F486231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 340 | 1874 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300046500|Ga0495596_0000041|Ga0495596_0000041_64841_66136 |
| Length | 431 |
| Sequence | MIRNEKRRLSVETGSRHQGNKELERIPLRALRVAGLMYAPVRAIYCINATRTHPGKGLTGFFISPSQHKKRLSNTLCTVMRGEVLYSLIKPALFRIEAEHAHGLALRALRLAAPSRAPSFPAALASQVAGLSFPNPVGMAAGFDKDGEVPDALLGMGFGFAEVGSITPLPQSGNPRPRLFRLVEDRAVINRMGFNNGGAQVAVDRLEARLGKPGVLGINIGANKDSTDRVADYAIMARLMAPLASYLAVNISSPNTPGLRALQDESALTGLLDAVIEARDAACPEGKRPPVFLKVAPDLEPADIDAIARIAIDKRLGALIVSNTTISRPTLVSVHGGETGGLSGAPLRDLAQQRLRDFRKATGGAVSLVGVGGIATAQDAWARIRAGASLVQLYSAMVYEGPTIARVICKGLSELMKRDGFASIAEAVGTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 205 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 206 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 267 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 276 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 277 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 284 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 285 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 288 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 289 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 303 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 304 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 305 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 317 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 318 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 319 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 320 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 321 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 322 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 323 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 324 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 325 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 326 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 327 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 328 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 329 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 330 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 331 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 332 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 333 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 334 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 335 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 336 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 337 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 338 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 339 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 340 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.33 |
| Metatranscriptomes | 0 |
| Isolates | 2.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.28 |
| Nodule | 0.21 |
| Rhizoplane | 1.49 |
| Rhizosphere | 82.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495596_0000041 | 3300046500 | Bacteria | 93277 |
| 2 | SwRhRL2b_contig_1406535 | 2162886007 | Bacteria | 6769 |
| 3 | JGI24736J21556_1000072 | 3300001904 | Bacteria | 16499 |
| 4 | JGI24736J21556_1005886 | 3300001904 | Bacteria | 2071 |
| 5 | JGI24741J21665_1000687 | 3300001915 | Bacteria | 10222 |
| 6 | JGI24752J21851_1000272 | 3300001976 | Bacteria | 7208 |
| 7 | JGI24752J21851_1000964 | 3300001976 | Bacteria | 3929 |
| 8 | JGI24740J21852_10000442 | 3300001979 | Bacteria | 17721 |
| 9 | JGI24740J21852_10003459 | 3300001979 | Bacteria | 6936 |
| 10 | JGI24740J21852_10007263 | 3300001979 | Bacteria | 4514 |
| 11 | JGI24740J21852_10039116 | 3300001979 | Bacteria | 1450 |
| 12 | JGI24739J22299_10001723 | 3300001989 | Bacteria | 8326 |
| 13 | JGI24739J22299_10006356 | 3300001989 | Bacteria | 4462 |
| 14 | JGI24739J22299_10011748 | 3300001989 | Bacteria | 3227 |
| 15 | JGI24739J22299_10016266 | 3300001989 | Bacteria | 2694 |
| 16 | JGI24739J22299_10028146 | 3300001989 | Bacteria | 1961 |
| 17 | JGI24737J22298_10000252 | 3300001990 | Bacteria | 17703 |
| 18 | JGI24737J22298_10000790 | 3300001990 | Bacteria | 11221 |
| 19 | JGI24737J22298_10001283 | 3300001990 | Bacteria | 8895 |
| 20 | JGI24735J21928_10003014 | 3300002067 | Bacteria | 5791 |
| 21 | JGI24735J21928_10008091 | 3300002067 | Bacteria | 3411 |
| 22 | JGI24750J21931_1000348 | 3300002070 | Bacteria | 7846 |
| 23 | JGI24748J21848_1000033 | 3300002074 | Bacteria | 78443 |
| 24 | JGI24738J21930_10000782 | 3300002075 | Bacteria | 9112 |
| 25 | JGI24738J21930_10000879 | 3300002075 | Bacteria | 8611 |
| 26 | JGI24738J21930_10002203 | 3300002075 | Bacteria | 5183 |
| 27 | JGI24738J21930_10003362 | 3300002075 | Bacteria | 4054 |
| 28 | JGI24738J21930_10004478 | 3300002075 | Bacteria | 3417 |
| 29 | JGI24034J26672_10000032 | 3300002239 | Bacteria | 89175 |
| 30 | JGI24751J29686_10000166 | 3300002459 | Bacteria | 30777 |
| 31 | JGI24751J29686_10000483 | 3300002459 | Bacteria | 11826 |
| 32 | JGI24751J29686_10001949 | 3300002459 | Bacteria | 4212 |
| 33 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 34 | Ga0055542_1011823 | 3300003762 | Bacteria | 1532 |
| 35 | Ga0055536_1003199 | 3300003781 | Bacteria | 8877 |
| 36 | Ga0055536_1004985 | 3300003781 | Bacteria | 6599 |
| 37 | Ga0055536_1004999 | 3300003781 | Bacteria | 6587 |
| 38 | Ga0055536_1006826 | 3300003781 | Bacteria | 5221 |
| 39 | Ga0055530_10000526 | 3300003791 | Bacteria | 33232 |
| 40 | Ga0055530_10004955 | 3300003791 | Bacteria | 6587 |
| 41 | Ga0055531_10000294 | 3300003794 | Bacteria | 49839 |
| 42 | Ga0055531_10000563 | 3300003794 | Bacteria | 32623 |
| 43 | Ga0055531_10005290 | 3300003794 | Bacteria | 7573 |
| 44 | Ga0055531_10006533 | 3300003794 | Bacteria | 6605 |
| 45 | Ga0065704_10001107 | 3300005289 | Bacteria | 9540 |
| 46 | Ga0065704_10070157 | 3300005289 | Bacteria | 211668 |
| 47 | Ga0065704_10074818 | 3300005289 | Bacteria | 5988 |
| 48 | Ga0070658_10000264 | 3300005327 | Bacteria | 46199 |
| 49 | Ga0070658_10000688 | 3300005327 | Bacteria | 29272 |
| 50 | Ga0070658_10011548 | 3300005327 | Bacteria | 7085 |
| 51 | Ga0070658_10023406 | 3300005327 | Bacteria | 4959 |
| 52 | Ga0070658_10060390 | 3300005327 | Bacteria | 3087 |
| 53 | Ga0070658_10076428 | 3300005327 | Bacteria | 2746 |
| 54 | Ga0070658_10076867 | 3300005327 | Bacteria | 2738 |
| 55 | Ga0070658_10077708 | 3300005327 | Bacteria | 2723 |
| 56 | Ga0070658_10080455 | 3300005327 | Bacteria | 2676 |
| 57 | Ga0070658_10099604 | 3300005327 | Bacteria | 2401 |
| 58 | Ga0070676_10002905 | 3300005328 | Bacteria | 8851 |
| 59 | Ga0070676_10061638 | 3300005328 | Bacteria | 2230 |
| 60 | Ga0070683_100188795 | 3300005329 | Bacteria | 1956 |
| 61 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 62 | Ga0070690_100029524 | 3300005330 | Bacteria | 3402 |
| 63 | Ga0070670_100000202 | 3300005331 | Bacteria | 55420 |
| 64 | Ga0070670_100002165 | 3300005331 | Bacteria | 16136 |
| 65 | Ga0070670_100009373 | 3300005331 | Bacteria | 8357 |
| 66 | Ga0070670_100020528 | 3300005331 | Bacteria | 5680 |
| 67 | Ga0070670_100064787 | 3300005331 | Bacteria | 3135 |
| 68 | Ga0070670_100069540 | 3300005331 | Bacteria | 3022 |
| 69 | Ga0070670_100124679 | 3300005331 | Bacteria | 2223 |
| 70 | Ga0070670_100293249 | 3300005331 | Bacteria | 1422 |
| 71 | Ga0070677_10018547 | 3300005333 | Bacteria | 2507 |
| 72 | Ga0068869_100000353 | 3300005334 | Bacteria | 24652 |
| 73 | Ga0068869_100003780 | 3300005334 | Bacteria | 9326 |
| 74 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 75 | Ga0070666_10000067 | 3300005335 | Bacteria | 76560 |
| 76 | Ga0070666_10047300 | 3300005335 | Bacteria | 2887 |
| 77 | Ga0070666_10072151 | 3300005335 | Bacteria | 2351 |
| 78 | Ga0070666_10102674 | 3300005335 | Bacteria | 1972 |
| 79 | Ga0070680_100021021 | 3300005336 | Bacteria | 5182 |
| 80 | Ga0068868_100000053 | 3300005338 | Bacteria | 65580 |
| 81 | Ga0068868_100001128 | 3300005338 | Bacteria | 18247 |
| 82 | Ga0070660_100000091 | 3300005339 | Bacteria | 54397 |
| 83 | Ga0070660_100001677 | 3300005339 | Bacteria | 15200 |
| 84 | Ga0070660_100010408 | 3300005339 | Bacteria | 6574 |
| 85 | Ga0070660_100012472 | 3300005339 | Bacteria | 6070 |
| 86 | Ga0070660_100031466 | 3300005339 | Bacteria | 3985 |
| 87 | Ga0070660_100033444 | 3300005339 | Bacteria | 3876 |
| 88 | Ga0070660_100067586 | 3300005339 | Bacteria | 2785 |
| 89 | Ga0070660_100075077 | 3300005339 | Bacteria | 2646 |
| 90 | Ga0070660_100093062 | 3300005339 | Bacteria | 2380 |
| 91 | Ga0070689_100012518 | 3300005340 | Bacteria | 6113 |
| 92 | Ga0070661_100041541 | 3300005344 | Bacteria | 3356 |
| 93 | Ga0070661_100076468 | 3300005344 | Bacteria | 2467 |
| 94 | Ga0070692_10014412 | 3300005345 | Bacteria | 3713 |
| 95 | Ga0070692_10016225 | 3300005345 | Bacteria | 3541 |
| 96 | Ga0070692_10018483 | 3300005345 | Bacteria | 3354 |
| 97 | Ga0070668_100004154 | 3300005347 | Bacteria | 10726 |
| 98 | Ga0070668_100005795 | 3300005347 | Bacteria | 9163 |
| 99 | Ga0070668_100007848 | 3300005347 | Bacteria | 7925 |
| 100 | Ga0070668_100039607 | 3300005347 | Bacteria | 3603 |
| 101 | Ga0070668_100042844 | 3300005347 | Bacteria | 3469 |
| 102 | Ga0070668_100086269 | 3300005347 | Bacteria | 2468 |
| 103 | Ga0070668_100189959 | 3300005347 | Bacteria | 1682 |
| 104 | Ga0070669_100000029 | 3300005353 | Bacteria | 163005 |
| 105 | Ga0070669_100000031 | 3300005353 | Bacteria | 154042 |
| 106 | Ga0070669_100000489 | 3300005353 | Bacteria | 29993 |
| 107 | Ga0070669_100001511 | 3300005353 | Bacteria | 16803 |
| 108 | Ga0070669_100004512 | 3300005353 | Bacteria | 10047 |
| 109 | Ga0070669_100016060 | 3300005353 | Bacteria | 5341 |
| 110 | Ga0070669_100171417 | 3300005353 | Bacteria | 1692 |
| 111 | Ga0070675_100021009 | 3300005354 | Bacteria | 5213 |
| 112 | Ga0070675_100075387 | 3300005354 | Bacteria | 2804 |
| 113 | Ga0070675_100134596 | 3300005354 | Bacteria | 2108 |
| 114 | Ga0070675_100174417 | 3300005354 | Bacteria | 1856 |
| 115 | Ga0070671_100000016 | 3300005355 | Bacteria | 156166 |
| 116 | Ga0070671_100003107 | 3300005355 | Bacteria | 12932 |
| 117 | Ga0070671_100030763 | 3300005355 | Bacteria | 4430 |
| 118 | Ga0070671_100036033 | 3300005355 | Bacteria | 4101 |
| 119 | Ga0070671_100182242 | 3300005355 | Bacteria | 1778 |
| 120 | Ga0070674_100017727 | 3300005356 | Bacteria | 4486 |
| 121 | Ga0070674_100224205 | 3300005356 | Bacteria | 1464 |
| 122 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 123 | Ga0070673_100003541 | 3300005364 | Bacteria | 9736 |
| 124 | Ga0070673_100024270 | 3300005364 | Bacteria | 4443 |
| 125 | Ga0070688_100000409 | 3300005365 | Bacteria | 21819 |
| 126 | Ga0070659_100000565 | 3300005366 | Bacteria | 27071 |
| 127 | Ga0070659_100010545 | 3300005366 | Bacteria | 6803 |
| 128 | Ga0070659_100035372 | 3300005366 | Bacteria | 3890 |
| 129 | Ga0070659_100102350 | 3300005366 | Bacteria | 2306 |
| 130 | Ga0070659_100229043 | 3300005366 | Bacteria | 1535 |
| 131 | Ga0070659_100375268 | 3300005366 | Bacteria | 1197 |
| 132 | Ga0070667_100000193 | 3300005367 | Bacteria | 72859 |
| 133 | Ga0070667_100000513 | 3300005367 | Bacteria | 39042 |
| 134 | Ga0070667_100001750 | 3300005367 | Bacteria | 19407 |
| 135 | Ga0070667_100002064 | 3300005367 | Bacteria | 17776 |
| 136 | Ga0070667_100017003 | 3300005367 | Bacteria | 6022 |
| 137 | Ga0070667_100038186 | 3300005367 | Bacteria | 4026 |
| 138 | Ga0070667_100042729 | 3300005367 | Bacteria | 3803 |
| 139 | Ga0070667_100047513 | 3300005367 | Bacteria | 3611 |
| 140 | Ga0070667_100072436 | 3300005367 | Bacteria | 2936 |
| 141 | Ga0070667_100156553 | 3300005367 | Bacteria | 2004 |
| 142 | Ga0070663_100010120 | 3300005455 | Bacteria | 5868 |
| 143 | Ga0070663_100040594 | 3300005455 | Bacteria | 3259 |
| 144 | Ga0070662_100000854 | 3300005457 | Bacteria | 18719 |
| 145 | Ga0070662_100006752 | 3300005457 | Bacteria | 7419 |
| 146 | Ga0070662_100007013 | 3300005457 | Bacteria | 7289 |
| 147 | Ga0070662_100099640 | 3300005457 | Bacteria | 2197 |
| 148 | Ga0070662_100102368 | 3300005457 | Bacteria | 2170 |
| 149 | Ga0070662_100167334 | 3300005457 | Bacteria | 1724 |
| 150 | Ga0070662_100262225 | 3300005457 | Bacteria | 1392 |
| 151 | Ga0070681_10224374 | 3300005458 | Bacteria | 1794 |
| 152 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 153 | Ga0068867_100000662 | 3300005459 | Bacteria | 22816 |
| 154 | Ga0068867_100008991 | 3300005459 | Bacteria | 7047 |
| 155 | Ga0068867_100021550 | 3300005459 | Bacteria | 4598 |
| 156 | Ga0070685_10005656 | 3300005466 | Bacteria | 6344 |
| 157 | Ga0070679_100088751 | 3300005530 | Bacteria | 3078 |
| 158 | Ga0070679_100130951 | 3300005530 | Bacteria | 2490 |
| 159 | Ga0070684_100270390 | 3300005535 | Bacteria | 1556 |
| 160 | Ga0068853_100002629 | 3300005539 | Bacteria | 13520 |
| 161 | Ga0068853_100015604 | 3300005539 | Bacteria | 6241 |
| 162 | Ga0068853_100084056 | 3300005539 | Bacteria | 2789 |
| 163 | Ga0068853_100093832 | 3300005539 | Bacteria | 2643 |
| 164 | Ga0068853_100233154 | 3300005539 | Bacteria | 1684 |
| 165 | Ga0070672_100033768 | 3300005543 | Bacteria | 3877 |
| 166 | Ga0070672_100042772 | 3300005543 | Bacteria | 3489 |
| 167 | Ga0070672_100102124 | 3300005543 | Bacteria | 2327 |
| 168 | Ga0070686_100000035 | 3300005544 | Bacteria | 108191 |
| 169 | Ga0070686_100079456 | 3300005544 | Bacteria | 2168 |
| 170 | Ga0070695_100012457 | 3300005545 | Bacteria | 5105 |
| 171 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 172 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 173 | Ga0070665_100000296 | 3300005548 | Bacteria | 78411 |
| 174 | Ga0070665_100003329 | 3300005548 | Bacteria | 17217 |
| 175 | Ga0070665_100005502 | 3300005548 | Bacteria | 13039 |
| 176 | Ga0070665_100013198 | 3300005548 | Bacteria | 8322 |
| 177 | Ga0070704_100116534 | 3300005549 | Bacteria | 2043 |
| 178 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 179 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 180 | Ga0068855_100028845 | 3300005563 | Bacteria | 6640 |
| 181 | Ga0068855_100091907 | 3300005563 | Bacteria | 3500 |
| 182 | Ga0068855_100157405 | 3300005563 | Bacteria | 2580 |
| 183 | Ga0068855_100261371 | 3300005563 | Bacteria | 1928 |
| 184 | Ga0068855_100281569 | 3300005563 | Bacteria | 1846 |
| 185 | Ga0068855_100637339 | 3300005563 | Bacteria | 1146 |
| 186 | Ga0070664_100023883 | 3300005564 | Bacteria | 5051 |
| 187 | Ga0070664_100037350 | 3300005564 | Bacteria | 4084 |
| 188 | Ga0070664_100186001 | 3300005564 | Bacteria | 1849 |
| 189 | Ga0070664_100306681 | 3300005564 | Bacteria | 1436 |
| 190 | Ga0068857_100005757 | 3300005577 | Bacteria | 10597 |
| 191 | Ga0068857_100013218 | 3300005577 | Bacteria | 7193 |
| 192 | Ga0068857_100013971 | 3300005577 | Bacteria | 6986 |
| 193 | Ga0068857_100056259 | 3300005577 | Bacteria | 3491 |
| 194 | Ga0068857_100068155 | 3300005577 | Bacteria | 3167 |
| 195 | Ga0068854_100000751 | 3300005578 | Bacteria | 19185 |
| 196 | Ga0068854_100003675 | 3300005578 | Bacteria | 9599 |
| 197 | Ga0068854_100010543 | 3300005578 | Bacteria | 5996 |
| 198 | Ga0068854_100019212 | 3300005578 | Bacteria | 4600 |
| 199 | Ga0068854_100271665 | 3300005578 | Bacteria | 1361 |
| 200 | Ga0068854_100275528 | 3300005578 | Bacteria | 1352 |
| 201 | Ga0068856_100008084 | 3300005614 | Bacteria | 10270 |
| 202 | Ga0068856_100416555 | 3300005614 | Bacteria | 1363 |
| 203 | Ga0068852_100039475 | 3300005616 | Bacteria | 3974 |
| 204 | Ga0068852_100120905 | 3300005616 | Bacteria | 2397 |
| 205 | Ga0068852_100199235 | 3300005616 | Bacteria | 1894 |
| 206 | Ga0068852_100345976 | 3300005616 | Bacteria | 1450 |
| 207 | Ga0068852_100448774 | 3300005616 | Bacteria | 1276 |
| 208 | Ga0068859_100000110 | 3300005617 | Bacteria | 77515 |
| 209 | Ga0068859_100006262 | 3300005617 | Bacteria | 12072 |
| 210 | Ga0068859_100010390 | 3300005617 | Bacteria | 9367 |
| 211 | Ga0068859_100031118 | 3300005617 | Bacteria | 5356 |
| 212 | Ga0068859_100052534 | 3300005617 | Bacteria | 4097 |
| 213 | Ga0068859_100067773 | 3300005617 | Bacteria | 3604 |
| 214 | Ga0068864_100000123 | 3300005618 | Bacteria | 75407 |
| 215 | Ga0068864_100000194 | 3300005618 | Bacteria | 55652 |
| 216 | Ga0068864_100001925 | 3300005618 | Bacteria | 17046 |
| 217 | Ga0068864_100003050 | 3300005618 | Bacteria | 13831 |
| 218 | Ga0068864_100019097 | 3300005618 | Bacteria | 5729 |
| 219 | Ga0068861_100004044 | 3300005719 | Bacteria | 9820 |
| 220 | Ga0068861_100020401 | 3300005719 | Bacteria | 4747 |
| 221 | Ga0068861_100032369 | 3300005719 | Bacteria | 3848 |
| 222 | Ga0068851_10023612 | 3300005834 | Bacteria | 3007 |
| 223 | Ga0068851_10036736 | 3300005834 | Bacteria | 2453 |
| 224 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 225 | Ga0068863_100000258 | 3300005841 | Bacteria | 55428 |
| 226 | Ga0068863_100000466 | 3300005841 | Bacteria | 41328 |
| 227 | Ga0068863_100004018 | 3300005841 | Bacteria | 14527 |
| 228 | Ga0068863_100007016 | 3300005841 | Bacteria | 11040 |
| 229 | Ga0068863_100008448 | 3300005841 | Bacteria | 10058 |
| 230 | Ga0068863_100015266 | 3300005841 | Bacteria | 7380 |
| 231 | Ga0068863_100020635 | 3300005841 | Bacteria | 6295 |
| 232 | Ga0068863_100038627 | 3300005841 | Bacteria | 4541 |
| 233 | Ga0068863_100052537 | 3300005841 | Bacteria | 3862 |
| 234 | Ga0068863_100087584 | 3300005841 | Bacteria | 2951 |
| 235 | Ga0068863_100392061 | 3300005841 | Bacteria | 1357 |
| 236 | Ga0068858_100000620 | 3300005842 | Bacteria | 36979 |
| 237 | Ga0068858_100001165 | 3300005842 | Bacteria | 27252 |
| 238 | Ga0068858_100002313 | 3300005842 | Bacteria | 19263 |
| 239 | Ga0068858_100043485 | 3300005842 | Bacteria | 4165 |
| 240 | Ga0068858_100050995 | 3300005842 | Bacteria | 3829 |
| 241 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 242 | Ga0068860_100000473 | 3300005843 | Bacteria | 49993 |
| 243 | Ga0068860_100006941 | 3300005843 | Bacteria | 11350 |
| 244 | Ga0068860_100015365 | 3300005843 | Bacteria | 7479 |
| 245 | Ga0068860_100023060 | 3300005843 | Bacteria | 6020 |
| 246 | Ga0068860_100045232 | 3300005843 | Bacteria | 4197 |
| 247 | Ga0068860_100056396 | 3300005843 | Bacteria | 3735 |
| 248 | Ga0068860_100383414 | 3300005843 | Bacteria | 1388 |
| 249 | Ga0068862_100000043 | 3300005844 | Bacteria | 164356 |
| 250 | Ga0068862_100000059 | 3300005844 | Bacteria | 136840 |
| 251 | Ga0068862_100000146 | 3300005844 | Bacteria | 80138 |
| 252 | Ga0068862_100000289 | 3300005844 | Bacteria | 55428 |
| 253 | Ga0068862_100000781 | 3300005844 | Bacteria | 31565 |
| 254 | Ga0068862_100001131 | 3300005844 | Bacteria | 25309 |
| 255 | Ga0068862_100007304 | 3300005844 | Bacteria | 9173 |
| 256 | Ga0068862_100011830 | 3300005844 | Bacteria | 7206 |
| 257 | Ga0068862_100014765 | 3300005844 | Bacteria | 6487 |
| 258 | Ga0068862_100065212 | 3300005844 | Bacteria | 3136 |
| 259 | Ga0068862_100192213 | 3300005844 | Bacteria | 1837 |
| 260 | Ga0070717_10063847 | 3300006028 | Bacteria | 3058 |
| 261 | Ga0075365_10008874 | 3300006038 | Bacteria | 5740 |
| 262 | Ga0075368_10000200 | 3300006042 | Bacteria | 16589 |
| 263 | Ga0075368_10000388 | 3300006042 | Bacteria | 12955 |
| 264 | Ga0075363_100155871 | 3300006048 | Bacteria | 1291 |
| 265 | Ga0075364_10000812 | 3300006051 | Bacteria | 16485 |
| 266 | Ga0075362_10000043 | 3300006177 | Bacteria | 44587 |
| 267 | Ga0075362_10007412 | 3300006177 | Bacteria | 4154 |
| 268 | Ga0075367_10004091 | 3300006178 | Bacteria | 7063 |
| 269 | Ga0075367_10009645 | 3300006178 | Bacteria | 5053 |
| 270 | Ga0075369_10003398 | 3300006186 | Bacteria | 5790 |
| 271 | Ga0075366_10000830 | 3300006195 | Bacteria | 14848 |
| 272 | Ga0075366_10026750 | 3300006195 | Bacteria | 3380 |
| 273 | Ga0075366_10069262 | 3300006195 | Bacteria | 2100 |
| 274 | Ga0097621_100084921 | 3300006237 | Bacteria | 2640 |
| 275 | Ga0075370_10000241 | 3300006353 | Bacteria | 19620 |
| 276 | Ga0075370_10001693 | 3300006353 | Bacteria | 9784 |
| 277 | Ga0075370_10021447 | 3300006353 | Bacteria | 3539 |
| 278 | Ga0075370_10044358 | 3300006353 | Bacteria | 2514 |
| 279 | Ga0068871_100025318 | 3300006358 | Bacteria | 4615 |
| 280 | Ga0068871_100069389 | 3300006358 | Bacteria | 2894 |
| 281 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 282 | Ga0068865_100000928 | 3300006881 | Bacteria | 16628 |
| 283 | Ga0068865_100015234 | 3300006881 | Bacteria | 4900 |
| 284 | Ga0097620_100000110 | 3300006931 | Bacteria | 77515 |
| 285 | Ga0097620_100006261 | 3300006931 | Bacteria | 12072 |
| 286 | Ga0097620_100010387 | 3300006931 | Bacteria | 9367 |
| 287 | Ga0097620_100031117 | 3300006931 | Bacteria | 5356 |
| 288 | Ga0097620_100052539 | 3300006931 | Bacteria | 4097 |
| 289 | Ga0097620_100067773 | 3300006931 | Bacteria | 3604 |
| 290 | Ga0079104_1013105 | 3300006946 | Bacteria | 2572 |
| 291 | Ga0105251_10001504 | 3300009011 | Bacteria | 20016 |
| 292 | Ga0105251_10003378 | 3300009011 | Bacteria | 11612 |
| 293 | Ga0105240_10016757 | 3300009093 | Bacteria | 9911 |
| 294 | Ga0105240_10025944 | 3300009093 | Bacteria | 7697 |
| 295 | Ga0105240_10196399 | 3300009093 | Bacteria | 2368 |
| 296 | Ga0105240_10335659 | 3300009093 | Bacteria | 1718 |
| 297 | Ga0105245_10002121 | 3300009098 | Bacteria | 17965 |
| 298 | Ga0105245_10067957 | 3300009098 | Bacteria | 3228 |
| 299 | Ga0105247_10002974 | 3300009101 | Bacteria | 11242 |
| 300 | Ga0105247_10003512 | 3300009101 | Bacteria | 10204 |
| 301 | Ga0105243_10000054 | 3300009148 | Bacteria | 136517 |
| 302 | Ga0105241_10002058 | 3300009174 | Bacteria | 15192 |
| 303 | Ga0105241_10273428 | 3300009174 | Bacteria | 1440 |
| 304 | Ga0105242_10000315 | 3300009176 | Bacteria | 38764 |
| 305 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 306 | Ga0105248_10001592 | 3300009177 | Bacteria | 25260 |
| 307 | Ga0105248_10002301 | 3300009177 | Bacteria | 21148 |
| 308 | Ga0105248_10020496 | 3300009177 | Bacteria | 7326 |
| 309 | Ga0105248_10082687 | 3300009177 | Bacteria | 3612 |
| 310 | Ga0105237_10019685 | 3300009545 | Bacteria | 6967 |
| 311 | Ga0105237_10036210 | 3300009545 | Bacteria | 4992 |
| 312 | Ga0105238_10043038 | 3300009551 | Bacteria | 4570 |
| 313 | Ga0105238_10053762 | 3300009551 | Bacteria | 4046 |
| 314 | Ga0105238_10375196 | 3300009551 | Bacteria | 1413 |
| 315 | Ga0105238_10392002 | 3300009551 | Bacteria | 1381 |
| 316 | Ga0105249_10000065 | 3300009553 | Bacteria | 151159 |
| 317 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 318 | Ga0105249_10000099 | 3300009553 | Bacteria | 119885 |
| 319 | Ga0105249_10015660 | 3300009553 | Bacteria | 6715 |
| 320 | Ga0105249_10077646 | 3300009553 | Bacteria | 3080 |
| 321 | Ga0105249_10352021 | 3300009553 | Bacteria | 1492 |
| 322 | Ga0105239_10122921 | 3300010375 | Bacteria | 2884 |
| 323 | Ga0105246_10001552 | 3300011119 | Bacteria | 13642 |
| 324 | Ga0105246_10116444 | 3300011119 | Bacteria | 1973 |
| 325 | Ga0157373_10026035 | 3300013100 | Bacteria | 4227 |
| 326 | Ga0157373_10030029 | 3300013100 | Bacteria | 3912 |
| 327 | Ga0157373_10106188 | 3300013100 | Bacteria | 1975 |
| 328 | Ga0157373_10159299 | 3300013100 | Bacteria | 1588 |
| 329 | Ga0157373_10180303 | 3300013100 | Bacteria | 1487 |
| 330 | Ga0157371_10003444 | 3300013102 | Bacteria | 14349 |
| 331 | Ga0157371_10003542 | 3300013102 | Bacteria | 14084 |
| 332 | Ga0157371_10082391 | 3300013102 | Bacteria | 2278 |
| 333 | Ga0157371_10286725 | 3300013102 | Bacteria | 1190 |
| 334 | Ga0157370_10004235 | 3300013104 | Bacteria | 16599 |
| 335 | Ga0157370_10012917 | 3300013104 | Bacteria | 8631 |
| 336 | Ga0157370_10038879 | 3300013104 | Bacteria | 4602 |
| 337 | Ga0157370_10111513 | 3300013104 | Bacteria | 2557 |
| 338 | Ga0157370_10266460 | 3300013104 | Bacteria | 1583 |
| 339 | Ga0157369_10000137 | 3300013105 | Bacteria | 103542 |
| 340 | Ga0157369_10041344 | 3300013105 | Bacteria | 5032 |
| 341 | Ga0157369_10043291 | 3300013105 | Bacteria | 4907 |
| 342 | Ga0157369_10086851 | 3300013105 | Bacteria | 3340 |
| 343 | Ga0157369_10091533 | 3300013105 | Bacteria | 3246 |
| 344 | Ga0157369_10364151 | 3300013105 | Bacteria | 1501 |
| 345 | Ga0157374_10003253 | 3300013296 | Bacteria | 13645 |
| 346 | Ga0157374_10071841 | 3300013296 | Bacteria | 3264 |
| 347 | Ga0157378_10000154 | 3300013297 | Bacteria | 64986 |
| 348 | Ga0163162_10011913 | 3300013306 | Bacteria | 8478 |
| 349 | Ga0163162_10070948 | 3300013306 | Bacteria | 3536 |
| 350 | Ga0157372_10109822 | 3300013307 | Bacteria | 3159 |
| 351 | Ga0157372_10319837 | 3300013307 | Bacteria | 1807 |
| 352 | Ga0157372_10618067 | 3300013307 | Bacteria | 1263 |
| 353 | Ga0157375_10003825 | 3300013308 | Bacteria | 13053 |
| 354 | Ga0157375_10041209 | 3300013308 | Bacteria | 4457 |
| 355 | Ga0157375_10047504 | 3300013308 | Bacteria | 4193 |
| 356 | Ga0157375_10732439 | 3300013308 | Bacteria | 1141 |
| 357 | Ga0163163_10003287 | 3300014325 | Bacteria | 13706 |
| 358 | Ga0163163_10014503 | 3300014325 | Bacteria | 7247 |
| 359 | Ga0163163_10019974 | 3300014325 | Bacteria | 6302 |
| 360 | Ga0163163_10260670 | 3300014325 | Bacteria | 1784 |
| 361 | Ga0157380_10000040 | 3300014326 | Bacteria | 76401 |
| 362 | Ga0157380_10000851 | 3300014326 | Bacteria | 19120 |
| 363 | Ga0157380_10282422 | 3300014326 | Bacteria | 1520 |
| 364 | Ga0157379_10005418 | 3300014968 | Bacteria | 10961 |
| 365 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 366 | Ga0163161_10000614 | 3300017792 | Bacteria | 28529 |
| 367 | Ga0163161_10029862 | 3300017792 | Bacteria | 3875 |
| 368 | Ga0213873_10000026 | 3300021358 | Bacteria | 74525 |
| 369 | Ga0213876_10000149 | 3300021384 | Bacteria | 74548 |
| 370 | Ga0213876_10030099 | 3300021384 | Bacteria | 2862 |
| 371 | Ga0207672_1000235 | 3300025223 | Bacteria | 7751 |
| 372 | Ga0209147_101508 | 3300025229 | Bacteria | 8208 |
| 373 | Ga0209026_1004430 | 3300025250 | Bacteria | 4158 |
| 374 | Ga0209148_1001817 | 3300025254 | Bacteria | 8989 |
| 375 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 376 | Ga0209455_1000972 | 3300025272 | Bacteria | 14510 |
| 377 | Ga0209675_1000137 | 3300025291 | Bacteria | 98902 |
| 378 | Ga0209676_1000138 | 3300025292 | Bacteria | 178932 |
| 379 | Ga0209676_1000392 | 3300025292 | Bacteria | 79950 |
| 380 | Ga0209676_1000883 | 3300025292 | Bacteria | 38382 |
| 381 | Ga0209676_1001128 | 3300025292 | Bacteria | 29355 |
| 382 | Ga0209025_1012379 | 3300025294 | Bacteria | 5476 |
| 383 | Ga0209050_1000411 | 3300025298 | Bacteria | 79805 |
| 384 | Ga0209050_1000784 | 3300025298 | Bacteria | 45231 |
| 385 | Ga0209050_1001243 | 3300025298 | Bacteria | 29491 |
| 386 | Ga0209050_1019220 | 3300025298 | Bacteria | 2608 |
| 387 | Ga0209257_1000250 | 3300025304 | Bacteria | 124024 |
| 388 | Ga0209257_1000513 | 3300025304 | Bacteria | 67348 |
| 389 | Ga0209257_1000603 | 3300025304 | Bacteria | 59325 |
| 390 | Ga0209257_1002085 | 3300025304 | Bacteria | 21046 |
| 391 | Ga0207697_10000059 | 3300025315 | Bacteria | 45306 |
| 392 | Ga0207697_10000831 | 3300025315 | Bacteria | 17481 |
| 393 | Ga0207656_10037729 | 3300025321 | Bacteria | 2035 |
| 394 | Ga0207713_1001789 | 3300025735 | Bacteria | 16445 |
| 395 | Ga0207682_10018584 | 3300025893 | Bacteria | 2719 |
| 396 | Ga0207710_10038482 | 3300025900 | Bacteria | 2115 |
| 397 | Ga0207688_10003475 | 3300025901 | Bacteria | 8595 |
| 398 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 399 | Ga0207680_10000291 | 3300025903 | Bacteria | 23983 |
| 400 | Ga0207680_10050992 | 3300025903 | Bacteria | 2473 |
| 401 | Ga0207680_10059663 | 3300025903 | Bacteria | 2319 |
| 402 | Ga0207680_10092343 | 3300025903 | Bacteria | 1928 |
| 403 | Ga0207647_10000270 | 3300025904 | Bacteria | 42605 |
| 404 | Ga0207647_10001030 | 3300025904 | Bacteria | 21610 |
| 405 | Ga0207647_10001181 | 3300025904 | Bacteria | 20110 |
| 406 | Ga0207647_10012173 | 3300025904 | Bacteria | 6000 |
| 407 | Ga0207647_10013763 | 3300025904 | Bacteria | 5602 |
| 408 | Ga0207647_10032580 | 3300025904 | Bacteria | 3346 |
| 409 | Ga0207647_10053102 | 3300025904 | Bacteria | 2499 |
| 410 | Ga0207647_10063112 | 3300025904 | Bacteria | 2254 |
| 411 | Ga0207645_10003775 | 3300025907 | Bacteria | 11381 |
| 412 | Ga0207645_10013513 | 3300025907 | Bacteria | 5499 |
| 413 | Ga0207645_10096783 | 3300025907 | Bacteria | 1902 |
| 414 | Ga0207705_10000030 | 3300025909 | Bacteria | 239341 |
| 415 | Ga0207705_10000091 | 3300025909 | Bacteria | 110768 |
| 416 | Ga0207705_10000340 | 3300025909 | Bacteria | 42251 |
| 417 | Ga0207705_10002248 | 3300025909 | Bacteria | 14927 |
| 418 | Ga0207705_10007109 | 3300025909 | Bacteria | 8254 |
| 419 | Ga0207705_10014791 | 3300025909 | Bacteria | 5610 |
| 420 | Ga0207705_10027030 | 3300025909 | Bacteria | 4090 |
| 421 | Ga0207705_10047608 | 3300025909 | Bacteria | 3083 |
| 422 | Ga0207705_10051801 | 3300025909 | Bacteria | 2954 |
| 423 | Ga0207705_10067264 | 3300025909 | Bacteria | 2593 |
| 424 | Ga0207705_10159080 | 3300025909 | Bacteria | 1696 |
| 425 | Ga0207654_10002997 | 3300025911 | Bacteria | 8568 |
| 426 | Ga0207707_10357906 | 3300025912 | Bacteria | 1257 |
| 427 | Ga0207695_10002869 | 3300025913 | Bacteria | 25023 |
| 428 | Ga0207695_10004964 | 3300025913 | Bacteria | 17910 |
| 429 | Ga0207695_10035517 | 3300025913 | Bacteria | 5404 |
| 430 | Ga0207695_10273649 | 3300025913 | Bacteria | 1584 |
| 431 | Ga0207695_10385662 | 3300025913 | Bacteria | 1286 |
| 432 | Ga0207671_10002215 | 3300025914 | Bacteria | 21093 |
| 433 | Ga0207671_10002393 | 3300025914 | Bacteria | 20115 |
| 434 | Ga0207671_10062957 | 3300025914 | Bacteria | 2756 |
| 435 | Ga0207657_10000092 | 3300025919 | Bacteria | 85665 |
| 436 | Ga0207657_10000252 | 3300025919 | Bacteria | 57036 |
| 437 | Ga0207657_10014735 | 3300025919 | Bacteria | 7612 |
| 438 | Ga0207657_10016141 | 3300025919 | Bacteria | 7211 |
| 439 | Ga0207657_10021012 | 3300025919 | Bacteria | 6154 |
| 440 | Ga0207657_10031057 | 3300025919 | Bacteria | 4843 |
| 441 | Ga0207657_10032515 | 3300025919 | Bacteria | 4712 |
| 442 | Ga0207657_10033527 | 3300025919 | Bacteria | 4628 |
| 443 | Ga0207657_10036833 | 3300025919 | Bacteria | 4376 |
| 444 | Ga0207657_10047515 | 3300025919 | Bacteria | 3752 |
| 445 | Ga0207657_10063000 | 3300025919 | Bacteria | 3173 |
| 446 | Ga0207657_10076781 | 3300025919 | Bacteria | 2817 |
| 447 | Ga0207657_10096011 | 3300025919 | Bacteria | 2466 |
| 448 | Ga0207657_10236608 | 3300025919 | Bacteria | 1459 |
| 449 | Ga0207649_10001000 | 3300025920 | Bacteria | 17495 |
| 450 | Ga0207652_10040373 | 3300025921 | Bacteria | 3963 |
| 451 | Ga0207652_10076319 | 3300025921 | Bacteria | 2922 |
| 452 | Ga0207652_10267797 | 3300025921 | Bacteria | 1541 |
| 453 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 454 | Ga0207681_10000040 | 3300025923 | Bacteria | 147547 |
| 455 | Ga0207681_10000053 | 3300025923 | Bacteria | 110626 |
| 456 | Ga0207681_10002113 | 3300025923 | Bacteria | 12733 |
| 457 | Ga0207681_10004633 | 3300025923 | Bacteria | 8457 |
| 458 | Ga0207681_10007131 | 3300025923 | Bacteria | 6853 |
| 459 | Ga0207681_10016972 | 3300025923 | Bacteria | 4567 |
| 460 | Ga0207681_10042999 | 3300025923 | Bacteria | 3021 |
| 461 | Ga0207681_10149530 | 3300025923 | Bacteria | 1748 |
| 462 | Ga0207694_10001896 | 3300025924 | Bacteria | 17332 |
| 463 | Ga0207694_10026009 | 3300025924 | Bacteria | 4450 |
| 464 | Ga0207694_10070535 | 3300025924 | Bacteria | 2730 |
| 465 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 466 | Ga0207650_10000285 | 3300025925 | Bacteria | 52016 |
| 467 | Ga0207650_10019874 | 3300025925 | Bacteria | 4727 |
| 468 | Ga0207650_10038683 | 3300025925 | Bacteria | 3485 |
| 469 | Ga0207650_10043829 | 3300025925 | Bacteria | 3286 |
| 470 | Ga0207650_10091220 | 3300025925 | Bacteria | 2328 |
| 471 | Ga0207650_10319309 | 3300025925 | Bacteria | 1272 |
| 472 | Ga0207659_10010945 | 3300025926 | Bacteria | 5713 |
| 473 | Ga0207687_10005686 | 3300025927 | Bacteria | 8241 |
| 474 | Ga0207644_10000023 | 3300025931 | Bacteria | 156180 |
| 475 | Ga0207644_10000242 | 3300025931 | Bacteria | 37472 |
| 476 | Ga0207644_10002058 | 3300025931 | Bacteria | 13020 |
| 477 | Ga0207644_10007123 | 3300025931 | Bacteria | 7290 |
| 478 | Ga0207644_10011134 | 3300025931 | Bacteria | 5941 |
| 479 | Ga0207644_10054779 | 3300025931 | Bacteria | 2873 |
| 480 | Ga0207690_10024470 | 3300025932 | Bacteria | 3782 |
| 481 | Ga0207690_10035345 | 3300025932 | Bacteria | 3227 |
| 482 | Ga0207690_10149746 | 3300025932 | Bacteria | 1729 |
| 483 | Ga0207690_10205589 | 3300025932 | Bacteria | 1498 |
| 484 | Ga0207706_10000426 | 3300025933 | Bacteria | 45291 |
| 485 | Ga0207706_10006019 | 3300025933 | Bacteria | 11282 |
| 486 | Ga0207706_10009479 | 3300025933 | Bacteria | 8940 |
| 487 | Ga0207706_10015546 | 3300025933 | Bacteria | 6876 |
| 488 | Ga0207706_10042810 | 3300025933 | Bacteria | 4013 |
| 489 | Ga0207706_10051256 | 3300025933 | Bacteria | 3645 |
| 490 | Ga0207706_10083654 | 3300025933 | Bacteria | 2806 |
| 491 | Ga0207706_10111427 | 3300025933 | Bacteria | 2407 |
| 492 | Ga0207686_10022176 | 3300025934 | Bacteria | 3655 |
| 493 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 494 | Ga0207669_10002095 | 3300025937 | Bacteria | 8458 |
| 495 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 496 | Ga0207691_10000563 | 3300025940 | Bacteria | 37125 |
| 497 | Ga0207691_10035604 | 3300025940 | Bacteria | 4618 |
| 498 | Ga0207691_10082911 | 3300025940 | Bacteria | 2879 |
| 499 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 500 | Ga0207711_10001332 | 3300025941 | Bacteria | 23354 |
| 501 | Ga0207711_10003824 | 3300025941 | Bacteria | 12948 |
| 502 | Ga0207711_10172022 | 3300025941 | Bacteria | 1966 |
| 503 | Ga0207711_10221600 | 3300025941 | Bacteria | 1730 |
| 504 | Ga0207689_10000128 | 3300025942 | Bacteria | 64122 |
| 505 | Ga0207689_10001110 | 3300025942 | Bacteria | 25930 |
| 506 | Ga0207661_10083629 | 3300025944 | Bacteria | 2642 |
| 507 | Ga0207661_10165271 | 3300025944 | Bacteria | 1922 |
| 508 | Ga0207661_10309422 | 3300025944 | Bacteria | 1418 |
| 509 | Ga0207679_10086732 | 3300025945 | Bacteria | 2409 |
| 510 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 511 | Ga0207667_10000303 | 3300025949 | Bacteria | 68209 |
| 512 | Ga0207667_10002966 | 3300025949 | Bacteria | 21075 |
| 513 | Ga0207667_10006684 | 3300025949 | Bacteria | 13944 |
| 514 | Ga0207667_10100734 | 3300025949 | Bacteria | 2980 |
| 515 | Ga0207667_10116924 | 3300025949 | Bacteria | 2748 |
| 516 | Ga0207667_10179259 | 3300025949 | Bacteria | 2176 |
| 517 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 518 | Ga0207651_10004988 | 3300025960 | Bacteria | 6766 |
| 519 | Ga0207651_10046960 | 3300025960 | Bacteria | 2908 |
| 520 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 521 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 522 | Ga0207712_10000161 | 3300025961 | Bacteria | 69260 |
| 523 | Ga0207712_10004168 | 3300025961 | Bacteria | 9131 |
| 524 | Ga0207712_10007997 | 3300025961 | Bacteria | 6686 |
| 525 | Ga0207712_10088449 | 3300025961 | Bacteria | 2274 |
| 526 | Ga0207668_10000050 | 3300025972 | Bacteria | 98767 |
| 527 | Ga0207668_10000161 | 3300025972 | Bacteria | 46772 |
| 528 | Ga0207668_10000235 | 3300025972 | Bacteria | 37035 |
| 529 | Ga0207668_10001831 | 3300025972 | Bacteria | 12417 |
| 530 | Ga0207668_10058737 | 3300025972 | Bacteria | 2690 |
| 531 | Ga0207640_10000436 | 3300025981 | Bacteria | 25464 |
| 532 | Ga0207640_10000791 | 3300025981 | Bacteria | 17974 |
| 533 | Ga0207640_10008601 | 3300025981 | Bacteria | 5671 |
| 534 | Ga0207640_10033480 | 3300025981 | Bacteria | 3198 |
| 535 | Ga0207640_10098116 | 3300025981 | Bacteria | 2047 |
| 536 | Ga0207640_10235583 | 3300025981 | Bacteria | 1411 |
| 537 | Ga0207640_10289224 | 3300025981 | Bacteria | 1291 |
| 538 | Ga0207658_10000042 | 3300025986 | Bacteria | 134223 |
| 539 | Ga0207658_10000232 | 3300025986 | Bacteria | 58908 |
| 540 | Ga0207658_10000512 | 3300025986 | Bacteria | 35351 |
| 541 | Ga0207658_10000865 | 3300025986 | Bacteria | 25306 |
| 542 | Ga0207658_10001126 | 3300025986 | Bacteria | 21549 |
| 543 | Ga0207658_10003756 | 3300025986 | Bacteria | 10693 |
| 544 | Ga0207658_10004591 | 3300025986 | Bacteria | 9586 |
| 545 | Ga0207658_10010342 | 3300025986 | Bacteria | 6339 |
| 546 | Ga0207658_10040834 | 3300025986 | Bacteria | 3356 |
| 547 | Ga0207658_10118166 | 3300025986 | Bacteria | 2108 |
| 548 | Ga0207677_10001525 | 3300026023 | Bacteria | 12251 |
| 549 | Ga0207677_10004294 | 3300026023 | Bacteria | 7630 |
| 550 | Ga0207703_10003308 | 3300026035 | Bacteria | 13528 |
| 551 | Ga0207703_10004540 | 3300026035 | Bacteria | 11385 |
| 552 | Ga0207703_10018941 | 3300026035 | Bacteria | 5377 |
| 553 | Ga0207639_10000323 | 3300026041 | Bacteria | 33257 |
| 554 | Ga0207639_10023999 | 3300026041 | Bacteria | 4408 |
| 555 | Ga0207639_10037201 | 3300026041 | Bacteria | 3613 |
| 556 | Ga0207639_10078778 | 3300026041 | Bacteria | 2602 |
| 557 | Ga0207639_10128760 | 3300026041 | Bacteria | 2092 |
| 558 | Ga0207639_10225278 | 3300026041 | Bacteria | 1622 |
| 559 | Ga0207678_10000068 | 3300026067 | Bacteria | 81610 |
| 560 | Ga0207678_10001958 | 3300026067 | Bacteria | 18768 |
| 561 | Ga0207678_10008956 | 3300026067 | Bacteria | 8810 |
| 562 | Ga0207678_10061483 | 3300026067 | Bacteria | 3230 |
| 563 | Ga0207678_10091890 | 3300026067 | Bacteria | 2594 |
| 564 | Ga0207678_10203344 | 3300026067 | Bacteria | 1694 |
| 565 | Ga0207678_10287591 | 3300026067 | Bacteria | 1412 |
| 566 | Ga0207702_10001343 | 3300026078 | Bacteria | 24595 |
| 567 | Ga0207702_10002737 | 3300026078 | Bacteria | 16509 |
| 568 | Ga0207702_10003060 | 3300026078 | Bacteria | 15549 |
| 569 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 570 | Ga0207641_10000046 | 3300026088 | Bacteria | 180836 |
| 571 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 572 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 573 | Ga0207641_10003235 | 3300026088 | Bacteria | 14538 |
| 574 | Ga0207641_10003834 | 3300026088 | Bacteria | 13168 |
| 575 | Ga0207641_10004892 | 3300026088 | Bacteria | 11521 |
| 576 | Ga0207641_10006069 | 3300026088 | Bacteria | 10231 |
| 577 | Ga0207641_10054815 | 3300026088 | Bacteria | 3385 |
| 578 | Ga0207641_10077637 | 3300026088 | Bacteria | 2874 |
| 579 | Ga0207641_10160334 | 3300026088 | Bacteria | 2044 |
| 580 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 581 | Ga0207648_10003077 | 3300026089 | Bacteria | 17625 |
| 582 | Ga0207648_10005891 | 3300026089 | Bacteria | 12261 |
| 583 | Ga0207648_10067764 | 3300026089 | Bacteria | 3111 |
| 584 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 585 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 586 | Ga0207676_10001069 | 3300026095 | Bacteria | 20852 |
| 587 | Ga0207676_10007591 | 3300026095 | Bacteria | 7698 |
| 588 | Ga0207676_10008497 | 3300026095 | Bacteria | 7301 |
| 589 | Ga0207676_10011546 | 3300026095 | Bacteria | 6317 |
| 590 | Ga0207676_10041919 | 3300026095 | Bacteria | 3518 |
| 591 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 592 | Ga0207674_10000531 | 3300026116 | Bacteria | 49979 |
| 593 | Ga0207674_10008409 | 3300026116 | Bacteria | 11926 |
| 594 | Ga0207674_10018390 | 3300026116 | Bacteria | 7598 |
| 595 | Ga0207674_10057345 | 3300026116 | Bacteria | 3948 |
| 596 | Ga0207674_10069316 | 3300026116 | Bacteria | 3547 |
| 597 | Ga0207674_10088815 | 3300026116 | Bacteria | 3083 |
| 598 | Ga0207675_100000739 | 3300026118 | Bacteria | 32427 |
| 599 | Ga0207675_100001387 | 3300026118 | Bacteria | 24293 |
| 600 | Ga0207675_100007152 | 3300026118 | Bacteria | 10546 |
| 601 | Ga0207675_100108376 | 3300026118 | Bacteria | 2620 |
| 602 | Ga0207683_10127928 | 3300026121 | Bacteria | 2284 |
| 603 | Ga0207698_10014333 | 3300026142 | Bacteria | 5266 |
| 604 | Ga0207698_10041755 | 3300026142 | Bacteria | 3421 |
| 605 | Ga0207698_10055755 | 3300026142 | Bacteria | 3048 |
| 606 | Ga0207698_10137440 | 3300026142 | Bacteria | 2099 |
| 607 | Ga0207698_10147621 | 3300026142 | Bacteria | 2036 |
| 608 | Ga0207698_10272103 | 3300026142 | Bacteria | 1562 |
| 609 | Ga0207698_10330296 | 3300026142 | Bacteria | 1432 |
| 610 | Ga0209281_1014011 | 3300027111 | Bacteria | 1710 |
| 611 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 612 | Ga0209813_10000172 | 3300027866 | Bacteria | 21011 |
| 613 | Ga0209974_10011733 | 3300027876 | Bacteria | 2938 |
| 614 | Ga0209974_10014198 | 3300027876 | Bacteria | 2654 |
| 615 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 616 | Ga0268266_10000486 | 3300028379 | Bacteria | 56915 |
| 617 | Ga0268266_10000573 | 3300028379 | Bacteria | 50799 |
| 618 | Ga0268266_10008611 | 3300028379 | Bacteria | 9059 |
| 619 | Ga0268266_10012670 | 3300028379 | Bacteria | 7286 |
| 620 | Ga0268266_10091026 | 3300028379 | Bacteria | 2674 |
| 621 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 622 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 623 | Ga0268265_10000128 | 3300028380 | Bacteria | 96118 |
| 624 | Ga0268265_10000141 | 3300028380 | Bacteria | 91426 |
| 625 | Ga0268265_10002045 | 3300028380 | Bacteria | 15816 |
| 626 | Ga0268265_10006109 | 3300028380 | Bacteria | 8172 |
| 627 | Ga0268265_10009102 | 3300028380 | Bacteria | 6713 |
| 628 | Ga0268265_10060708 | 3300028380 | Bacteria | 2898 |
| 629 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 630 | Ga0268264_10000141 | 3300028381 | Bacteria | 170966 |
| 631 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 632 | Ga0268264_10001883 | 3300028381 | Bacteria | 19050 |
| 633 | Ga0268264_10004349 | 3300028381 | Bacteria | 12097 |
| 634 | Ga0268264_10004427 | 3300028381 | Bacteria | 11983 |
| 635 | Ga0268264_10012122 | 3300028381 | Bacteria | 7096 |
| 636 | Ga0268264_10016449 | 3300028381 | Bacteria | 6056 |
| 637 | Ga0268264_10019349 | 3300028381 | Bacteria | 5565 |
| 638 | Ga0268264_10383320 | 3300028381 | Bacteria | 1347 |
| 639 | Ga0307513_10021633 | 3300031456 | Bacteria | 7586 |
| 640 | Ga0307408_100026841 | 3300031548 | Bacteria | 3961 |
| 641 | Ga0307405_10121154 | 3300031731 | Bacteria | 1790 |
| 642 | Ga0307406_10024190 | 3300031901 | Bacteria | 3624 |
| 643 | Ga0307406_10049755 | 3300031901 | Bacteria | 2653 |
| 644 | Ga0307412_10002696 | 3300031911 | Bacteria | 9858 |
| 645 | Ga0307412_10004821 | 3300031911 | Bacteria | 7528 |
| 646 | Ga0307412_10039228 | 3300031911 | Bacteria | 3055 |
| 647 | Ga0307412_10094284 | 3300031911 | Bacteria | 2102 |
| 648 | Ga0307409_100005395 | 3300031995 | Bacteria | 7349 |
| 649 | Ga0307409_100077861 | 3300031995 | Bacteria | 2665 |
| 650 | Ga0307416_100050425 | 3300032002 | Bacteria | 3317 |
| 651 | Ga0307416_100081705 | 3300032002 | Bacteria | 2734 |
| 652 | Ga0307416_100119888 | 3300032002 | Bacteria | 2341 |
| 653 | Ga0307414_10000095 | 3300032004 | Bacteria | 67330 |
| 654 | Ga0307414_10001510 | 3300032004 | Bacteria | 12089 |
| 655 | Ga0307414_10041818 | 3300032004 | Bacteria | 3108 |
| 656 | Ga0307414_10091531 | 3300032004 | Bacteria | 2261 |
| 657 | Ga0307414_10103643 | 3300032004 | Bacteria | 2147 |
| 658 | Ga0307414_10128396 | 3300032004 | Bacteria | 1963 |
| 659 | Ga0307411_10058174 | 3300032005 | Bacteria | 2557 |
| 660 | Ga0307411_10162332 | 3300032005 | Bacteria | 1675 |
| 661 | Ga0373931_0074215 | 3300035691 | Bacteria | 1863 |
| 662 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 663 | Ga0395899_0001026 | 3300037312 | Bacteria | 25486 |
| 664 | Ga0395899_0017300 | 3300037312 | Bacteria | 5494 |
| 665 | Ga0395899_0061308 | 3300037312 | Bacteria | 2770 |
| 666 | Ga0395899_0085008 | 3300037312 | Bacteria | 2299 |
| 667 | Ga0395899_0129422 | 3300037312 | Bacteria | 1803 |
| 668 | Ga0395899_0157802 | 3300037312 | Bacteria | 1604 |
| 669 | Ga0395900_0000477 | 3300037418 | Bacteria | 56791 |
| 670 | Ga0395900_0005306 | 3300037418 | Bacteria | 13508 |
| 671 | Ga0395900_0023878 | 3300037418 | Bacteria | 6256 |
| 672 | Ga0395900_0024012 | 3300037418 | Bacteria | 6240 |
| 673 | Ga0395900_0105805 | 3300037418 | Bacteria | 2890 |
| 674 | Ga0395900_0142730 | 3300037418 | Bacteria | 2451 |
| 675 | Ga0395900_0166852 | 3300037418 | Bacteria | 2243 |
| 676 | Ga0395900_0294896 | 3300037418 | Bacteria | 1609 |
| 677 | Ga0395900_0350167 | 3300037418 | Bacteria | 1451 |
| 678 | Ga0395898_0038841 | 3300037466 | Bacteria | 4715 |
| 679 | Ga0395898_0067563 | 3300037466 | Bacteria | 3460 |
| 680 | Ga0395898_0215670 | 3300037466 | Bacteria | 1830 |
| 681 | Ga0395898_0324048 | 3300037466 | Bacteria | 1470 |
| 682 | Ga0395898_0392336 | 3300037466 | Bacteria | 1323 |
| 683 | Ga0395898_0650561 | 3300037466 | Bacteria | 996 |
| 684 | Ga0395905_0014452 | 3300037471 | Bacteria | 7537 |
| 685 | Ga0395905_0015256 | 3300037471 | Bacteria | 7305 |
| 686 | Ga0395905_0027502 | 3300037471 | Bacteria | 5363 |
| 687 | Ga0395905_0077760 | 3300037471 | Bacteria | 3109 |
| 688 | Ga0395905_0166336 | 3300037471 | Bacteria | 2073 |
| 689 | Ga0395905_0173159 | 3300037471 | Bacteria | 2027 |
| 690 | Ga0395905_0341485 | 3300037471 | Bacteria | 1388 |
| 691 | Ga0395905_0364896 | 3300037471 | Bacteria | 1337 |
| 692 | Ga0395901_0000275 | 3300038443 | Bacteria | 63659 |
| 693 | Ga0395901_0025148 | 3300038443 | Bacteria | 6112 |
| 694 | Ga0395901_0045532 | 3300038443 | Bacteria | 4553 |
| 695 | Ga0395901_0134298 | 3300038443 | Bacteria | 2600 |
| 696 | Ga0395901_0142581 | 3300038443 | Bacteria | 2518 |
| 697 | Ga0395901_0305273 | 3300038443 | Bacteria | 1649 |
| 698 | Ga0395901_0337637 | 3300038443 | Bacteria | 1557 |
| 699 | Ga0395901_0338215 | 3300038443 | Bacteria | 1555 |
| 700 | Ga0436365_0618422 | 3300039437 | Bacteria | 2873 |
| 701 | Ga0436365_1025078 | 3300039437 | Bacteria | 33251 |
| 702 | Ga0436362_0376260 | 3300039453 | Bacteria | 74620 |
| 703 | Ga0451837_0501092 | 3300041494 | Bacteria | 1491 |
| 704 | Ga0451853_1752212 | 3300041512 | Bacteria | 1730 |
| 705 | Ga0439448_0009342 | 3300042005 | Bacteria | 2889 |
| 706 | Ga0439448_0029685 | 3300042005 | Bacteria | 1731 |
| 707 | Ga0439432_013264 | 3300042006 | Bacteria | 2805 |
| 708 | Ga0439455_0031055 | 3300042012 | Bacteria | 1328 |
| 709 | Ga0439458_0000898 | 3300042157 | Bacteria | 7675 |
| 710 | Ga0466969_0000550 | 3300044656 | Bacteria | 20589 |
| 711 | Ga0466969_0012325 | 3300044656 | Bacteria | 4510 |
| 712 | Ga0466966_0000072 | 3300044684 | Bacteria | 65377 |
| 713 | Ga0466966_0000962 | 3300044684 | Bacteria | 18476 |
| 714 | Ga0466966_0005442 | 3300044684 | Bacteria | 8370 |
| 715 | Ga0466961_0001853 | 3300044693 | Bacteria | 13122 |
| 716 | Ga0466961_0052461 | 3300044693 | Bacteria | 2602 |
| 717 | Ga0466963_0012318 | 3300044694 | Bacteria | 5230 |
| 718 | Ga0453684_0502587 | 3300044712 | Bacteria | 1342 |
| 719 | Ga0466971_0007548 | 3300044719 | Bacteria | 4740 |
| 720 | Ga0466970_0002808 | 3300044765 | Bacteria | 8406 |
| 721 | Ga0466970_0007258 | 3300044765 | Bacteria | 5551 |
| 722 | Ga0466957_0007498 | 3300044842 | Bacteria | 6165 |
| 723 | Ga0466957_0025075 | 3300044842 | Bacteria | 3533 |
| 724 | Ga0466957_0078106 | 3300044842 | Bacteria | 2057 |
| 725 | Ga0466959_0000225 | 3300045049 | Bacteria | 36568 |
| 726 | Ga0466959_0006960 | 3300045049 | Bacteria | 7901 |
| 727 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 728 | Ga0466958_0002556 | 3300045836 | Bacteria | 9180 |
| 729 | Ga0466967_0085852 | 3300045976 | Bacteria | 2850 |
| 730 | Ga0495617_008778 | 3300046452 | Bacteria | 3480 |
| 731 | Ga0495627_000336 | 3300046453 | Bacteria | 44344 |
| 732 | Ga0495627_000684 | 3300046453 | Bacteria | 26010 |
| 733 | Ga0495627_002181 | 3300046453 | Bacteria | 9776 |
| 734 | Ga0495650_0000915 | 3300046471 | Bacteria | 34702 |
| 735 | Ga0495650_0001232 | 3300046471 | Bacteria | 26631 |
| 736 | Ga0495584_0017187 | 3300046491 | Bacteria | 3686 |
| 737 | Ga0495596_0000908 | 3300046500 | Bacteria | 17710 |
| 738 | Ga0495607_0010175 | 3300046501 | Bacteria | 6329 |
| 739 | Ga0495607_0069232 | 3300046501 | Bacteria | 1976 |
| 740 | Ga0495583_0020562 | 3300046506 | Bacteria | 3416 |
| 741 | Ga0495610_0000067 | 3300046512 | Bacteria | 123466 |
| 742 | Ga0495610_0000083 | 3300046512 | Bacteria | 112946 |
| 743 | Ga0495610_0000253 | 3300046512 | Bacteria | 56195 |
| 744 | Ga0495610_0009340 | 3300046512 | Bacteria | 6209 |
| 745 | Ga0495610_0039804 | 3300046512 | Bacteria | 2374 |
| 746 | Ga0495620_0027710 | 3300046515 | Bacteria | 2647 |
| 747 | Ga0495632_0000023 | 3300046519 | Bacteria | 180933 |
| 748 | Ga0495632_0004635 | 3300046519 | Bacteria | 9298 |
| 749 | Ga0495632_0023002 | 3300046519 | Bacteria | 3334 |
| 750 | Ga0495637_0001820 | 3300046520 | Bacteria | 12213 |
| 751 | Ga0495637_0004635 | 3300046520 | Bacteria | 7099 |
| 752 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 753 | Ga0495643_0000529 | 3300046522 | Bacteria | 47569 |
| 754 | Ga0495643_0011099 | 3300046522 | Bacteria | 5506 |
| 755 | Ga0495643_0012972 | 3300046522 | Bacteria | 5006 |
| 756 | Ga0495643_0019944 | 3300046522 | Bacteria | 3874 |
| 757 | Ga0495643_0023464 | 3300046522 | Bacteria | 3508 |
| 758 | Ga0495648_0004843 | 3300046524 | Bacteria | 11362 |
| 759 | Ga0495648_0024107 | 3300046524 | Bacteria | 4153 |
| 760 | Ga0495663_0000019 | 3300046525 | Bacteria | 129361 |
| 761 | Ga0495663_0023965 | 3300046525 | Bacteria | 1771 |
| 762 | Ga0495654_0084426 | 3300046530 | Bacteria | 1483 |
| 763 | Ga0495609_0002330 | 3300046538 | Bacteria | 11725 |
| 764 | Ga0495621_0014589 | 3300046539 | Bacteria | 2489 |
| 765 | Ga0495621_0015949 | 3300046539 | Bacteria | 2403 |
| 766 | Ga0495633_0000054 | 3300046558 | Bacteria | 151646 |
| 767 | Ga0495633_0008801 | 3300046558 | Bacteria | 5640 |
| 768 | Ga0495633_0078981 | 3300046558 | Bacteria | 1532 |
| 769 | Ga0495668_0000031 | 3300046616 | Bacteria | 256576 |
| 770 | Ga0495625_0000169 | 3300046660 | Bacteria | 102287 |
| 771 | Ga0495661_0019302 | 3300046665 | Bacteria | 4470 |
| 772 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 773 | Ga0495683_0050433 | 3300047323 | Bacteria | 2083 |
| 774 | Ga0495673_0059236 | 3300047469 | Bacteria | 1647 |
| 775 | Ga0495681_0000036 | 3300047470 | Bacteria | 124207 |
| 776 | Ga0495681_0000153 | 3300047470 | Bacteria | 57842 |
| 777 | Ga0495681_0019068 | 3300047470 | Bacteria | 3757 |
| 778 | Ga0495686_0103675 | 3300047472 | Bacteria | 1713 |
| 779 | Ga0495686_0193653 | 3300047472 | Bacteria | 1170 |
| 780 | Ga0495615_0000103 | 3300048090 | Bacteria | 23149 |
| 781 | Ga0495626_0002741 | 3300048091 | Bacteria | 11858 |
| 782 | Ga0496101_0018700 | 3300048904 | Bacteria | 4716 |
| 783 | Ga0496102_0000117 | 3300048905 | Bacteria | 114037 |
| 784 | Ga0496102_0002649 | 3300048905 | Bacteria | 15214 |
| 785 | Ga0496103_0000076 | 3300048906 | Bacteria | 113209 |
| 786 | Ga0496103_0001866 | 3300048906 | Bacteria | 13692 |
| 787 | Ga0496103_0009443 | 3300048906 | Bacteria | 5776 |
| 788 | Ga0496103_0191339 | 3300048906 | Bacteria | 1315 |
| 789 | Ga0496105_0060801 | 3300048908 | Bacteria | 3117 |
| 790 | Ga0496105_0165099 | 3300048908 | Bacteria | 1817 |
| 791 | Ga0496105_0207034 | 3300048908 | Bacteria | 1600 |
| 792 | Ga0496106_0130564 | 3300048909 | Bacteria | 1970 |
| 793 | Ga0496107_0133260 | 3300048910 | Bacteria | 1835 |
| 794 | Ga0496108_0024888 | 3300048911 | Bacteria | 4930 |
| 795 | Ga0496115_0023743 | 3300048918 | Bacteria | 4760 |
| 796 | Ga0496116_0000149 | 3300048919 | Bacteria | 141841 |
| 797 | Ga0496116_0009061 | 3300048919 | Bacteria | 8534 |
| 798 | Ga0496116_0017657 | 3300048919 | Bacteria | 5529 |
| 799 | Ga0496116_0077226 | 3300048919 | Bacteria | 2082 |
| 800 | Ga0496117_0000201 | 3300048920 | Bacteria | 117679 |
| 801 | Ga0496117_0006841 | 3300048920 | Bacteria | 11343 |
| 802 | Ga0496117_0011104 | 3300048920 | Bacteria | 8101 |
| 803 | Ga0496117_0040004 | 3300048920 | Bacteria | 3454 |
| 804 | Ga0496117_0055344 | 3300048920 | Bacteria | 2772 |
| 805 | Ga0496118_0000097 | 3300048921 | Bacteria | 160837 |
| 806 | Ga0496118_0003316 | 3300048921 | Bacteria | 20415 |
| 807 | Ga0496118_0021481 | 3300048921 | Bacteria | 5678 |
| 808 | Ga0496118_0054877 | 3300048921 | Bacteria | 3013 |
| 809 | Ga0496119_0022531 | 3300048922 | Bacteria | 4506 |
| 810 | Ga0496120_0172072 | 3300048923 | Bacteria | 1070 |
| 811 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 812 | Ga0496121_0000723 | 3300048924 | Bacteria | 61128 |
| 813 | Ga0496121_0000997 | 3300048924 | Bacteria | 50601 |
| 814 | Ga0496121_0017545 | 3300048924 | Bacteria | 7302 |
| 815 | Ga0496121_0191785 | 3300048924 | Bacteria | 1464 |
| 816 | Ga0496122_0003138 | 3300048925 | Bacteria | 22134 |
| 817 | Ga0496122_0005188 | 3300048925 | Bacteria | 15663 |
| 818 | Ga0496122_0014685 | 3300048925 | Bacteria | 7551 |
| 819 | Ga0496122_0060237 | 3300048925 | Bacteria | 2797 |
| 820 | Ga0496123_0002459 | 3300048926 | Bacteria | 22941 |
| 821 | Ga0496123_0002495 | 3300048926 | Bacteria | 22695 |
| 822 | Ga0496123_0007334 | 3300048926 | Bacteria | 10444 |
| 823 | Ga0496123_0030279 | 3300048926 | Bacteria | 3964 |
| 824 | Ga0496123_0053823 | 3300048926 | Bacteria | 2656 |
| 825 | Ga0496124_0000202 | 3300048927 | Bacteria | 117650 |
| 826 | Ga0496124_0005279 | 3300048927 | Bacteria | 14616 |
| 827 | Ga0496124_0013965 | 3300048927 | Bacteria | 7800 |
| 828 | Ga0496124_0014384 | 3300048927 | Bacteria | 7651 |
| 829 | Ga0496124_0051985 | 3300048927 | Bacteria | 3483 |
| 830 | Ga0496124_0084033 | 3300048927 | Bacteria | 2611 |
| 831 | Ga0496124_0163048 | 3300048927 | Bacteria | 1735 |
| 832 | Ga0496125_0010673 | 3300048928 | Bacteria | 9272 |
| 833 | Ga0496125_0029877 | 3300048928 | Bacteria | 4887 |
| 834 | Ga0496125_0086087 | 3300048928 | Bacteria | 2378 |
| 835 | Ga0496126_0000261 | 3300048929 | Bacteria | 112027 |
| 836 | Ga0496126_0004925 | 3300048929 | Bacteria | 15584 |
| 837 | Ga0496126_0032221 | 3300048929 | Bacteria | 4940 |
| 838 | Ga0496126_0035596 | 3300048929 | Bacteria | 4665 |
| 839 | Ga0496126_0073216 | 3300048929 | Bacteria | 3046 |
| 840 | Ga0495678_019574 | 3300049459 | Bacteria | 3015 |
| 841 | Ga0501292_000266 | 3300049515 | Bacteria | 7553 |
| 842 | Ga0501294_000234 | 3300049517 | Bacteria | 6851 |
| 843 | Ga0501032_0014418 | 3300049569 | Bacteria | 5598 |
| 844 | Ga0501033_0006206 | 3300049570 | Bacteria | 9367 |
| 845 | Ga0501034_0003520 | 3300049571 | Bacteria | 17777 |
| 846 | Ga0501036_0009028 | 3300049572 | Bacteria | 8197 |
| 847 | Ga0501037_0107159 | 3300049573 | Bacteria | 2013 |
| 848 | Ga0501043_0037962 | 3300049579 | Bacteria | 3788 |
| 849 | Ga0501048_0054780 | 3300049582 | Bacteria | 2833 |
| 850 | Ga0501206_001033 | 3300049653 | Bacteria | 3476 |
| 851 | Ga0501207_018580 | 3300049654 | Bacteria | 1095 |
| 852 | Ga0501222_000364 | 3300049662 | Bacteria | 7042 |
| 853 | Ga0501223_000072 | 3300049663 | Bacteria | 30438 |
| 854 | Ga0501223_000276 | 3300049663 | Bacteria | 12894 |
| 855 | Ga0501223_000876 | 3300049663 | Bacteria | 7135 |
| 856 | Ga0501224_000004 | 3300049664 | Bacteria | 169090 |
| 857 | Ga0501227_005637 | 3300049665 | Bacteria | 2681 |
| 858 | Ga0501233_000343 | 3300049668 | Bacteria | 7239 |
| 859 | Ga0501225_0000048 | 3300049705 | Bacteria | 40596 |
| 860 | Ga0501225_0000350 | 3300049705 | Bacteria | 14591 |
| 861 | Ga0501225_0004353 | 3300049705 | Bacteria | 4232 |
| 862 | Ga0501245_002045 | 3300049708 | Bacteria | 2675 |
| 863 | Ga0501264_004022 | 3300049761 | Bacteria | 1334 |
| 864 | Ga0501279_000234 | 3300049775 | Bacteria | 7665 |
| 865 | Ga0501280_000705 | 3300049776 | Bacteria | 7378 |
| 866 | Ga0501281_00363 | 3300049777 | Bacteria | 4594 |
| 867 | Ga0501282_000728 | 3300049778 | Bacteria | 3778 |
| 868 | Ga0501283_001283 | 3300049779 | Bacteria | 3295 |
| 869 | Ga0501044_0013012 | 3300049823 | Bacteria | 9004 |
| 870 | Ga0501044_0117509 | 3300049823 | Bacteria | 2663 |
| 871 | Ga0501044_0333557 | 3300049823 | Bacteria | 1439 |
| 872 | Ga0501226_000018 | 3300049853 | Bacteria | 147268 |
| 873 | nmdc:mga03683_164_c1 | 3300050489 | Bacteria | 22386 |
| 874 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 875 | nmdc:mga03n38_120158_c1 | 3300050490 | Bacteria | 1290 |
| 876 | nmdc:mga03n38_766_c1 | 3300050490 | Bacteria | 8515 |
| 877 | nmdc:mga00v17_1241_c1 | 3300050491 | Bacteria | 13372 |
| 878 | nmdc:mga00v17_50679_c1 | 3300050491 | Bacteria | 2523 |
| 879 | nmdc:mga00v17_75749_c1 | 3300050491 | Bacteria | 2093 |
| 880 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 881 | nmdc:mga06z11_140_c1 | 3300050494 | Bacteria | 28632 |
| 882 | nmdc:mga06z11_715_c1 | 3300050494 | Bacteria | 12079 |
| 883 | nmdc:mga04h51_259_c1 | 3300050495 | Bacteria | 13806 |
| 884 | nmdc:mga04h51_48_c1 | 3300050495 | Bacteria | 38959 |
| 885 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 886 | nmdc:mga07m45_30498_c1 | 3300050496 | Bacteria | 2986 |
| 887 | nmdc:mga07m45_31886_c1 | 3300050496 | Bacteria | 2921 |
| 888 | nmdc:mga07m45_7436_c1 | 3300050496 | Bacteria | 5598 |
| 889 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 890 | nmdc:mga0sz30_2266_c1 | 3300050516 | Bacteria | 6882 |
| 891 | nmdc:mga0sz30_84_c1 | 3300050516 | Bacteria | 36247 |
| 892 | Ga0500643_013262 | 3300053087 | Bacteria | 2917 |
| 893 | Ga0500562_001244 | 3300053108 | Bacteria | 6278 |
| 894 | Ga0500593_074227 | 3300053117 | Bacteria | 1471 |
| 895 | Ga0500607_002811 | 3300053121 | Bacteria | 13495 |
| 896 | Ga0500607_005193 | 3300053121 | Bacteria | 8590 |
| 897 | Ga0500608_000429 | 3300053122 | Bacteria | 15955 |
| 898 | Ga0500618_008507 | 3300053125 | Bacteria | 2858 |
| 899 | Ga0500658_0020690 | 3300053134 | Bacteria | 2487 |
| 900 | Ga0500559_0000760 | 3300053136 | Bacteria | 21156 |
| 901 | Ga0500559_0010421 | 3300053136 | Bacteria | 3989 |
| 902 | Ga0500559_0013681 | 3300053136 | Bacteria | 3433 |
| 903 | Ga0500590_031440 | 3300053148 | Bacteria | 2752 |
| 904 | Ga0500622_0005190 | 3300053156 | Bacteria | 7889 |
| 905 | Ga0500624_000101 | 3300053157 | Bacteria | 41193 |
| 906 | Ga0500624_000236 | 3300053157 | Bacteria | 20013 |
| 907 | Ga0500627_0000012 | 3300053158 | Bacteria | 140613 |
| 908 | Ga0500636_0000447 | 3300053177 | Bacteria | 22672 |
| 909 | Ga0500645_039520 | 3300053730 | Bacteria | 1397 |
| 910 | Ga0500587_005008 | 3300053739 | Bacteria | 1802 |
| 911 | Ga0466962_0000117 | 3300061719 | Bacteria | 32210 |
| 912 | Ga0466962_0016756 | 3300061719 | Bacteria | 3532 |
| 913 | 2511130901 | 2510917021 | Bacteria | 5705459 |
| 914 | 2512643217 | 2512564014 | Bacteria | 4639632 |
| 915 | 2587918939 | 2585428106 | Bacteria | 5179711 |
| 916 | 2643822103 | 2643221560 | Bacteria | 4801179 |
| 917 | 2643833430 | 2643221563 | Bacteria | 4726935 |
| 918 | 2643951135 | 2643221588 | Bacteria | 3692460 |
| 919 | 2644040258 | 2643221605 | Bacteria | 4772303 |
| 920 | 2644054357 | 2643221608 | Bacteria | 4724829 |
| 921 | 2644227648 | 2643221640 | Bacteria | 5258820 |
| 922 | 2644236834 | 2643221642 | Bacteria | 5357871 |
| 923 | 2778125479 | 2775507255 | Bacteria | 3945731 |
| 924 | 2809063561 | 2808606401 | Bacteria | 4586670 |
| 925 | 2809079468 | 2808606404 | Bacteria | 4652788 |
| 926 | 2809083894 | 2808606405 | Bacteria | 4586632 |
| 927 | 2819550997 | 2818991438 | Bacteria | 5793701 |
| 928 | 2842778918 | 2842775625 | Bacteria | 5587290 |
| 929 | 2852654629 | 2852653556 | Bacteria | 4050083 |
| 930 | 2852682320 | 2852680915 | Bacteria | 4100189 |
| 931 | 2880521069 | 2880518877 | Bacteria | 5012590 |
| 932 | 2884961450 | 2884960567 | Bacteria | 5437054 |
| 933 | 2896186188 | 2896184354 | Bacteria | 3258548 |
| 934 | 2896431652 | 2896429255 | Bacteria | 2557483 |
| 935 | 2919138965 | 2919138771 | Bacteria | 5281312 |
| 936 | 2919711272 | 2919709256 | Bacteria | 4318106 |
| 937 | 2928531618 | 2928531327 | Bacteria | 5101314 |
| 938 | Ga0495596_0000041 | |||
| 939 | SwRhRL2b_contig_1406535 | |||
| 940 | JGI24736J21556_1000072 | |||
| 941 | JGI24736J21556_1005886 | |||
| 942 | JGI24741J21665_1000687 | |||
| 943 | JGI24752J21851_1000272 | |||
| 944 | JGI24752J21851_1000964 | |||
| 945 | JGI24740J21852_10000442 | |||
| 946 | JGI24740J21852_10003459 | |||
| 947 | JGI24740J21852_10007263 | |||
| 948 | JGI24740J21852_10039116 | |||
| 949 | JGI24739J22299_10001723 | |||
| 950 | JGI24739J22299_10006356 | |||
| 951 | JGI24739J22299_10011748 | |||
| 952 | JGI24739J22299_10016266 | |||
| 953 | JGI24739J22299_10028146 | |||
| 954 | JGI24737J22298_10000252 | |||
| 955 | JGI24737J22298_10000790 | |||
| 956 | JGI24737J22298_10001283 | |||
| 957 | JGI24735J21928_10003014 | |||
| 958 | JGI24735J21928_10008091 | |||
| 959 | JGI24750J21931_1000348 | |||
| 960 | JGI24748J21848_1000033 | |||
| 961 | JGI24738J21930_10000782 | |||
| 962 | JGI24738J21930_10000879 | |||
| 963 | JGI24738J21930_10002203 | |||
| 964 | JGI24738J21930_10003362 | |||
| 965 | JGI24738J21930_10004478 | |||
| 966 | JGI24034J26672_10000032 | |||
| 967 | JGI24751J29686_10000166 | |||
| 968 | JGI24751J29686_10000483 | |||
| 969 | JGI24751J29686_10001949 | |||
| 970 | JGI25165J46597_1000188 | |||
| 971 | Ga0055542_1011823 | |||
| 972 | Ga0055536_1003199 | |||
| 973 | Ga0055536_1004985 | |||
| 974 | Ga0055536_1004999 | |||
| 975 | Ga0055536_1006826 | |||
| 976 | Ga0055530_10000526 | |||
| 977 | Ga0055530_10004955 | |||
| 978 | Ga0055531_10000294 | |||
| 979 | Ga0055531_10000563 | |||
| 980 | Ga0055531_10005290 | |||
| 981 | Ga0055531_10006533 | |||
| 982 | Ga0065704_10001107 | |||
| 983 | Ga0065704_10070157 | |||
| 984 | Ga0065704_10074818 | |||
| 985 | Ga0070658_10000264 | |||
| 986 | Ga0070658_10000688 | |||
| 987 | Ga0070658_10011548 | |||
| 988 | Ga0070658_10023406 | |||
| 989 | Ga0070658_10060390 | |||
| 990 | Ga0070658_10076428 | |||
| 991 | Ga0070658_10076867 | |||
| 992 | Ga0070658_10077708 | |||
| 993 | Ga0070658_10080455 | |||
| 994 | Ga0070658_10099604 | |||
| 995 | Ga0070676_10002905 | |||
| 996 | Ga0070676_10061638 | |||
| 997 | Ga0070683_100188795 | |||
| 998 | Ga0070690_100000011 | |||
| 999 | Ga0070690_100029524 | |||
| 1000 | Ga0070670_100000202 | |||
| 1001 | Ga0070670_100002165 | |||
| 1002 | Ga0070670_100009373 | |||
| 1003 | Ga0070670_100020528 | |||
| 1004 | Ga0070670_100064787 | |||
| 1005 | Ga0070670_100069540 | |||
| 1006 | Ga0070670_100124679 | |||
| 1007 | Ga0070670_100293249 | |||
| 1008 | Ga0070677_10018547 | |||
| 1009 | Ga0068869_100000353 | |||
| 1010 | Ga0068869_100003780 | |||
| 1011 | Ga0070666_10000035 | |||
| 1012 | Ga0070666_10000067 | |||
| 1013 | Ga0070666_10047300 | |||
| 1014 | Ga0070666_10072151 | |||
| 1015 | Ga0070666_10102674 | |||
| 1016 | Ga0070680_100021021 | |||
| 1017 | Ga0068868_100000053 | |||
| 1018 | Ga0068868_100001128 | |||
| 1019 | Ga0070660_100000091 | |||
| 1020 | Ga0070660_100001677 | |||
| 1021 | Ga0070660_100010408 | |||
| 1022 | Ga0070660_100012472 | |||
| 1023 | Ga0070660_100031466 | |||
| 1024 | Ga0070660_100033444 | |||
| 1025 | Ga0070660_100067586 | |||
| 1026 | Ga0070660_100075077 | |||
| 1027 | Ga0070660_100093062 | |||
| 1028 | Ga0070689_100012518 | |||
| 1029 | Ga0070661_100041541 | |||
| 1030 | Ga0070661_100076468 | |||
| 1031 | Ga0070692_10014412 | |||
| 1032 | Ga0070692_10016225 | |||
| 1033 | Ga0070692_10018483 | |||
| 1034 | Ga0070668_100004154 | |||
| 1035 | Ga0070668_100005795 | |||
| 1036 | Ga0070668_100007848 | |||
| 1037 | Ga0070668_100039607 | |||
| 1038 | Ga0070668_100042844 | |||
| 1039 | Ga0070668_100086269 | |||
| 1040 | Ga0070668_100189959 | |||
| 1041 | Ga0070669_100000029 | |||
| 1042 | Ga0070669_100000031 | |||
| 1043 | Ga0070669_100000489 | |||
| 1044 | Ga0070669_100001511 | |||
| 1045 | Ga0070669_100004512 | |||
| 1046 | Ga0070669_100016060 | |||
| 1047 | Ga0070669_100171417 | |||
| 1048 | Ga0070675_100021009 | |||
| 1049 | Ga0070675_100075387 | |||
| 1050 | Ga0070675_100134596 | |||
| 1051 | Ga0070675_100174417 | |||
| 1052 | Ga0070671_100000016 | |||
| 1053 | Ga0070671_100003107 | |||
| 1054 | Ga0070671_100030763 | |||
| 1055 | Ga0070671_100036033 | |||
| 1056 | Ga0070671_100182242 | |||
| 1057 | Ga0070674_100017727 | |||
| 1058 | Ga0070674_100224205 | |||
| 1059 | Ga0070673_100000023 | |||
| 1060 | Ga0070673_100003541 | |||
| 1061 | Ga0070673_100024270 | |||
| 1062 | Ga0070688_100000409 | |||
| 1063 | Ga0070659_100000565 | |||
| 1064 | Ga0070659_100010545 | |||
| 1065 | Ga0070659_100035372 | |||
| 1066 | Ga0070659_100102350 | |||
| 1067 | Ga0070659_100229043 | |||
| 1068 | Ga0070659_100375268 | |||
| 1069 | Ga0070667_100000193 | |||
| 1070 | Ga0070667_100000513 | |||
| 1071 | Ga0070667_100001750 | |||
| 1072 | Ga0070667_100002064 | |||
| 1073 | Ga0070667_100017003 | |||
| 1074 | Ga0070667_100038186 | |||
| 1075 | Ga0070667_100042729 | |||
| 1076 | Ga0070667_100047513 | |||
| 1077 | Ga0070667_100072436 | |||
| 1078 | Ga0070667_100156553 | |||
| 1079 | Ga0070663_100010120 | |||
| 1080 | Ga0070663_100040594 | |||
| 1081 | Ga0070662_100000854 | |||
| 1082 | Ga0070662_100006752 | |||
| 1083 | Ga0070662_100007013 | |||
| 1084 | Ga0070662_100099640 | |||
| 1085 | Ga0070662_100102368 | |||
| 1086 | Ga0070662_100167334 | |||
| 1087 | Ga0070662_100262225 | |||
| 1088 | Ga0070681_10224374 | |||
| 1089 | Ga0068867_100000007 | |||
| 1090 | Ga0068867_100000662 | |||
| 1091 | Ga0068867_100008991 | |||
| 1092 | Ga0068867_100021550 | |||
| 1093 | Ga0070685_10005656 | |||
| 1094 | Ga0070679_100088751 | |||
| 1095 | Ga0070679_100130951 | |||
| 1096 | Ga0070684_100270390 | |||
| 1097 | Ga0068853_100002629 | |||
| 1098 | Ga0068853_100015604 | |||
| 1099 | Ga0068853_100084056 | |||
| 1100 | Ga0068853_100093832 | |||
| 1101 | Ga0068853_100233154 | |||
| 1102 | Ga0070672_100033768 | |||
| 1103 | Ga0070672_100042772 | |||
| 1104 | Ga0070672_100102124 | |||
| 1105 | Ga0070686_100000035 | |||
| 1106 | Ga0070686_100079456 | |||
| 1107 | Ga0070695_100012457 | |||
| 1108 | Ga0070665_100000079 | |||
| 1109 | Ga0070665_100000161 | |||
| 1110 | Ga0070665_100000296 | |||
| 1111 | Ga0070665_100003329 | |||
| 1112 | Ga0070665_100005502 | |||
| 1113 | Ga0070665_100013198 | |||
| 1114 | Ga0070704_100116534 | |||
| 1115 | Ga0068855_100000029 | |||
| 1116 | Ga0068855_100000129 | |||
| 1117 | Ga0068855_100028845 | |||
| 1118 | Ga0068855_100091907 | |||
| 1119 | Ga0068855_100157405 | |||
| 1120 | Ga0068855_100261371 | |||
| 1121 | Ga0068855_100281569 | |||
| 1122 | Ga0068855_100637339 | |||
| 1123 | Ga0070664_100023883 | |||
| 1124 | Ga0070664_100037350 | |||
| 1125 | Ga0070664_100186001 | |||
| 1126 | Ga0070664_100306681 | |||
| 1127 | Ga0068857_100005757 | |||
| 1128 | Ga0068857_100013218 | |||
| 1129 | Ga0068857_100013971 | |||
| 1130 | Ga0068857_100056259 | |||
| 1131 | Ga0068857_100068155 | |||
| 1132 | Ga0068854_100000751 | |||
| 1133 | Ga0068854_100003675 | |||
| 1134 | Ga0068854_100010543 | |||
| 1135 | Ga0068854_100019212 | |||
| 1136 | Ga0068854_100271665 | |||
| 1137 | Ga0068854_100275528 | |||
| 1138 | Ga0068856_100008084 | |||
| 1139 | Ga0068856_100416555 | |||
| 1140 | Ga0068852_100039475 | |||
| 1141 | Ga0068852_100120905 | |||
| 1142 | Ga0068852_100199235 | |||
| 1143 | Ga0068852_100345976 | |||
| 1144 | Ga0068852_100448774 | |||
| 1145 | Ga0068859_100000110 | |||
| 1146 | Ga0068859_100006262 | |||
| 1147 | Ga0068859_100010390 | |||
| 1148 | Ga0068859_100031118 | |||
| 1149 | Ga0068859_100052534 | |||
| 1150 | Ga0068859_100067773 | |||
| 1151 | Ga0068864_100000123 | |||
| 1152 | Ga0068864_100000194 | |||
| 1153 | Ga0068864_100001925 | |||
| 1154 | Ga0068864_100003050 | |||
| 1155 | Ga0068864_100019097 | |||
| 1156 | Ga0068861_100004044 | |||
| 1157 | Ga0068861_100020401 | |||
| 1158 | Ga0068861_100032369 | |||
| 1159 | Ga0068851_10023612 | |||
| 1160 | Ga0068851_10036736 | |||
| 1161 | Ga0068863_100000060 | |||
| 1162 | Ga0068863_100000258 | |||
| 1163 | Ga0068863_100000466 | |||
| 1164 | Ga0068863_100004018 | |||
| 1165 | Ga0068863_100007016 | |||
| 1166 | Ga0068863_100008448 | |||
| 1167 | Ga0068863_100015266 | |||
| 1168 | Ga0068863_100020635 | |||
| 1169 | Ga0068863_100038627 | |||
| 1170 | Ga0068863_100052537 | |||
| 1171 | Ga0068863_100087584 | |||
| 1172 | Ga0068863_100392061 | |||
| 1173 | Ga0068858_100000620 | |||
| 1174 | Ga0068858_100001165 | |||
| 1175 | Ga0068858_100002313 | |||
| 1176 | Ga0068858_100043485 | |||
| 1177 | Ga0068858_100050995 | |||
| 1178 | Ga0068860_100000126 | |||
| 1179 | Ga0068860_100000473 | |||
| 1180 | Ga0068860_100006941 | |||
| 1181 | Ga0068860_100015365 | |||
| 1182 | Ga0068860_100023060 | |||
| 1183 | Ga0068860_100045232 | |||
| 1184 | Ga0068860_100056396 | |||
| 1185 | Ga0068860_100383414 | |||
| 1186 | Ga0068862_100000043 | |||
| 1187 | Ga0068862_100000059 | |||
| 1188 | Ga0068862_100000146 | |||
| 1189 | Ga0068862_100000289 | |||
| 1190 | Ga0068862_100000781 | |||
| 1191 | Ga0068862_100001131 | |||
| 1192 | Ga0068862_100007304 | |||
| 1193 | Ga0068862_100011830 | |||
| 1194 | Ga0068862_100014765 | |||
| 1195 | Ga0068862_100065212 | |||
| 1196 | Ga0068862_100192213 | |||
| 1197 | Ga0070717_10063847 | |||
| 1198 | Ga0075365_10008874 | |||
| 1199 | Ga0075368_10000200 | |||
| 1200 | Ga0075368_10000388 | |||
| 1201 | Ga0075363_100155871 | |||
| 1202 | Ga0075364_10000812 | |||
| 1203 | Ga0075362_10000043 | |||
| 1204 | Ga0075362_10007412 | |||
| 1205 | Ga0075367_10004091 | |||
| 1206 | Ga0075367_10009645 | |||
| 1207 | Ga0075369_10003398 | |||
| 1208 | Ga0075366_10000830 | |||
| 1209 | Ga0075366_10026750 | |||
| 1210 | Ga0075366_10069262 | |||
| 1211 | Ga0097621_100084921 | |||
| 1212 | Ga0075370_10000241 | |||
| 1213 | Ga0075370_10001693 | |||
| 1214 | Ga0075370_10021447 | |||
| 1215 | Ga0075370_10044358 | |||
| 1216 | Ga0068871_100025318 | |||
| 1217 | Ga0068871_100069389 | |||
| 1218 | Ga0068865_100000010 | |||
| 1219 | Ga0068865_100000928 | |||
| 1220 | Ga0068865_100015234 | |||
| 1221 | Ga0097620_100000110 | |||
| 1222 | Ga0097620_100006261 | |||
| 1223 | Ga0097620_100010387 | |||
| 1224 | Ga0097620_100031117 | |||
| 1225 | Ga0097620_100052539 | |||
| 1226 | Ga0097620_100067773 | |||
| 1227 | Ga0079104_1013105 | |||
| 1228 | Ga0105251_10001504 | |||
| 1229 | Ga0105251_10003378 | |||
| 1230 | Ga0105240_10016757 | |||
| 1231 | Ga0105240_10025944 | |||
| 1232 | Ga0105240_10196399 | |||
| 1233 | Ga0105240_10335659 | |||
| 1234 | Ga0105245_10002121 | |||
| 1235 | Ga0105245_10067957 | |||
| 1236 | Ga0105247_10002974 | |||
| 1237 | Ga0105247_10003512 | |||
| 1238 | Ga0105243_10000054 | |||
| 1239 | Ga0105241_10002058 | |||
| 1240 | Ga0105241_10273428 | |||
| 1241 | Ga0105242_10000315 | |||
| 1242 | Ga0105248_10000012 | |||
| 1243 | Ga0105248_10001592 | |||
| 1244 | Ga0105248_10002301 | |||
| 1245 | Ga0105248_10020496 | |||
| 1246 | Ga0105248_10082687 | |||
| 1247 | Ga0105237_10019685 | |||
| 1248 | Ga0105237_10036210 | |||
| 1249 | Ga0105238_10043038 | |||
| 1250 | Ga0105238_10053762 | |||
| 1251 | Ga0105238_10375196 | |||
| 1252 | Ga0105238_10392002 | |||
| 1253 | Ga0105249_10000065 | |||
| 1254 | Ga0105249_10000094 | |||
| 1255 | Ga0105249_10000099 | |||
| 1256 | Ga0105249_10015660 | |||
| 1257 | Ga0105249_10077646 | |||
| 1258 | Ga0105249_10352021 | |||
| 1259 | Ga0105239_10122921 | |||
| 1260 | Ga0105246_10001552 | |||
| 1261 | Ga0105246_10116444 | |||
| 1262 | Ga0157373_10026035 | |||
| 1263 | Ga0157373_10030029 | |||
| 1264 | Ga0157373_10106188 | |||
| 1265 | Ga0157373_10159299 | |||
| 1266 | Ga0157373_10180303 | |||
| 1267 | Ga0157371_10003444 | |||
| 1268 | Ga0157371_10003542 | |||
| 1269 | Ga0157371_10082391 | |||
| 1270 | Ga0157371_10286725 | |||
| 1271 | Ga0157370_10004235 | |||
| 1272 | Ga0157370_10012917 | |||
| 1273 | Ga0157370_10038879 | |||
| 1274 | Ga0157370_10111513 | |||
| 1275 | Ga0157370_10266460 | |||
| 1276 | Ga0157369_10000137 | |||
| 1277 | Ga0157369_10041344 | |||
| 1278 | Ga0157369_10043291 | |||
| 1279 | Ga0157369_10086851 | |||
| 1280 | Ga0157369_10091533 | |||
| 1281 | Ga0157369_10364151 | |||
| 1282 | Ga0157374_10003253 | |||
| 1283 | Ga0157374_10071841 | |||
| 1284 | Ga0157378_10000154 | |||
| 1285 | Ga0163162_10011913 | |||
| 1286 | Ga0163162_10070948 | |||
| 1287 | Ga0157372_10109822 | |||
| 1288 | Ga0157372_10319837 | |||
| 1289 | Ga0157372_10618067 | |||
| 1290 | Ga0157375_10003825 | |||
| 1291 | Ga0157375_10041209 | |||
| 1292 | Ga0157375_10047504 | |||
| 1293 | Ga0157375_10732439 | |||
| 1294 | Ga0163163_10003287 | |||
| 1295 | Ga0163163_10014503 | |||
| 1296 | Ga0163163_10019974 | |||
| 1297 | Ga0163163_10260670 | |||
| 1298 | Ga0157380_10000040 | |||
| 1299 | Ga0157380_10000851 | |||
| 1300 | Ga0157380_10282422 | |||
| 1301 | Ga0157379_10005418 | |||
| 1302 | Ga0157376_10000047 | |||
| 1303 | Ga0163161_10000614 | |||
| 1304 | Ga0163161_10029862 | |||
| 1305 | Ga0213873_10000026 | |||
| 1306 | Ga0213876_10000149 | |||
| 1307 | Ga0213876_10030099 | |||
| 1308 | Ga0207672_1000235 | |||
| 1309 | Ga0209147_101508 | |||
| 1310 | Ga0209026_1004430 | |||
| 1311 | Ga0209148_1001817 | |||
| 1312 | Ga0209233_1000120 | |||
| 1313 | Ga0209455_1000972 | |||
| 1314 | Ga0209675_1000137 | |||
| 1315 | Ga0209676_1000138 | |||
| 1316 | Ga0209676_1000392 | |||
| 1317 | Ga0209676_1000883 | |||
| 1318 | Ga0209676_1001128 | |||
| 1319 | Ga0209025_1012379 | |||
| 1320 | Ga0209050_1000411 | |||
| 1321 | Ga0209050_1000784 | |||
| 1322 | Ga0209050_1001243 | |||
| 1323 | Ga0209050_1019220 | |||
| 1324 | Ga0209257_1000250 | |||
| 1325 | Ga0209257_1000513 | |||
| 1326 | Ga0209257_1000603 | |||
| 1327 | Ga0209257_1002085 | |||
| 1328 | Ga0207697_10000059 | |||
| 1329 | Ga0207697_10000831 | |||
| 1330 | Ga0207656_10037729 | |||
| 1331 | Ga0207713_1001789 | |||
| 1332 | Ga0207682_10018584 | |||
| 1333 | Ga0207710_10038482 | |||
| 1334 | Ga0207688_10003475 | |||
| 1335 | Ga0207680_10000007 | |||
| 1336 | Ga0207680_10000291 | |||
| 1337 | Ga0207680_10050992 | |||
| 1338 | Ga0207680_10059663 | |||
| 1339 | Ga0207680_10092343 | |||
| 1340 | Ga0207647_10000270 | |||
| 1341 | Ga0207647_10001030 | |||
| 1342 | Ga0207647_10001181 | |||
| 1343 | Ga0207647_10012173 | |||
| 1344 | Ga0207647_10013763 | |||
| 1345 | Ga0207647_10032580 | |||
| 1346 | Ga0207647_10053102 | |||
| 1347 | Ga0207647_10063112 | |||
| 1348 | Ga0207645_10003775 | |||
| 1349 | Ga0207645_10013513 | |||
| 1350 | Ga0207645_10096783 | |||
| 1351 | Ga0207705_10000030 | |||
| 1352 | Ga0207705_10000091 | |||
| 1353 | Ga0207705_10000340 | |||
| 1354 | Ga0207705_10002248 | |||
| 1355 | Ga0207705_10007109 | |||
| 1356 | Ga0207705_10014791 | |||
| 1357 | Ga0207705_10027030 | |||
| 1358 | Ga0207705_10047608 | |||
| 1359 | Ga0207705_10051801 | |||
| 1360 | Ga0207705_10067264 | |||
| 1361 | Ga0207705_10159080 | |||
| 1362 | Ga0207654_10002997 | |||
| 1363 | Ga0207707_10357906 | |||
| 1364 | Ga0207695_10002869 | |||
| 1365 | Ga0207695_10004964 | |||
| 1366 | Ga0207695_10035517 | |||
| 1367 | Ga0207695_10273649 | |||
| 1368 | Ga0207695_10385662 | |||
| 1369 | Ga0207671_10002215 | |||
| 1370 | Ga0207671_10002393 | |||
| 1371 | Ga0207671_10062957 | |||
| 1372 | Ga0207657_10000092 | |||
| 1373 | Ga0207657_10000252 | |||
| 1374 | Ga0207657_10014735 | |||
| 1375 | Ga0207657_10016141 | |||
| 1376 | Ga0207657_10021012 | |||
| 1377 | Ga0207657_10031057 | |||
| 1378 | Ga0207657_10032515 | |||
| 1379 | Ga0207657_10033527 | |||
| 1380 | Ga0207657_10036833 | |||
| 1381 | Ga0207657_10047515 | |||
| 1382 | Ga0207657_10063000 | |||
| 1383 | Ga0207657_10076781 | |||
| 1384 | Ga0207657_10096011 | |||
| 1385 | Ga0207657_10236608 | |||
| 1386 | Ga0207649_10001000 | |||
| 1387 | Ga0207652_10040373 | |||
| 1388 | Ga0207652_10076319 | |||
| 1389 | Ga0207652_10267797 | |||
| 1390 | Ga0207681_10000014 | |||
| 1391 | Ga0207681_10000040 | |||
| 1392 | Ga0207681_10000053 | |||
| 1393 | Ga0207681_10002113 | |||
| 1394 | Ga0207681_10004633 | |||
| 1395 | Ga0207681_10007131 | |||
| 1396 | Ga0207681_10016972 | |||
| 1397 | Ga0207681_10042999 | |||
| 1398 | Ga0207681_10149530 | |||
| 1399 | Ga0207694_10001896 | |||
| 1400 | Ga0207694_10026009 | |||
| 1401 | Ga0207694_10070535 | |||
| 1402 | Ga0207650_10000015 | |||
| 1403 | Ga0207650_10000285 | |||
| 1404 | Ga0207650_10019874 | |||
| 1405 | Ga0207650_10038683 | |||
| 1406 | Ga0207650_10043829 | |||
| 1407 | Ga0207650_10091220 | |||
| 1408 | Ga0207650_10319309 | |||
| 1409 | Ga0207659_10010945 | |||
| 1410 | Ga0207687_10005686 | |||
| 1411 | Ga0207644_10000023 | |||
| 1412 | Ga0207644_10000242 | |||
| 1413 | Ga0207644_10002058 | |||
| 1414 | Ga0207644_10007123 | |||
| 1415 | Ga0207644_10011134 | |||
| 1416 | Ga0207644_10054779 | |||
| 1417 | Ga0207690_10024470 | |||
| 1418 | Ga0207690_10035345 | |||
| 1419 | Ga0207690_10149746 | |||
| 1420 | Ga0207690_10205589 | |||
| 1421 | Ga0207706_10000426 | |||
| 1422 | Ga0207706_10006019 | |||
| 1423 | Ga0207706_10009479 | |||
| 1424 | Ga0207706_10015546 | |||
| 1425 | Ga0207706_10042810 | |||
| 1426 | Ga0207706_10051256 | |||
| 1427 | Ga0207706_10083654 | |||
| 1428 | Ga0207706_10111427 | |||
| 1429 | Ga0207686_10022176 | |||
| 1430 | Ga0207709_10000050 | |||
| 1431 | Ga0207669_10002095 | |||
| 1432 | Ga0207704_10000020 | |||
| 1433 | Ga0207691_10000563 | |||
| 1434 | Ga0207691_10035604 | |||
| 1435 | Ga0207691_10082911 | |||
| 1436 | Ga0207711_10000004 | |||
| 1437 | Ga0207711_10001332 | |||
| 1438 | Ga0207711_10003824 | |||
| 1439 | Ga0207711_10172022 | |||
| 1440 | Ga0207711_10221600 | |||
| 1441 | Ga0207689_10000128 | |||
| 1442 | Ga0207689_10001110 | |||
| 1443 | Ga0207661_10083629 | |||
| 1444 | Ga0207661_10165271 | |||
| 1445 | Ga0207661_10309422 | |||
| 1446 | Ga0207679_10086732 | |||
| 1447 | Ga0207667_10000035 | |||
| 1448 | Ga0207667_10000303 | |||
| 1449 | Ga0207667_10002966 | |||
| 1450 | Ga0207667_10006684 | |||
| 1451 | Ga0207667_10100734 | |||
| 1452 | Ga0207667_10116924 | |||
| 1453 | Ga0207667_10179259 | |||
| 1454 | Ga0207651_10000005 | |||
| 1455 | Ga0207651_10004988 | |||
| 1456 | Ga0207651_10046960 | |||
| 1457 | Ga0207712_10000002 | |||
| 1458 | Ga0207712_10000004 | |||
| 1459 | Ga0207712_10000161 | |||
| 1460 | Ga0207712_10004168 | |||
| 1461 | Ga0207712_10007997 | |||
| 1462 | Ga0207712_10088449 | |||
| 1463 | Ga0207668_10000050 | |||
| 1464 | Ga0207668_10000161 | |||
| 1465 | Ga0207668_10000235 | |||
| 1466 | Ga0207668_10001831 | |||
| 1467 | Ga0207668_10058737 | |||
| 1468 | Ga0207640_10000436 | |||
| 1469 | Ga0207640_10000791 | |||
| 1470 | Ga0207640_10008601 | |||
| 1471 | Ga0207640_10033480 | |||
| 1472 | Ga0207640_10098116 | |||
| 1473 | Ga0207640_10235583 | |||
| 1474 | Ga0207640_10289224 | |||
| 1475 | Ga0207658_10000042 | |||
| 1476 | Ga0207658_10000232 | |||
| 1477 | Ga0207658_10000512 | |||
| 1478 | Ga0207658_10000865 | |||
| 1479 | Ga0207658_10001126 | |||
| 1480 | Ga0207658_10003756 | |||
| 1481 | Ga0207658_10004591 | |||
| 1482 | Ga0207658_10010342 | |||
| 1483 | Ga0207658_10040834 | |||
| 1484 | Ga0207658_10118166 | |||
| 1485 | Ga0207677_10001525 | |||
| 1486 | Ga0207677_10004294 | |||
| 1487 | Ga0207703_10003308 | |||
| 1488 | Ga0207703_10004540 | |||
| 1489 | Ga0207703_10018941 | |||
| 1490 | Ga0207639_10000323 | |||
| 1491 | Ga0207639_10023999 | |||
| 1492 | Ga0207639_10037201 | |||
| 1493 | Ga0207639_10078778 | |||
| 1494 | Ga0207639_10128760 | |||
| 1495 | Ga0207639_10225278 | |||
| 1496 | Ga0207678_10000068 | |||
| 1497 | Ga0207678_10001958 | |||
| 1498 | Ga0207678_10008956 | |||
| 1499 | Ga0207678_10061483 | |||
| 1500 | Ga0207678_10091890 | |||
| 1501 | Ga0207678_10203344 | |||
| 1502 | Ga0207678_10287591 | |||
| 1503 | Ga0207702_10001343 | |||
| 1504 | Ga0207702_10002737 | |||
| 1505 | Ga0207702_10003060 | |||
| 1506 | Ga0207641_10000010 | |||
| 1507 | Ga0207641_10000046 | |||
| 1508 | Ga0207641_10000098 | |||
| 1509 | Ga0207641_10000100 | |||
| 1510 | Ga0207641_10003235 | |||
| 1511 | Ga0207641_10003834 | |||
| 1512 | Ga0207641_10004892 | |||
| 1513 | Ga0207641_10006069 | |||
| 1514 | Ga0207641_10054815 | |||
| 1515 | Ga0207641_10077637 | |||
| 1516 | Ga0207641_10160334 | |||
| 1517 | Ga0207648_10000017 | |||
| 1518 | Ga0207648_10003077 | |||
| 1519 | Ga0207648_10005891 | |||
| 1520 | Ga0207648_10067764 | |||
| 1521 | Ga0207676_10000021 | |||
| 1522 | Ga0207676_10000046 | |||
| 1523 | Ga0207676_10001069 | |||
| 1524 | Ga0207676_10007591 | |||
| 1525 | Ga0207676_10008497 | |||
| 1526 | Ga0207676_10011546 | |||
| 1527 | Ga0207676_10041919 | |||
| 1528 | Ga0207674_10000086 | |||
| 1529 | Ga0207674_10000531 | |||
| 1530 | Ga0207674_10008409 | |||
| 1531 | Ga0207674_10018390 | |||
| 1532 | Ga0207674_10057345 | |||
| 1533 | Ga0207674_10069316 | |||
| 1534 | Ga0207674_10088815 | |||
| 1535 | Ga0207675_100000739 | |||
| 1536 | Ga0207675_100001387 | |||
| 1537 | Ga0207675_100007152 | |||
| 1538 | Ga0207675_100108376 | |||
| 1539 | Ga0207683_10127928 | |||
| 1540 | Ga0207698_10014333 | |||
| 1541 | Ga0207698_10041755 | |||
| 1542 | Ga0207698_10055755 | |||
| 1543 | Ga0207698_10137440 | |||
| 1544 | Ga0207698_10147621 | |||
| 1545 | Ga0207698_10272103 | |||
| 1546 | Ga0207698_10330296 | |||
| 1547 | Ga0209281_1014011 | |||
| 1548 | Ga0209813_10000027 | |||
| 1549 | Ga0209813_10000172 | |||
| 1550 | Ga0209974_10011733 | |||
| 1551 | Ga0209974_10014198 | |||
| 1552 | Ga0268266_10000040 | |||
| 1553 | Ga0268266_10000486 | |||
| 1554 | Ga0268266_10000573 | |||
| 1555 | Ga0268266_10008611 | |||
| 1556 | Ga0268266_10012670 | |||
| 1557 | Ga0268266_10091026 | |||
| 1558 | Ga0268265_10000013 | |||
| 1559 | Ga0268265_10000026 | |||
| 1560 | Ga0268265_10000128 | |||
| 1561 | Ga0268265_10000141 | |||
| 1562 | Ga0268265_10002045 | |||
| 1563 | Ga0268265_10006109 | |||
| 1564 | Ga0268265_10009102 | |||
| 1565 | Ga0268265_10060708 | |||
| 1566 | Ga0268264_10000003 | |||
| 1567 | Ga0268264_10000141 | |||
| 1568 | Ga0268264_10000224 | |||
| 1569 | Ga0268264_10001883 | |||
| 1570 | Ga0268264_10004349 | |||
| 1571 | Ga0268264_10004427 | |||
| 1572 | Ga0268264_10012122 | |||
| 1573 | Ga0268264_10016449 | |||
| 1574 | Ga0268264_10019349 | |||
| 1575 | Ga0268264_10383320 | |||
| 1576 | Ga0307513_10021633 | |||
| 1577 | Ga0307408_100026841 | |||
| 1578 | Ga0307405_10121154 | |||
| 1579 | Ga0307406_10024190 | |||
| 1580 | Ga0307406_10049755 | |||
| 1581 | Ga0307412_10002696 | |||
| 1582 | Ga0307412_10004821 | |||
| 1583 | Ga0307412_10039228 | |||
| 1584 | Ga0307412_10094284 | |||
| 1585 | Ga0307409_100005395 | |||
| 1586 | Ga0307409_100077861 | |||
| 1587 | Ga0307416_100050425 | |||
| 1588 | Ga0307416_100081705 | |||
| 1589 | Ga0307416_100119888 | |||
| 1590 | Ga0307414_10000095 | |||
| 1591 | Ga0307414_10001510 | |||
| 1592 | Ga0307414_10041818 | |||
| 1593 | Ga0307414_10091531 | |||
| 1594 | Ga0307414_10103643 | |||
| 1595 | Ga0307414_10128396 | |||
| 1596 | Ga0307411_10058174 | |||
| 1597 | Ga0307411_10162332 | |||
| 1598 | Ga0373931_0074215 | |||
| 1599 | Ga0395899_0000132 | |||
| 1600 | Ga0395899_0001026 | |||
| 1601 | Ga0395899_0017300 | |||
| 1602 | Ga0395899_0061308 | |||
| 1603 | Ga0395899_0085008 | |||
| 1604 | Ga0395899_0129422 | |||
| 1605 | Ga0395899_0157802 | |||
| 1606 | Ga0395900_0000477 | |||
| 1607 | Ga0395900_0005306 | |||
| 1608 | Ga0395900_0023878 | |||
| 1609 | Ga0395900_0024012 | |||
| 1610 | Ga0395900_0105805 | |||
| 1611 | Ga0395900_0142730 | |||
| 1612 | Ga0395900_0166852 | |||
| 1613 | Ga0395900_0294896 | |||
| 1614 | Ga0395900_0350167 | |||
| 1615 | Ga0395898_0038841 | |||
| 1616 | Ga0395898_0067563 | |||
| 1617 | Ga0395898_0215670 | |||
| 1618 | Ga0395898_0324048 | |||
| 1619 | Ga0395898_0392336 | |||
| 1620 | Ga0395898_0650561 | |||
| 1621 | Ga0395905_0014452 | |||
| 1622 | Ga0395905_0015256 | |||
| 1623 | Ga0395905_0027502 | |||
| 1624 | Ga0395905_0077760 | |||
| 1625 | Ga0395905_0166336 | |||
| 1626 | Ga0395905_0173159 | |||
| 1627 | Ga0395905_0341485 | |||
| 1628 | Ga0395905_0364896 | |||
| 1629 | Ga0395901_0000275 | |||
| 1630 | Ga0395901_0025148 | |||
| 1631 | Ga0395901_0045532 | |||
| 1632 | Ga0395901_0134298 | |||
| 1633 | Ga0395901_0142581 | |||
| 1634 | Ga0395901_0305273 | |||
| 1635 | Ga0395901_0337637 | |||
| 1636 | Ga0395901_0338215 | |||
| 1637 | Ga0436365_0618422 | |||
| 1638 | Ga0436365_1025078 | |||
| 1639 | Ga0436362_0376260 | |||
| 1640 | Ga0451837_0501092 | |||
| 1641 | Ga0451853_1752212 | |||
| 1642 | Ga0439448_0009342 | |||
| 1643 | Ga0439448_0029685 | |||
| 1644 | Ga0439432_013264 | |||
| 1645 | Ga0439455_0031055 | |||
| 1646 | Ga0439458_0000898 | |||
| 1647 | Ga0466969_0000550 | |||
| 1648 | Ga0466969_0012325 | |||
| 1649 | Ga0466966_0000072 | |||
| 1650 | Ga0466966_0000962 | |||
| 1651 | Ga0466966_0005442 | |||
| 1652 | Ga0466961_0001853 | |||
| 1653 | Ga0466961_0052461 | |||
| 1654 | Ga0466963_0012318 | |||
| 1655 | Ga0453684_0502587 | |||
| 1656 | Ga0466971_0007548 | |||
| 1657 | Ga0466970_0002808 | |||
| 1658 | Ga0466970_0007258 | |||
| 1659 | Ga0466957_0007498 | |||
| 1660 | Ga0466957_0025075 | |||
| 1661 | Ga0466957_0078106 | |||
| 1662 | Ga0466959_0000225 | |||
| 1663 | Ga0466959_0006960 | |||
| 1664 | Ga0451576_0000017 | |||
| 1665 | Ga0466958_0002556 | |||
| 1666 | Ga0466967_0085852 | |||
| 1667 | Ga0495617_008778 | |||
| 1668 | Ga0495627_000336 | |||
| 1669 | Ga0495627_000684 | |||
| 1670 | Ga0495627_002181 | |||
| 1671 | Ga0495650_0000915 | |||
| 1672 | Ga0495650_0001232 | |||
| 1673 | Ga0495584_0017187 | |||
| 1674 | Ga0495596_0000908 | |||
| 1675 | Ga0495607_0010175 | |||
| 1676 | Ga0495607_0069232 | |||
| 1677 | Ga0495583_0020562 | |||
| 1678 | Ga0495610_0000067 | |||
| 1679 | Ga0495610_0000083 | |||
| 1680 | Ga0495610_0000253 | |||
| 1681 | Ga0495610_0009340 | |||
| 1682 | Ga0495610_0039804 | |||
| 1683 | Ga0495620_0027710 | |||
| 1684 | Ga0495632_0000023 | |||
| 1685 | Ga0495632_0004635 | |||
| 1686 | Ga0495632_0023002 | |||
| 1687 | Ga0495637_0001820 | |||
| 1688 | Ga0495637_0004635 | |||
| 1689 | Ga0495643_0000038 | |||
| 1690 | Ga0495643_0000529 | |||
| 1691 | Ga0495643_0011099 | |||
| 1692 | Ga0495643_0012972 | |||
| 1693 | Ga0495643_0019944 | |||
| 1694 | Ga0495643_0023464 | |||
| 1695 | Ga0495648_0004843 | |||
| 1696 | Ga0495648_0024107 | |||
| 1697 | Ga0495663_0000019 | |||
| 1698 | Ga0495663_0023965 | |||
| 1699 | Ga0495654_0084426 | |||
| 1700 | Ga0495609_0002330 | |||
| 1701 | Ga0495621_0014589 | |||
| 1702 | Ga0495621_0015949 | |||
| 1703 | Ga0495633_0000054 | |||
| 1704 | Ga0495633_0008801 | |||
| 1705 | Ga0495633_0078981 | |||
| 1706 | Ga0495668_0000031 | |||
| 1707 | Ga0495625_0000169 | |||
| 1708 | Ga0495661_0019302 | |||
| 1709 | Ga0495671_0000027 | |||
| 1710 | Ga0495683_0050433 | |||
| 1711 | Ga0495673_0059236 | |||
| 1712 | Ga0495681_0000036 | |||
| 1713 | Ga0495681_0000153 | |||
| 1714 | Ga0495681_0019068 | |||
| 1715 | Ga0495686_0103675 | |||
| 1716 | Ga0495686_0193653 | |||
| 1717 | Ga0495615_0000103 | |||
| 1718 | Ga0495626_0002741 | |||
| 1719 | Ga0496101_0018700 | |||
| 1720 | Ga0496102_0000117 | |||
| 1721 | Ga0496102_0002649 | |||
| 1722 | Ga0496103_0000076 | |||
| 1723 | Ga0496103_0001866 | |||
| 1724 | Ga0496103_0009443 | |||
| 1725 | Ga0496103_0191339 | |||
| 1726 | Ga0496105_0060801 | |||
| 1727 | Ga0496105_0165099 | |||
| 1728 | Ga0496105_0207034 | |||
| 1729 | Ga0496106_0130564 | |||
| 1730 | Ga0496107_0133260 | |||
| 1731 | Ga0496108_0024888 | |||
| 1732 | Ga0496115_0023743 | |||
| 1733 | Ga0496116_0000149 | |||
| 1734 | Ga0496116_0009061 | |||
| 1735 | Ga0496116_0017657 | |||
| 1736 | Ga0496116_0077226 | |||
| 1737 | Ga0496117_0000201 | |||
| 1738 | Ga0496117_0006841 | |||
| 1739 | Ga0496117_0011104 | |||
| 1740 | Ga0496117_0040004 | |||
| 1741 | Ga0496117_0055344 | |||
| 1742 | Ga0496118_0000097 | |||
| 1743 | Ga0496118_0003316 | |||
| 1744 | Ga0496118_0021481 | |||
| 1745 | Ga0496118_0054877 | |||
| 1746 | Ga0496119_0022531 | |||
| 1747 | Ga0496120_0172072 | |||
| 1748 | Ga0496121_0000024 | |||
| 1749 | Ga0496121_0000723 | |||
| 1750 | Ga0496121_0000997 | |||
| 1751 | Ga0496121_0017545 | |||
| 1752 | Ga0496121_0191785 | |||
| 1753 | Ga0496122_0003138 | |||
| 1754 | Ga0496122_0005188 | |||
| 1755 | Ga0496122_0014685 | |||
| 1756 | Ga0496122_0060237 | |||
| 1757 | Ga0496123_0002459 | |||
| 1758 | Ga0496123_0002495 | |||
| 1759 | Ga0496123_0007334 | |||
| 1760 | Ga0496123_0030279 | |||
| 1761 | Ga0496123_0053823 | |||
| 1762 | Ga0496124_0000202 | |||
| 1763 | Ga0496124_0005279 | |||
| 1764 | Ga0496124_0013965 | |||
| 1765 | Ga0496124_0014384 | |||
| 1766 | Ga0496124_0051985 | |||
| 1767 | Ga0496124_0084033 | |||
| 1768 | Ga0496124_0163048 | |||
| 1769 | Ga0496125_0010673 | |||
| 1770 | Ga0496125_0029877 | |||
| 1771 | Ga0496125_0086087 | |||
| 1772 | Ga0496126_0000261 | |||
| 1773 | Ga0496126_0004925 | |||
| 1774 | Ga0496126_0032221 | |||
| 1775 | Ga0496126_0035596 | |||
| 1776 | Ga0496126_0073216 | |||
| 1777 | Ga0495678_019574 | |||
| 1778 | Ga0501292_000266 | |||
| 1779 | Ga0501294_000234 | |||
| 1780 | Ga0501032_0014418 | |||
| 1781 | Ga0501033_0006206 | |||
| 1782 | Ga0501034_0003520 | |||
| 1783 | Ga0501036_0009028 | |||
| 1784 | Ga0501037_0107159 | |||
| 1785 | Ga0501043_0037962 | |||
| 1786 | Ga0501048_0054780 | |||
| 1787 | Ga0501206_001033 | |||
| 1788 | Ga0501207_018580 | |||
| 1789 | Ga0501222_000364 | |||
| 1790 | Ga0501223_000072 | |||
| 1791 | Ga0501223_000276 | |||
| 1792 | Ga0501223_000876 | |||
| 1793 | Ga0501224_000004 | |||
| 1794 | Ga0501227_005637 | |||
| 1795 | Ga0501233_000343 | |||
| 1796 | Ga0501225_0000048 | |||
| 1797 | Ga0501225_0000350 | |||
| 1798 | Ga0501225_0004353 | |||
| 1799 | Ga0501245_002045 | |||
| 1800 | Ga0501264_004022 | |||
| 1801 | Ga0501279_000234 | |||
| 1802 | Ga0501280_000705 | |||
| 1803 | Ga0501281_00363 | |||
| 1804 | Ga0501282_000728 | |||
| 1805 | Ga0501283_001283 | |||
| 1806 | Ga0501044_0013012 | |||
| 1807 | Ga0501044_0117509 | |||
| 1808 | Ga0501044_0333557 | |||
| 1809 | Ga0501226_000018 | |||
| 1810 | nmdc:mga03683_164_c1 | |||
| 1811 | nmdc:mga03683_3_c1 | |||
| 1812 | nmdc:mga03n38_120158_c1 | |||
| 1813 | nmdc:mga03n38_766_c1 | |||
| 1814 | nmdc:mga00v17_1241_c1 | |||
| 1815 | nmdc:mga00v17_50679_c1 | |||
| 1816 | nmdc:mga00v17_75749_c1 | |||
| 1817 | nmdc:mga0k408_2_c1 | |||
| 1818 | nmdc:mga06z11_140_c1 | |||
| 1819 | nmdc:mga06z11_715_c1 | |||
| 1820 | nmdc:mga04h51_259_c1 | |||
| 1821 | nmdc:mga04h51_48_c1 | |||
| 1822 | nmdc:mga07m45_1_c1 | |||
| 1823 | nmdc:mga07m45_30498_c1 | |||
| 1824 | nmdc:mga07m45_31886_c1 | |||
| 1825 | nmdc:mga07m45_7436_c1 | |||
| 1826 | nmdc:mga07m45_9_c1 | |||
| 1827 | nmdc:mga0sz30_2266_c1 | |||
| 1828 | nmdc:mga0sz30_84_c1 | |||
| 1829 | Ga0500643_013262 | |||
| 1830 | Ga0500562_001244 | |||
| 1831 | Ga0500593_074227 | |||
| 1832 | Ga0500607_002811 | |||
| 1833 | Ga0500607_005193 | |||
| 1834 | Ga0500608_000429 | |||
| 1835 | Ga0500618_008507 | |||
| 1836 | Ga0500658_0020690 | |||
| 1837 | Ga0500559_0000760 | |||
| 1838 | Ga0500559_0010421 | |||
| 1839 | Ga0500559_0013681 | |||
| 1840 | Ga0500590_031440 | |||
| 1841 | Ga0500622_0005190 | |||
| 1842 | Ga0500624_000101 | |||
| 1843 | Ga0500624_000236 | |||
| 1844 | Ga0500627_0000012 | |||
| 1845 | Ga0500636_0000447 | |||
| 1846 | Ga0500645_039520 | |||
| 1847 | Ga0500587_005008 | |||
| 1848 | Ga0466962_0000117 | |||
| 1849 | Ga0466962_0016756 | |||
| 1850 | 2511130901 | |||
| 1851 | 2512643217 | |||
| 1852 | 2587918939 | |||
| 1853 | 2643822103 | |||
| 1854 | 2643833430 | |||
| 1855 | 2643951135 | |||
| 1856 | 2644040258 | |||
| 1857 | 2644054357 | |||
| 1858 | 2644227648 | |||
| 1859 | 2644236834 | |||
| 1860 | 2778125479 | |||
| 1861 | 2809063561 | |||
| 1862 | 2809079468 | |||
| 1863 | 2809083894 | |||
| 1864 | 2819550997 | |||
| 1865 | 2842778918 | |||
| 1866 | 2852654629 | |||
| 1867 | 2852682320 | |||
| 1868 | 2880521069 | |||
| 1869 | 2884961450 | |||
| 1870 | 2896186188 | |||
| 1871 | 2896431652 | |||
| 1872 | 2919138965 | |||
| 1873 | 2919711272 | |||
| 1874 | 2928531618 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zws-assembly1.cif.gz_A | structure of human dihydroorotate dehydrogenase with a bound inhibitor | 0.9597 | 15 | 353 |
| 2fqi-assembly1.cif.gz_A | dual binding modes of a novel series of dhodh inhibitors | 0.9597 | 9 | 353 |
| 6syp-assembly1.cif.gz_AAA | human dhodh bound to inhibitor ipp/cnrs-a017 | 0.9587 | 16 | 353 |
| 3f1q-assembly1.cif.gz_A | human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 1 | 0.9585 | 9 | 353 |
| 6lzl-assembly1.cif.gz_A | crystal structure of human dihydroorotate dehydrogenase (dhodh) with piperine | 0.955 | 9 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3w7rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9567 | 10 | 353 | 3.20.20.70 |
| 6i55B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9418 | 6 | 354 | 3.20.20.70 |
| 3w7rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9276 | 10 | 353 | 3.20.20.70 |
| af_P9WHL1_31_353_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.927 | 26 | 352 | 3.20.20.70 |
| af_Q874I4_58_444_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9268 | 8 | 353 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2BCX5-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) | 0.9889 | 158 | 352 |
GO:0005737
GO:0006207 GO:0016020 GO:0044205 GO:0106430 |
| AF-A0A6I4SJA1-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (DHOD) (DHODase) (Dihydroorotate oxidase) | 0.9855 | 6 | 352 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
| AF-F1C6Y8-F1-model_v4 | Mitochondrial dihydroorotate dehydrogenase | 0.9852 | 212 | 353 |
GO:0004152
GO:0005743 GO:0006207 GO:0044205 |
| AF-A0A7S4D696-F1-model_v4 | Dihydroorotate dehydrogenase catalytic domain-containing protein | 0.9851 | 238 | 352 |
GO:0004152
GO:0005743 GO:0006207 GO:0044205 |
| AF-A0A086Q6J2-F1-model_v4 | Putative dihydroorotate dehydrogenase reveal (EC 1.3.98.1) | 0.9842 | 219 | 353 |
GO:0005743
GO:0006207 GO:0044205 GO:1990663 |