578 3300006852 Ga0075433_10053367 Ga0075433_100533673 148
579 3300006852 Ga0075433_10054073 Ga0075433_100540734 148
580 3300006852 Ga0075433_10183185 Ga0075433_101831852 148
581 3300006871 Ga0075434_100008828 Ga0075434_1000088284 148
582 3300006871 Ga0075434_100054222 Ga0075434_1000542222 148
583 3300006871 Ga0075434_100107712 Ga0075434_1001077123 148
584 3300006871 Ga0075434_100268093 Ga0075434_1002680932 148
585 3300006871 Ga0075434_101096201 Ga0075434_1010962011 148
586 3300006880 Ga0075429_100062109 Ga0075429_1000621092 148
587 3300006880 Ga0075429_100391003 Ga0075429_1003910032 148
588 3300006881 Ga0068865_100150804 Ga0068865_1001508043 148
589 3300006881 Ga0068865_100338176 Ga0068865_1003381762 148
590 3300006881 Ga0068865_100855738 Ga0068865_1008557382 148
591 3300006931 Ga0097620_100002071 Ga0097620_1000020712 148
592 3300006931 Ga0097620_100002533 Ga0097620_10000253316 148
593 3300006931 Ga0097620_100022927 Ga0097620_1000229277 148
594 3300006931 Ga0097620_100069604 Ga0097620_1000696041 148
595 3300006931 Ga0097620_102562974 Ga0097620_1025629741 148
596 3300007076 Ga0075435_100005714 Ga0075435_1000057143 148
597 3300007076 Ga0075435_100060230 Ga0075435_1000602302 148
598 3300007076 Ga0075435_100637741 Ga0075435_1006377412 148
599 3300009094 Ga0111539_10000769 Ga0111539_100007695 148
600 3300009094 Ga0111539_10022455 Ga0111539_100224558 148
601 3300009094 Ga0111539_10360069 Ga0111539_103600693 148
602 3300009094 Ga0111539_10654940 Ga0111539_106549401 148
603 3300009094 Ga0111539_11208015 Ga0111539_112080152 148
604 3300009094 Ga0111539_12498185 Ga0111539_124981851 148
605 3300009094 Ga0111539_13317903 Ga0111539_133179031 148
606 3300009098 Ga0105245_10457378 Ga0105245_104573782 148
607 3300009147 Ga0114129_10003276 Ga0114129_1000327614 148
608 3300009147 Ga0114129_10006054 Ga0114129_100060547 148
609 3300009147 Ga0114129_10088180 Ga0114129_100881807 148
610 3300009147 Ga0114129_10113438 Ga0114129_101134382 148
611 3300009147 Ga0114129_10431633 Ga0114129_104316332 148
612 3300009147 Ga0114129_10610543 Ga0114129_106105432 148
613 3300009147 Ga0114129_10641114 Ga0114129_106411142 148
614 3300009147 Ga0114129_11329002 Ga0114129_113290022 148
615 3300009147 Ga0114129_12868545 Ga0114129_128685451 148
616 3300009148 Ga0105243_10039279 Ga0105243_100392792 148
617 3300009148 Ga0105243_11884064 Ga0105243_118840641 148
618 3300009176 Ga0105242_10467408 Ga0105242_104674082 148
619 3300009177 Ga0105248_10076791 Ga0105248_100767912 148
620 3300009177 Ga0105248_10158064 Ga0105248_101580644 148
621 3300009553 Ga0105249_10001334 Ga0105249_1000133418 148
622 3300009553 Ga0105249_10170129 Ga0105249_101701293 148
623 3300011119 Ga0105246_10095338 Ga0105246_100953381 148
624 3300011119 Ga0105246_10214474 Ga0105246_102144741 148
625 3300011119 Ga0105246_10827539 Ga0105246_108275392 148
626 3300011119 Ga0105246_10905180 Ga0105246_109051802 148
627 3300012480 Ga0157346_1019322 Ga0157346_10193221 148
628 3300012495 Ga0157323_1007328 Ga0157323_10073281 148
629 3300013100 Ga0157373_10981274 Ga0157373_109812741 148
630 3300013296 Ga0157374_10199239 Ga0157374_101992392 148
631 3300013297 Ga0157378_10059392 Ga0157378_100593922 148
632 3300013297 Ga0157378_10089613 Ga0157378_100896133 148
633 3300013306 Ga0163162_10016085 Ga0163162_100160858 148
634 3300013306 Ga0163162_10589379 Ga0163162_105893792 148
635 3300013308 Ga0157375_10009638 Ga0157375_1000963811 148
636 3300013308 Ga0157375_10027823 Ga0157375_100278236 148
637 3300013308 Ga0157375_10370261 Ga0157375_103702612 148
638 3300014325 Ga0163163_10255424 Ga0163163_102554243 148
639 3300014326 Ga0157380_10005619 Ga0157380_100056192 148
640 3300014326 Ga0157380_10757404 Ga0157380_107574042 148
641 3300014745 Ga0157377_10002991 Ga0157377_100029915 148
642 3300014745 Ga0157377_10034044 Ga0157377_100340442 148
643 3300014745 Ga0157377_10078417 Ga0157377_100784172 148
644 3300014968 Ga0157379_10003739 Ga0157379_100037396 148
645 3300014968 Ga0157379_10087853 Ga0157379_100878533 148
646 3300014969 Ga0157376_10068589 Ga0157376_100685892 148
647 3300014969 Ga0157376_10310734 Ga0157376_103107343 148
648 3300014969 Ga0157376_11247253 Ga0157376_112472532 148
649 3300014969 Ga0157376_11528060 Ga0157376_115280601 148
650 3300017792 Ga0163161_10011766 Ga0163161_100117666 148
651 3300025271 Ga0207666_1077723 Ga0207666_10777231 148
652 3300025290 Ga0207673_1004738 Ga0207673_10047381 148
653 3300025315 Ga0207697_10001621 Ga0207697_100016212 148
654 3300025315 Ga0207697_10102352 Ga0207697_101023522 148
655 3300025893 Ga0207682_10001841 Ga0207682_100018416 148
656 3300025893 Ga0207682_10013530 Ga0207682_100135301 148
657 3300025893 Ga0207682_10593655 Ga0207682_105936551 148
658 3300025901 Ga0207688_10001443 Ga0207688_1000144311 148
659 3300025901 Ga0207688_10132575 Ga0207688_101325752 148
660 3300025901 Ga0207688_10699274 Ga0207688_106992741 148
661 3300025904 Ga0207647_10047580 Ga0207647_100475802 148
662 3300025907 Ga0207645_10001881 Ga0207645_1000188111 148
663 3300025907 Ga0207645_10529058 Ga0207645_105290582 148
664 3300025908 Ga0207643_10004144 Ga0207643_100041448 148
665 3300025908 Ga0207643_10005748 Ga0207643_100057482 148
666 3300025908 Ga0207643_10053082 Ga0207643_100530822 148
667 3300025908 Ga0207643_10234149 Ga0207643_102341493 148
668 3300025908 Ga0207643_10605897 Ga0207643_106058972 148
669 3300025909 Ga0207705_10224675 Ga0207705_102246752 148
670 3300025910 Ga0207684_10115149 Ga0207684_101151492 148
671 3300025912 Ga0207707_10084480 Ga0207707_100844802 148
672 3300025915 Ga0207693_10434261 Ga0207693_104342612 148
673 3300025917 Ga0207660_10199381 Ga0207660_101993812 148
674 3300025917 Ga0207660_10513750 Ga0207660_105137502 148
675 3300025918 Ga0207662_10002054 Ga0207662_100020549 148
676 3300025918 Ga0207662_10129801 Ga0207662_101298012 148
677 3300025919 Ga0207657_10899733 Ga0207657_108997332 148
678 3300025920 Ga0207649_10023217 Ga0207649_100232172 148
679 3300025920 Ga0207649_10267003 Ga0207649_102670032 148
680 3300025920 Ga0207649_11297535 Ga0207649_112975351 148
681 3300025921 Ga0207652_10701069 Ga0207652_107010692 148
682 3300025921 Ga0207652_10750787 Ga0207652_107507872 148
683 3300025922 Ga0207646_10020399 Ga0207646_100203992 148
684 3300025922 Ga0207646_10166267 Ga0207646_101662672 148
685 3300025922 Ga0207646_10177495 Ga0207646_101774952 148
686 3300025922 Ga0207646_10231923 Ga0207646_102319232 148
687 3300025922 Ga0207646_10270986 Ga0207646_102709862 148
688 3300025923 Ga0207681_10000566 Ga0207681_1000056613 148
689 3300025923 Ga0207681_10077568 Ga0207681_100775682 148
690 3300025923 Ga0207681_10088862 Ga0207681_100888622 148
691 3300025923 Ga0207681_10210141 Ga0207681_102101412 148
692 3300025925 Ga0207650_10037192 Ga0207650_100371922 148
693 3300025925 Ga0207650_10126129 Ga0207650_101261292 148
694 3300025925 Ga0207650_10273829 Ga0207650_102738292 148
695 3300025925 Ga0207650_10437743 Ga0207650_104377431 148
696 3300025925 Ga0207650_10569237 Ga0207650_105692372 148
697 3300025926 Ga0207659_10001222 Ga0207659_100012225 148
698 3300025926 Ga0207659_10002242 Ga0207659_100022425 148
699 3300025926 Ga0207659_10004787 Ga0207659_100047872 148
700 3300025926 Ga0207659_10027161 Ga0207659_100271613 148
701 3300025926 Ga0207659_10071033 Ga0207659_100710333 148
702 3300025927 Ga0207687_10849320 Ga0207687_108493202 148
703 3300025931 Ga0207644_10748292 Ga0207644_107482922 148
704 3300025932 Ga0207690_10165282 Ga0207690_101652822 148
705 3300025933 Ga0207706_10003425 Ga0207706_100034258 148
706 3300025933 Ga0207706_10037583 Ga0207706_100375832 148
707 3300025933 Ga0207706_10146880 Ga0207706_101468803 148
708 3300025933 Ga0207706_10833559 Ga0207706_108335592 148
709 3300025934 Ga0207686_10822442 Ga0207686_108224422 148
710 3300025936 Ga0207670_10003736 Ga0207670_1000373610 148
711 3300025936 Ga0207670_10006525 Ga0207670_100065256 148
712 3300025937 Ga0207669_10428381 Ga0207669_104283812 148
713 3300025940 Ga0207691_10012691 Ga0207691_100126917 148
714 3300025940 Ga0207691_10050039 Ga0207691_100500394 148
715 3300025940 Ga0207691_10088306 Ga0207691_100883062 148
716 3300025940 Ga0207691_10256872 Ga0207691_102568723 148
717 3300025941 Ga0207711_10083185 Ga0207711_100831854 148
718 3300025941 Ga0207711_10242585 Ga0207711_102425853 148
719 3300025942 Ga0207689_10000831 Ga0207689_1000083110 148
720 3300025942 Ga0207689_10084887 Ga0207689_100848873 148
721 3300025944 Ga0207661_10028828 Ga0207661_100288284 148
722 3300025945 Ga0207679_10029892 Ga0207679_100298921 148
723 3300025945 Ga0207679_10082888 Ga0207679_100828882 148
724 3300025945 Ga0207679_10757637 Ga0207679_107576372 148
725 3300025945 Ga0207679_11454145 Ga0207679_114541451 148
726 3300025960 Ga0207651_10096190 Ga0207651_100961901 148
727 3300025960 Ga0207651_10125337 Ga0207651_101253372 148
728 3300025960 Ga0207651_10180642 Ga0207651_101806422 148
729 3300025960 Ga0207651_10380877 Ga0207651_103808773 148
730 3300025961 Ga0207712_10002418 Ga0207712_1000241811 148
731 3300025961 Ga0207712_10464140 Ga0207712_104641402 148
732 3300025972 Ga0207668_10150849 Ga0207668_101508492 148
733 3300025972 Ga0207668_10269874 Ga0207668_102698743 148
734 3300025981 Ga0207640_10067322 Ga0207640_100673222 148
735 3300025981 Ga0207640_10250656 Ga0207640_102506561 148
736 3300025986 Ga0207658_10012438 Ga0207658_100124382 148
737 3300025986 Ga0207658_11138384 Ga0207658_111383841 148
738 3300026023 Ga0207677_10063258 Ga0207677_100632584 148
739 3300026023 Ga0207677_10603857 Ga0207677_106038571 148
740 3300026035 Ga0207703_10042317 Ga0207703_100423173 148
741 3300026035 Ga0207703_10141518 Ga0207703_101415181 148
742 3300026041 Ga0207639_11705257 Ga0207639_117052571 148
743 3300026075 Ga0207708_10017222 Ga0207708_100172222 148
744 3300026075 Ga0207708_10095321 Ga0207708_100953213 148
745 3300026088 Ga0207641_10097682 Ga0207641_100976822 148
746 3300026088 Ga0207641_10105045 Ga0207641_101050452 148
747 3300026088 Ga0207641_11546920 Ga0207641_115469201 148
748 3300026089 Ga0207648_10000446 Ga0207648_1000044630 148
749 3300026089 Ga0207648_10062997 Ga0207648_100629971 148
750 3300026089 Ga0207648_11114991 Ga0207648_111149912 148
751 3300026095 Ga0207676_10010914 Ga0207676_100109142 148
752 3300026095 Ga0207676_10026175 Ga0207676_100261755 148
753 3300026116 Ga0207674_10176364 Ga0207674_101763642 148
754 3300026116 Ga0207674_10185565 Ga0207674_101855652 148
755 3300026116 Ga0207674_10465004 Ga0207674_104650042 148
756 3300026118 Ga0207675_100001058 Ga0207675_10000105813 148
757 3300026118 Ga0207675_100004015 Ga0207675_10000401511 148
758 3300026118 Ga0207675_100794938 Ga0207675_1007949381 148
759 3300026121 Ga0207683_10021244 Ga0207683_100212445 148
760 3300026121 Ga0207683_10128891 Ga0207683_101288913 148
761 3300026121 Ga0207683_10808344 Ga0207683_108083442 148
762 3300026142 Ga0207698_10509518 Ga0207698_105095182 148
763 3300027617 Ga0210002_1084402 Ga0210002_10844021 148
764 3300027907 Ga0207428_10000224 Ga0207428_1000022467 148
765 3300027907 Ga0207428_10010077 Ga0207428_100100778 148
766 3300027907 Ga0207428_10304822 Ga0207428_103048222 148
767 3300028379 Ga0268266_10312547 Ga0268266_103125472 148
768 3300028380 Ga0268265_10000540 Ga0268265_1000054021 148
769 3300028380 Ga0268265_10055567 Ga0268265_100555672 148
770 3300028380 Ga0268265_10374861 Ga0268265_103748611 148
771 3300028381 Ga0268264_10012807 Ga0268264_100128078 148
772 3300028381 Ga0268264_10115573 Ga0268264_101155732 148
773 3300028381 Ga0268264_10879495 Ga0268264_108794952 148
774 3300031548 Ga0307408_100388393 Ga0307408_1003883931 148
775 3300031548 Ga0307408_101045124 Ga0307408_1010451241 148
776 3300031731 Ga0307405_10091958 Ga0307405_100919583 148
777 3300031731 Ga0307405_10751537 Ga0307405_107515372 148
778 3300031824 Ga0307413_10045918 Ga0307413_100459183 148
779 3300031824 Ga0307413_10140375 Ga0307413_101403752 148
780 3300031824 Ga0307413_11234604 Ga0307413_112346041 148
781 3300031852 Ga0307410_10005392 Ga0307410_100053923 148
782 3300031852 Ga0307410_10123448 Ga0307410_101234482 148
783 3300031852 Ga0307410_10141882 Ga0307410_101418821 148
784 3300031901 Ga0307406_10041702 Ga0307406_100417022 148
785 3300031901 Ga0307406_11405123 Ga0307406_114051231 148
786 3300031903 Ga0307407_10060573 Ga0307407_100605733 148
787 3300031903 Ga0307407_10968281 Ga0307407_109682812 148
788 3300031911 Ga0307412_10083761 Ga0307412_100837612 148
789 3300031911 Ga0307412_10671720 Ga0307412_106717202 148
790 3300031911 Ga0307412_10934579 Ga0307412_109345792 148
791 3300031995 Ga0307409_100018258 Ga0307409_1000182584 148
792 3300031995 Ga0307409_100104257 Ga0307409_1001042573 148
793 3300031995 Ga0307409_100115339 Ga0307409_1001153392 148
794 3300031995 Ga0307409_100147164 Ga0307409_1001471643 148
795 3300031995 Ga0307409_100927127 Ga0307409_1009271272 148
796 3300032002 Ga0307416_100012439 Ga0307416_1000124395 148
797 3300032002 Ga0307416_100072394 Ga0307416_1000723943 148
798 3300032002 Ga0307416_100119105 Ga0307416_1001191052 148
799 3300032002 Ga0307416_100530497 Ga0307416_1005304972 148
800 3300032002 Ga0307416_100791711 Ga0307416_1007917112 148
801 3300032002 Ga0307416_101584211 Ga0307416_1015842111 148
802 3300032002 Ga0307416_101974363 Ga0307416_1019743631 148
803 3300032002 Ga0307416_102130950 Ga0307416_1021309501 148
804 3300032002 Ga0307416_103018112 Ga0307416_1030181121 148
805 3300032002 Ga0307416_103157408 Ga0307416_1031574081 148
806 3300032004 Ga0307414_10366728 Ga0307414_103667283 148
807 3300032004 Ga0307414_10418639 Ga0307414_104186392 148
808 3300032004 Ga0307414_10549306 Ga0307414_105493062 148
809 3300032005 Ga0307411_10003247 Ga0307411_100032478 148
810 3300032005 Ga0307411_10029786 Ga0307411_100297864 148
811 3300032005 Ga0307411_10819408 Ga0307411_108194081 148
812 3300032126 Ga0307415_100007237 Ga0307415_1000072372 148
813 3300032126 Ga0307415_100134002 Ga0307415_1001340023 148
814 3300032126 Ga0307415_101561037 Ga0307415_1015610372 148
815 3300034819 Ga0373958_0149005 Ga0373958_0149005_78_524 148
816 3300035088 Ga0373940_0089324 Ga0373940_0089324_13_459 148
817 3300035114 Ga0373939_0279073 Ga0373939_0279073_190_636 148
818 3300035115 Ga0373941_0201517 Ga0373941_0201517_131_577 148
819 3300035115 Ga0373941_0428774 Ga0373941_0428774_37_483 148
820 3300035241 Ga0373961_0222983 Ga0373961_0222983_144_590 148
821 3300038996 Ga0242420_143832 Ga0242420_143832_29_475 148
822 3300042002 Ga0439442_126911 Ga0439442_126911_40_486 148
823 3300042437 Ga0439444_0009088 Ga0439444_0009088_848_1297 148
824 3300042461 Ga0439460_0244470 Ga0439460_0244470_83_529 148
825 3300042876 Ga0451577_0607601 Ga0451577_0607601_152_598 148
826 3300045051 Ga0451576_0007819 Ga0451576_0007819_11741_12187 148
827 3300045051 Ga0451576_0013731 Ga0451576_0013731_4330_4776 148
828 3300045051 Ga0451576_0067399 Ga0451576_0067399_68_616 148
829 3300045051 Ga0451576_0079338 Ga0451576_0079338_2800_3246 148
830 3300045051 Ga0451576_0186928 Ga0451576_0186928_83_529 148
831 3300045051 Ga0451576_0705066 Ga0451576_0705066_362_808 148
832 3300046455 Ga0495603_0188771 Ga0495603_0188771_640_1086 148
833 3300046459 Ga0495629_0057974 Ga0495629_0057974_130_576 148
834 3300046472 Ga0495580_0532991 Ga0495580_0532991_46_492 148
835 3300046492 Ga0495585_0147225 Ga0495585_0147225_583_1029 148
836 3300046499 Ga0495594_0028254 Ga0495594_0028254_2258_2704 148
837 3300046522 Ga0495643_0001548 Ga0495643_0001548_4068_4514 148
838 3300046523 Ga0495644_0019673 Ga0495644_0019673_1235_1681 148
839 3300046528 Ga0495642_0046137 Ga0495642_0046137_1246_1692 148
840 3300046528 Ga0495642_0048601 Ga0495642_0048601_224_670 148
841 3300046538 Ga0495609_0147241 Ga0495609_0147241_371_817 148
842 3300046539 Ga0495621_0015340 Ga0495621_0015340_824_1270 148
843 3300046539 Ga0495621_0107764 Ga0495621_0107764_234_680 148
844 3300046664 Ga0495659_0003442 Ga0495659_0003442_1716_2162 148
845 3300046664 Ga0495659_0013145 Ga0495659_0013145_1687_2133 148
846 3300046664 Ga0495659_0190341 Ga0495659_0190341_64_510 148
847 3300046664 Ga0495659_0308799 Ga0495659_0308799_173_619 148
848 3300046664 Ga0495659_0348468 Ga0495659_0348468_62_508 148
849 3300046674 Ga0495588_0024382 Ga0495588_0024382_1780_2226 148
850 3300046691 Ga0495670_0173556 Ga0495670_0173556_15_461 148
851 3300046691 Ga0495670_0483775 Ga0495670_0483775_187_648 148
852 3300047318 Ga0495636_0063710 Ga0495636_0063710_943_1389 148
853 3300047445 Ga0495677_0028335 Ga0495677_0028335_1420_1866 148
854 3300047445 Ga0495677_0195527 Ga0495677_0195527_92_538 148
855 3300048907 Ga0496104_0815228 Ga0496104_0815228_109_555 148
856 3300048911 Ga0496108_1280058 Ga0496108_1280058_90_536 148
857 3300048913 Ga0496110_0387822 Ga0496110_0387822_367_813 148
858 3300048915 Ga0496112_1640137 Ga0496112_1640137_25_471 148
859 3300049513 Ga0501290_071205 Ga0501290_071205_94_540 148
860 3300049572 Ga0501036_0665359 Ga0501036_0665359_320_766 148
861 3300049573 Ga0501037_0639497 Ga0501037_0639497_91_540 148
862 3300049575 Ga0501039_0007557 Ga0501039_0007557_5395_5844 148
863 3300049576 Ga0501040_0012945 Ga0501040_0012945_2002_2451 148
864 3300049577 Ga0501041_0227101 Ga0501041_0227101_660_1106 148
865 3300049578 Ga0501042_0632904 Ga0501042_0632904_48_494 148
866 3300049580 Ga0501046_0074757 Ga0501046_0074757_1125_1574 148
867 3300049583 Ga0501067_0296343 Ga0501067_0296343_115_561 148
868 3300049584 Ga0501068_0368144 Ga0501068_0368144_270_719 148
869 3300049588 Ga0501072_0008859 Ga0501072_0008859_315_764 148
870 3300049588 Ga0501072_0205831 Ga0501072_0205831_300_746 148
871 3300049588 Ga0501072_0392733 Ga0501072_0392733_15_461 148
872 3300049591 Ga0501075_0098439 Ga0501075_0098439_1653_2102 148
873 3300049591 Ga0501075_0502202 Ga0501075_0502202_431_877 148
874 3300049592 Ga0501076_0044775 Ga0501076_0044775_264_713 148
875 3300049655 Ga0501208_041509 Ga0501208_041509_243_689 148
876 3300049679 Ga0501249_016262 Ga0501249_016262_814_1260 148
877 3300049704 Ga0501221_137825 Ga0501221_137825_104_550 148
878 3300049708 Ga0501245_059587 Ga0501245_059587_120_566 148
879 3300049741 Ga0501079_0075401 Ga0501079_0075401_101_550 148
880 3300049741 Ga0501079_0445534 Ga0501079_0445534_249_695 148
881 3300049742 Ga0501080_0553263 Ga0501080_0553263_111_557 148
882 3300049742 Ga0501080_0994261 Ga0501080_0994261_215_661 148
883 3300049743 Ga0501081_0190447 Ga0501081_0190447_998_1447 148
884 3300049743 Ga0501081_0339545 Ga0501081_0339545_583_1029 148
885 3300049743 Ga0501081_0386495 Ga0501081_0386495_155_601 148
886 3300049743 Ga0501081_0625649 Ga0501081_0625649_341_787 148
887 3300049779 Ga0501283_035584 Ga0501283_035584_220_666 148
888 3300050507 nmdc:mga05p37_1654227_c1 nmdc:mga05p37_1654227_c1_25_471 148
889 3300050507 nmdc:mga05p37_1656263_c1 nmdc:mga05p37_1656263_c1_90_536 148
890 3300050507 nmdc:mga05p37_17011_c1 nmdc:mga05p37_17011_c1_5840_6286 148
891 3300050507 nmdc:mga05p37_200071_c1 nmdc:mga05p37_200071_c1_1471_1917 148
892 3300050507 nmdc:mga05p37_244730_c1 nmdc:mga05p37_244730_c1_1608_2057 148
893 3300050507 nmdc:mga05p37_395165_c1 nmdc:mga05p37_395165_c1_360_809 148
894 3300050507 nmdc:mga05p37_70703_c1 nmdc:mga05p37_70703_c1_118_564 148
895 3300050507 nmdc:mga05p37_974417_c1 nmdc:mga05p37_974417_c1_428_874 148
896 3300050508 nmdc:mga09592_29049_c1 nmdc:mga09592_29049_c1_1015_1461 148
897 3300050508 nmdc:mga09592_61109_c1 nmdc:mga09592_61109_c1_2011_2460 148
898 3300050508 nmdc:mga09592_80073_c1 nmdc:mga09592_80073_c1_1503_1949 148
899 3300050509 nmdc:mga0qj67_526_c1 nmdc:mga0qj67_526_c1_20470_20916 148
900 3300050509 nmdc:mga0qj67_5798_c1 nmdc:mga0qj67_5798_c1_3655_4104 148
901 3300050510 nmdc:mga06r32_107386_c1 nmdc:mga06r32_107386_c1_913_1359 148
902 3300050510 nmdc:mga06r32_18027_c1 nmdc:mga06r32_18027_c1_1345_1794 148
903 3300050510 nmdc:mga06r32_24815_c1 nmdc:mga06r32_24815_c1_1249_1695 148
904 3300050511 nmdc:mga08y16_15575_c1 nmdc:mga08y16_15575_c1_6839_7285 148
905 3300050511 nmdc:mga08y16_1836417_c1 nmdc:mga08y16_1836417_c1_87_533 148
906 3300050511 nmdc:mga08y16_467911_c1 nmdc:mga08y16_467911_c1_83_529 148
907 3300050511 nmdc:mga08y16_575165_c1 nmdc:mga08y16_575165_c1_277_723 148
908 3300050511 nmdc:mga08y16_60586_c1 nmdc:mga08y16_60586_c1_1600_2046 148
909 3300050511 nmdc:mga08y16_684391_c1 nmdc:mga08y16_684391_c1_563_1009 148
910 3300050512 nmdc:mga0n895_1446644_c1 nmdc:mga0n895_1446644_c1_120_566 148
911 3300050512 nmdc:mga0n895_32666_c1 nmdc:mga0n895_32666_c1_3356_3802 148
912 3300050512 nmdc:mga0n895_465314_c1 nmdc:mga0n895_465314_c1_424_870 148
913 3300050512 nmdc:mga0n895_809892_c1 nmdc:mga0n895_809892_c1_458_904 148
914 3300050512 nmdc:mga0n895_88881_c1 nmdc:mga0n895_88881_c1_1437_1889 148
915 3300050512 nmdc:mga0n895_90365_c1 nmdc:mga0n895_90365_c1_283_729 148
916 3300050513 nmdc:mga0rr50_102607_c1 nmdc:mga0rr50_102607_c1_48_494 148
917 3300050513 nmdc:mga0rr50_111579_c1 nmdc:mga0rr50_111579_c1_27_473 148
918 3300050513 nmdc:mga0rr50_1506752_c1 nmdc:mga0rr50_1506752_c1_83_529 148
919 3300050513 nmdc:mga0rr50_63989_c1 nmdc:mga0rr50_63989_c1_1509_1961 148
920 3300050515 nmdc:mga0a205_107387_c1 nmdc:mga0a205_107387_c1_2074_2526 148
921 3300050515 nmdc:mga0a205_1497_c1 nmdc:mga0a205_1497_c1_4352_4798 148
922 3300050515 nmdc:mga0a205_422640_c1 nmdc:mga0a205_422640_c1_270_716 148
923 3300050515 nmdc:mga0a205_55600_c1 nmdc:mga0a205_55600_c1_350_796 148
924 3300050515 nmdc:mga0a205_91795_c1 nmdc:mga0a205_91795_c1_1860_2306 148
925 3300050515 nmdc:mga0a205_94654_c1 nmdc:mga0a205_94654_c1_1890_2336 148
926 3300054114 Ga0501084_0250372 Ga0501084_0250372_328_777 148
927 3300054114 Ga0501084_0764188 Ga0501084_0764188_18_464 148
928 3300059421 Ga0590071_000198 Ga0590071_000198_2862_3311 148
929 3300059421 Ga0590071_001421 Ga0590071_001421_3257_3703 148
930 3300059421 Ga0590071_007060 Ga0590071_007060_664_1110 148
931 3300059423 Ga0590074_009905 Ga0590074_009905_59_508 148
932 3300059424 Ga0590075_000275 Ga0590075_000275_8794_9243 148
933 3300059424 Ga0590075_007624 Ga0590075_007624_91_537 148
934 3300059426 Ga0590077_000049 Ga0590077_000049_3954_4403 148
935 3300059426 Ga0590077_001543 Ga0590077_001543_1511_1957 148
936 3300060353 Ga0501082_0010321 Ga0501082_0010321_1061_1510 148
937 3300061734 Ga0530510_0001774 Ga0530510_0001774_1532_1981 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

84

165

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

78

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.9138 37 132
3guf-assembly1.cif.gz_B crystal structure of the hspa from xanthomonas axonopodis 0.8995 37 134
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8979 42 132
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8943 41 132
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8896 37 132
ID Description Score Start End Superfamily
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9057 39 135 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8943 41 132 2.60.40.790
af_K7KYJ0_12_113_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8919 37 134 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.888 38 133 2.60.40.790
af_C0PJF1_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8869 37 135 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A3M1PHI6-F1-model_v4 Hsp20/alpha crystallin family protein 0.9259 37 145
AF-A0A0L0H616-F1-model_v4 SHSP domain-containing protein 0.9258 39 145
AF-A0A7V5G6R0-F1-model_v4 Hsp20/alpha crystallin family protein 0.9226 39 134
AF-A0A2D4Z8W5-F1-model_v4 deleted 0.9163 39 147
AF-A0A7V5G6R0-F1-model_v4 Hsp20/alpha crystallin family protein 0.9137 39 134

Feature Viewer

pLDDT pTM Quality
83.03 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map