F486237
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 533 | 1874 | 467 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2728368933|2728532475 |
| Length | 557 |
| Sequence | KLHWTEPGHPAYGVPCSLPPDWKRVFTSACKNVKILIVSNFRDMQDFVNEVDLFSSGRTLLSLTKDGILILREMDFTQIQVQRVENQMAKQQIGVIGLAVMGKNLALNIESRGFTVSVYNRSPEKTHDLISEAEGKNLTGTFSIEEFVESLEVPRKILIMVQAGKATDATIEQLLPHLDQGDIIIDGGNAYFPDTVRRNKELEAKGFRFIGTGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVNGEPCCTYIGPDGAGHYVKMVHNGIEYGDMQLIGEAYHLLKDVLGLDAKELHSIFADWNSGELDSYLIEITKDIFAEYDEETGKPMVDVILDAAGQKGTGKWTSQSSLDLGVPLSMITESVFSRFLSAMKEERVAASKVLSGPVTEPFRGDKAEFIENVRKALFASKIVSYAQGFAQLRVASEEYNWDLKYGNLAKIWRGGCIIRSRFLQNITDAYENNPELKNLLLDPFFKNIMDTYQAAWRQVVSAAVAQGVPVPGFSSALAYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHNWLSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 68 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 69 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 70 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 109 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 112 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 128 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 132 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 133 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 136 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 137 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 138 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 141 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 142 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 143 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 213 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 217 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 223 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 224 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 225 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 226 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 227 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 228 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 229 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 230 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 231 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 232 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 233 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 234 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 235 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 236 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 237 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 238 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 239 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 240 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 241 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 242 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 243 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 244 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 245 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 246 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 247 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 248 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 249 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 250 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 251 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 252 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 253 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 254 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 255 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 256 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 257 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 258 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 259 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 260 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 261 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 262 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 263 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 264 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 265 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 266 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 267 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 268 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 269 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 270 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 271 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 272 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 273 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 274 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 275 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 276 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 277 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 278 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 279 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 280 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 281 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 282 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 283 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 284 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 285 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 286 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 287 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 288 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 289 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 290 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 291 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 292 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 293 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 294 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 295 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 296 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 297 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 298 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 299 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 300 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 301 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 302 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 303 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 304 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 305 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 306 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 307 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 308 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 309 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 310 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 311 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 312 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 313 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 314 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 315 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 316 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 317 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 318 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 319 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 320 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 321 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 322 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 323 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 324 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 325 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 326 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 327 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 328 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 329 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 330 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 331 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 332 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 333 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 334 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 335 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 336 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 337 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 338 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 339 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 340 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 341 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 342 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 343 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 344 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 345 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 346 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 347 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 348 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 349 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 350 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 351 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 352 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 353 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 354 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 355 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 356 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 357 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 358 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 359 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 360 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 361 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 362 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 363 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 364 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 365 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 366 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 367 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 368 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 369 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 370 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 371 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 372 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 373 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 374 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 375 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 376 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 377 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 378 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 379 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 380 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 381 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 382 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 383 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 384 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 385 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 386 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 387 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 388 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 389 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 390 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 391 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 392 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 393 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 394 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 395 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 396 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 397 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 398 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 399 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 400 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 401 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 402 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 403 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 404 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 405 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 406 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 407 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 408 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 409 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 410 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 411 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 412 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 413 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 414 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 415 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 416 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 417 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 418 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 419 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 420 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 421 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 422 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 423 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 424 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 425 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 426 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 427 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 428 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 429 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 430 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 431 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 432 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 433 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 434 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 435 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 436 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 437 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 438 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 439 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 440 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 441 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 442 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 443 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 444 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 445 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 446 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 447 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 448 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 449 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 450 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 451 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 452 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 453 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 454 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 455 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 456 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 457 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 458 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 459 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 460 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 461 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 462 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 463 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 464 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 465 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 466 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 467 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 468 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 469 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 470 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 471 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 472 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 473 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 474 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 475 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 476 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 477 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 478 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 479 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 480 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 481 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 482 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 483 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 484 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 485 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 486 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 487 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 488 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 489 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 490 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 491 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 492 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 493 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 494 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 495 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 496 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 497 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 498 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 499 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 500 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 501 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 502 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 503 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 504 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 505 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 506 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 507 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 508 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 509 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 510 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 511 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 512 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 513 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 514 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 515 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 516 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 517 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 518 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 519 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 520 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 521 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 522 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 523 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 524 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 525 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 526 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 527 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 528 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 529 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 530 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 531 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 532 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 533 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.75 |
| Metatranscriptomes | 1.28 |
| Isolates | 35.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.64 |
| Bulb | 0.11 |
| Endosphere | 7.15 |
| Nodule | 2.35 |
| Rhizoplane | 7.04 |
| Rhizosphere | 52.93 |
| Stem | 0.11 |
| Stem Tuber | 0.53 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000274 | 3300001989 | Bacteria | 17327 |
| 2 | JGI24744J21845_10014432 | 3300002077 | Bacteria | 1586 |
| 3 | JGI25162J39368_1000019 | 3300002737 | Bacteria | 262053 |
| 4 | JGI25162J39368_1001119 | 3300002737 | Bacteria | 16153 |
| 5 | JGI25163J39215_1000121 | 3300002771 | Bacteria | 32543 |
| 6 | JGI25164J39214_1000011 | 3300002772 | Bacteria | 262057 |
| 7 | JGI25152J39213_1000139 | 3300002773 | Bacteria | 49588 |
| 8 | JGI25151J46595_10000158 | 3300003187 | Bacteria | 87889 |
| 9 | JGI25151J46595_10003023 | 3300003187 | Bacteria | 9556 |
| 10 | JGI25151J46595_10014500 | 3300003187 | Bacteria | 3507 |
| 11 | JGI25151J46595_10015640 | 3300003187 | Bacteria | 3336 |
| 12 | JGI25151J46595_10027687 | 3300003187 | Bacteria | 2267 |
| 13 | Ga0006562J51391_1002186 | 3300003578 | Bacteria | 1580 |
| 14 | Ga0006562J51391_1006751 | 3300003578 | Bacteria | 7620 |
| 15 | Ga0006562J51391_1016265 | 3300003578 | Bacteria | 1888 |
| 16 | Ga0055538_1000021 | 3300003751 | Bacteria | 262057 |
| 17 | Ga0055538_1000316 | 3300003751 | Bacteria | 22997 |
| 18 | Ga0055539_1000026 | 3300003752 | Bacteria | 262057 |
| 19 | Ga0055533_1000035 | 3300003756 | Bacteria | 262057 |
| 20 | Ga0055532_1000233 | 3300003758 | Bacteria | 41111 |
| 21 | Ga0055525_1000045 | 3300003759 | Bacteria | 262057 |
| 22 | Ga0055535_1002935 | 3300003761 | Bacteria | 5291 |
| 23 | Ga0055531_10000234 | 3300003794 | Bacteria | 60772 |
| 24 | Ga0055541_1000020 | 3300003841 | Bacteria | 262057 |
| 25 | Ga0055541_1000831 | 3300003841 | Bacteria | 7590 |
| 26 | Ga0055541_1005311 | 3300003841 | Bacteria | 2257 |
| 27 | Ga0058692_1000099 | 3300003856 | Bacteria | 57042 |
| 28 | Ga0058692_1000261 | 3300003856 | Bacteria | 28622 |
| 29 | Ga0058692_1000354 | 3300003856 | Bacteria | 22335 |
| 30 | Ga0058692_1000393 | 3300003856 | Bacteria | 20974 |
| 31 | Ga0058692_1000468 | 3300003856 | Bacteria | 18161 |
| 32 | Ga0058692_1001738 | 3300003856 | Bacteria | 7757 |
| 33 | Ga0058692_1004623 | 3300003856 | Bacteria | 4052 |
| 34 | Ga0058692_1007067 | 3300003856 | Bacteria | 3014 |
| 35 | Ga0058692_1009103 | 3300003856 | Bacteria | 2524 |
| 36 | Ga0065703_1019809 | 3300005272 | Bacteria | 2385 |
| 37 | Ga0065704_10000261 | 3300005289 | Bacteria | 53884 |
| 38 | Ga0065704_10000708 | 3300005289 | Bacteria | 46350 |
| 39 | Ga0065704_10070603 | 3300005289 | Bacteria | 19322 |
| 40 | Ga0065704_10070657 | 3300005289 | Bacteria | 18234 |
| 41 | Ga0065704_10112895 | 3300005289 | Bacteria | 1922 |
| 42 | Ga0070658_10000763 | 3300005327 | Bacteria | 27616 |
| 43 | Ga0070658_10013013 | 3300005327 | Bacteria | 6678 |
| 44 | Ga0070690_100075534 | 3300005330 | Bacteria | 2197 |
| 45 | Ga0068868_100003167 | 3300005338 | Bacteria | 11453 |
| 46 | Ga0070660_100016489 | 3300005339 | Bacteria | 5362 |
| 47 | Ga0070671_100002544 | 3300005355 | Bacteria | 14132 |
| 48 | Ga0070708_100034203 | 3300005445 | Bacteria | 4421 |
| 49 | Ga0070708_100069342 | 3300005445 | Bacteria | 3170 |
| 50 | Ga0070706_100000084 | 3300005467 | Bacteria | 109077 |
| 51 | Ga0070706_100000277 | 3300005467 | Bacteria | 62380 |
| 52 | Ga0070706_100000858 | 3300005467 | Bacteria | 33483 |
| 53 | Ga0070706_100025427 | 3300005467 | Bacteria | 5449 |
| 54 | Ga0070706_100031538 | 3300005467 | Bacteria | 4886 |
| 55 | Ga0070707_100000029 | 3300005468 | Bacteria | 123116 |
| 56 | Ga0070707_100002389 | 3300005468 | Bacteria | 17929 |
| 57 | Ga0070707_100008844 | 3300005468 | Bacteria | 9340 |
| 58 | Ga0070707_100025604 | 3300005468 | Bacteria | 5599 |
| 59 | Ga0070698_100000166 | 3300005471 | Bacteria | 60815 |
| 60 | Ga0070698_100000793 | 3300005471 | Bacteria | 34351 |
| 61 | Ga0070698_100005108 | 3300005471 | Bacteria | 14369 |
| 62 | Ga0070698_100008670 | 3300005471 | Bacteria | 10957 |
| 63 | Ga0070698_100014576 | 3300005471 | Bacteria | 8301 |
| 64 | Ga0070698_100016460 | 3300005471 | Bacteria | 7801 |
| 65 | Ga0070698_100107780 | 3300005471 | Bacteria | 2753 |
| 66 | Ga0070698_100110789 | 3300005471 | Bacteria | 2710 |
| 67 | Ga0070699_100000171 | 3300005518 | Bacteria | 62282 |
| 68 | Ga0070699_100000395 | 3300005518 | Bacteria | 42275 |
| 69 | Ga0070699_100006492 | 3300005518 | Bacteria | 10184 |
| 70 | Ga0070699_100018451 | 3300005518 | Bacteria | 5993 |
| 71 | Ga0070699_100072515 | 3300005518 | Bacteria | 2995 |
| 72 | Ga0070684_100000077 | 3300005535 | Bacteria | 64172 |
| 73 | Ga0070697_100000003 | 3300005536 | Bacteria | 322584 |
| 74 | Ga0070697_100000806 | 3300005536 | Bacteria | 23524 |
| 75 | Ga0070697_100000866 | 3300005536 | Bacteria | 22778 |
| 76 | Ga0070697_100039204 | 3300005536 | Bacteria | 3830 |
| 77 | Ga0070665_100000464 | 3300005548 | Bacteria | 58895 |
| 78 | Ga0070665_100094141 | 3300005548 | Bacteria | 3001 |
| 79 | Ga0068857_100000207 | 3300005577 | Bacteria | 38345 |
| 80 | Ga0068859_100005482 | 3300005617 | Bacteria | 12917 |
| 81 | Ga0068858_100220246 | 3300005842 | Bacteria | 1797 |
| 82 | Ga0081455_10032838 | 3300005937 | Bacteria | 4671 |
| 83 | Ga0081538_10022116 | 3300005981 | Bacteria | 4619 |
| 84 | Ga0070717_10001202 | 3300006028 | Bacteria | 17535 |
| 85 | Ga0070717_10004253 | 3300006028 | Bacteria | 10324 |
| 86 | Ga0070717_10017018 | 3300006028 | Bacteria | 5647 |
| 87 | Ga0075364_10003469 | 3300006051 | Bacteria | 8974 |
| 88 | Ga0075364_10038878 | 3300006051 | Bacteria | 3083 |
| 89 | Ga0075364_10094540 | 3300006051 | Bacteria | 1986 |
| 90 | Ga0070716_100038075 | 3300006173 | Bacteria | 2661 |
| 91 | Ga0075366_10002650 | 3300006195 | Bacteria | 9220 |
| 92 | Ga0097620_100005480 | 3300006931 | Bacteria | 12917 |
| 93 | Ga0079104_1000018 | 3300006946 | Bacteria | 271088 |
| 94 | Ga0079104_1000163 | 3300006946 | Bacteria | 94189 |
| 95 | Ga0079104_1000282 | 3300006946 | Bacteria | 65218 |
| 96 | Ga0079104_1000384 | 3300006946 | Bacteria | 51458 |
| 97 | Ga0079104_1000391 | 3300006946 | Bacteria | 50839 |
| 98 | Ga0079104_1001061 | 3300006946 | Bacteria | 20757 |
| 99 | Ga0079104_1001257 | 3300006946 | Bacteria | 17623 |
| 100 | Ga0079104_1003314 | 3300006946 | Bacteria | 7635 |
| 101 | Ga0079104_1006480 | 3300006946 | Bacteria | 4419 |
| 102 | Ga0105251_10001421 | 3300009011 | Bacteria | 20627 |
| 103 | Ga0105251_10001888 | 3300009011 | Bacteria | 17191 |
| 104 | Ga0105251_10003233 | 3300009011 | Bacteria | 12002 |
| 105 | Ga0105251_10003985 | 3300009011 | Bacteria | 10450 |
| 106 | Ga0105251_10007214 | 3300009011 | Bacteria | 6900 |
| 107 | Ga0105251_10014434 | 3300009011 | Bacteria | 4366 |
| 108 | Ga0105251_10041405 | 3300009011 | Bacteria | 2242 |
| 109 | Ga0105244_10000009 | 3300009036 | Bacteria | 286143 |
| 110 | Ga0105244_10000347 | 3300009036 | Bacteria | 43582 |
| 111 | Ga0105244_10000635 | 3300009036 | Bacteria | 31015 |
| 112 | Ga0105244_10000636 | 3300009036 | Bacteria | 30959 |
| 113 | Ga0105244_10000667 | 3300009036 | Bacteria | 30108 |
| 114 | Ga0105244_10000818 | 3300009036 | Bacteria | 26304 |
| 115 | Ga0105244_10000999 | 3300009036 | Bacteria | 23680 |
| 116 | Ga0105244_10001459 | 3300009036 | Bacteria | 19110 |
| 117 | Ga0105244_10003403 | 3300009036 | Bacteria | 11355 |
| 118 | Ga0105244_10003888 | 3300009036 | Bacteria | 10508 |
| 119 | Ga0105244_10007217 | 3300009036 | Bacteria | 7085 |
| 120 | Ga0105244_10013124 | 3300009036 | Bacteria | 4856 |
| 121 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 122 | Ga0105250_10000101 | 3300009092 | Bacteria | 76942 |
| 123 | Ga0105250_10000594 | 3300009092 | Bacteria | 23692 |
| 124 | Ga0105250_10000614 | 3300009092 | Bacteria | 23253 |
| 125 | Ga0105250_10001153 | 3300009092 | Bacteria | 14845 |
| 126 | Ga0105250_10001182 | 3300009092 | Bacteria | 14657 |
| 127 | Ga0105250_10004678 | 3300009092 | Bacteria | 6254 |
| 128 | Ga0105250_10006179 | 3300009092 | Bacteria | 5262 |
| 129 | Ga0105250_10011526 | 3300009092 | Bacteria | 3665 |
| 130 | Ga0105240_10193625 | 3300009093 | Bacteria | 2389 |
| 131 | Ga0105245_10010945 | 3300009098 | Bacteria | 7893 |
| 132 | Ga0105245_10141483 | 3300009098 | Bacteria | 2266 |
| 133 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 134 | Ga0105243_10032193 | 3300009148 | Bacteria | 4050 |
| 135 | Ga0105241_10000005 | 3300009174 | Bacteria | 384203 |
| 136 | Ga0105248_10004273 | 3300009177 | Bacteria | 15809 |
| 137 | Ga0105237_10000060 | 3300009545 | Bacteria | 146242 |
| 138 | Ga0105238_10133244 | 3300009551 | Bacteria | 2463 |
| 139 | Ga0105239_10027102 | 3300010375 | Bacteria | 6308 |
| 140 | Ga0105246_10005098 | 3300011119 | Bacteria | 7993 |
| 141 | Ga0105246_10005700 | 3300011119 | Bacteria | 7600 |
| 142 | Ga0105246_10053878 | 3300011119 | Bacteria | 2770 |
| 143 | Ga0157373_10000110 | 3300013100 | Bacteria | 64710 |
| 144 | Ga0157373_10001965 | 3300013100 | Bacteria | 15579 |
| 145 | Ga0157373_10017913 | 3300013100 | Bacteria | 5157 |
| 146 | Ga0157373_10028353 | 3300013100 | Bacteria | 4038 |
| 147 | Ga0157371_10000098 | 3300013102 | Bacteria | 134017 |
| 148 | Ga0157371_10000528 | 3300013102 | Bacteria | 45611 |
| 149 | Ga0157371_10000663 | 3300013102 | Bacteria | 40884 |
| 150 | Ga0157371_10000673 | 3300013102 | Bacteria | 40561 |
| 151 | Ga0157371_10000911 | 3300013102 | Bacteria | 33321 |
| 152 | Ga0157371_10004595 | 3300013102 | Bacteria | 11988 |
| 153 | Ga0157371_10025820 | 3300013102 | Bacteria | 4276 |
| 154 | Ga0157370_10000683 | 3300013104 | Bacteria | 42237 |
| 155 | Ga0157370_10001362 | 3300013104 | Bacteria | 30264 |
| 156 | Ga0157370_10030269 | 3300013104 | Bacteria | 5304 |
| 157 | Ga0157370_10086395 | 3300013104 | Bacteria | 2947 |
| 158 | Ga0157369_10000589 | 3300013105 | Bacteria | 47375 |
| 159 | Ga0157369_10000988 | 3300013105 | Bacteria | 35979 |
| 160 | Ga0157369_10005106 | 3300013105 | Bacteria | 15365 |
| 161 | Ga0157369_10012721 | 3300013105 | Bacteria | 9544 |
| 162 | Ga0157369_10042245 | 3300013105 | Bacteria | 4974 |
| 163 | Ga0157374_10008966 | 3300013296 | Bacteria | 8574 |
| 164 | Ga0157374_10084100 | 3300013296 | Bacteria | 3024 |
| 165 | Ga0163162_10007001 | 3300013306 | Bacteria | 10938 |
| 166 | Ga0157372_10005333 | 3300013307 | Bacteria | 13654 |
| 167 | Ga0157372_10012243 | 3300013307 | Bacteria | 9136 |
| 168 | Ga0157375_10000052 | 3300013308 | Bacteria | 130032 |
| 169 | Ga0157376_10000214 | 3300014969 | Bacteria | 40007 |
| 170 | Ga0182006_1000018 | 3300015261 | Bacteria | 299376 |
| 171 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 172 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 173 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 174 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 175 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 176 | Ga0213876_10000034 | 3300021384 | Bacteria | 202967 |
| 177 | Ga0209760_100004 | 3300025207 | Bacteria | 254650 |
| 178 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 179 | Ga0209784_100183 | 3300025224 | Bacteria | 50174 |
| 180 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 181 | Ga0209566_100054 | 3300025225 | Bacteria | 221422 |
| 182 | Ga0209566_100058 | 3300025225 | Bacteria | 201317 |
| 183 | Ga0209566_100072 | 3300025225 | Bacteria | 167764 |
| 184 | Ga0209566_100115 | 3300025225 | Bacteria | 107765 |
| 185 | Ga0209566_100574 | 3300025225 | Bacteria | 23768 |
| 186 | Ga0209566_100703 | 3300025225 | Bacteria | 19289 |
| 187 | Ga0209566_101096 | 3300025225 | Bacteria | 10509 |
| 188 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 189 | Ga0209147_100088 | 3300025229 | Bacteria | 179728 |
| 190 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 191 | Ga0207427_100012 | 3300025231 | Bacteria | 585657 |
| 192 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 193 | Ga0209437_100238 | 3300025233 | Bacteria | 90380 |
| 194 | Ga0209437_100302 | 3300025233 | Bacteria | 68690 |
| 195 | Ga0209437_100909 | 3300025233 | Bacteria | 11539 |
| 196 | Ga0209258_103608 | 3300025242 | Bacteria | 3264 |
| 197 | Ga0209258_104781 | 3300025242 | Bacteria | 2465 |
| 198 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 199 | Ga0209129_1000077 | 3300025258 | Bacteria | 193474 |
| 200 | Ga0209233_1004169 | 3300025261 | Bacteria | 4969 |
| 201 | Ga0209130_1000320 | 3300025284 | Bacteria | 56333 |
| 202 | Ga0209676_1001699 | 3300025292 | Bacteria | 19044 |
| 203 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 204 | Ga0209025_1000368 | 3300025294 | Bacteria | 95103 |
| 205 | Ga0209025_1003105 | 3300025294 | Bacteria | 16286 |
| 206 | Ga0209025_1008379 | 3300025294 | Bacteria | 7450 |
| 207 | Ga0209025_1008947 | 3300025294 | Bacteria | 7083 |
| 208 | Ga0209025_1009924 | 3300025294 | Bacteria | 6543 |
| 209 | Ga0209025_1013065 | 3300025294 | Bacteria | 5250 |
| 210 | Ga0209025_1022408 | 3300025294 | Bacteria | 3351 |
| 211 | Ga0209025_1033559 | 3300025294 | Bacteria | 2368 |
| 212 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 213 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 214 | Ga0209257_1017430 | 3300025304 | Bacteria | 2828 |
| 215 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 216 | Ga0207696_1000013 | 3300025711 | Bacteria | 524881 |
| 217 | Ga0207696_1000021 | 3300025711 | Bacteria | 432606 |
| 218 | Ga0207696_1000053 | 3300025711 | Bacteria | 268590 |
| 219 | Ga0207696_1000058 | 3300025711 | Bacteria | 248495 |
| 220 | Ga0207696_1000620 | 3300025711 | Bacteria | 26106 |
| 221 | Ga0207696_1000622 | 3300025711 | Bacteria | 26024 |
| 222 | Ga0207696_1001212 | 3300025711 | Bacteria | 14657 |
| 223 | Ga0207696_1001317 | 3300025711 | Bacteria | 13720 |
| 224 | Ga0207696_1001388 | 3300025711 | Bacteria | 13239 |
| 225 | Ga0207696_1003318 | 3300025711 | Bacteria | 7404 |
| 226 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 227 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 228 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 229 | Ga0207655_1000036 | 3300025728 | Bacteria | 356747 |
| 230 | Ga0207655_1000447 | 3300025728 | Bacteria | 54492 |
| 231 | Ga0207655_1000604 | 3300025728 | Bacteria | 43480 |
| 232 | Ga0207655_1000642 | 3300025728 | Bacteria | 41825 |
| 233 | Ga0207655_1000733 | 3300025728 | Bacteria | 37019 |
| 234 | Ga0207655_1000829 | 3300025728 | Bacteria | 33362 |
| 235 | Ga0207655_1001670 | 3300025728 | Bacteria | 19607 |
| 236 | Ga0207655_1002030 | 3300025728 | Bacteria | 17117 |
| 237 | Ga0207655_1005626 | 3300025728 | Bacteria | 8482 |
| 238 | Ga0207655_1021087 | 3300025728 | Bacteria | 3320 |
| 239 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 240 | Ga0207713_1000012 | 3300025735 | Bacteria | 501860 |
| 241 | Ga0207713_1000047 | 3300025735 | Bacteria | 229463 |
| 242 | Ga0207713_1000132 | 3300025735 | Bacteria | 113216 |
| 243 | Ga0207713_1000383 | 3300025735 | Bacteria | 47969 |
| 244 | Ga0207713_1001567 | 3300025735 | Bacteria | 17940 |
| 245 | Ga0207713_1002227 | 3300025735 | Bacteria | 14371 |
| 246 | Ga0207713_1002776 | 3300025735 | Bacteria | 12377 |
| 247 | Ga0207713_1005688 | 3300025735 | Bacteria | 7738 |
| 248 | Ga0207713_1012704 | 3300025735 | Bacteria | 4483 |
| 249 | Ga0207713_1049410 | 3300025735 | Bacteria | 1686 |
| 250 | Ga0207710_10000150 | 3300025900 | Bacteria | 79270 |
| 251 | Ga0207705_10002539 | 3300025909 | Bacteria | 14057 |
| 252 | Ga0207705_10005126 | 3300025909 | Bacteria | 9824 |
| 253 | Ga0207684_10000002 | 3300025910 | Bacteria | 1042751 |
| 254 | Ga0207684_10000008 | 3300025910 | Bacteria | 601602 |
| 255 | Ga0207684_10000040 | 3300025910 | Bacteria | 262703 |
| 256 | Ga0207684_10017137 | 3300025910 | Bacteria | 6218 |
| 257 | Ga0207654_10000007 | 3300025911 | Bacteria | 384211 |
| 258 | Ga0207671_10000062 | 3300025914 | Bacteria | 172081 |
| 259 | Ga0207657_10041612 | 3300025919 | Bacteria | 4062 |
| 260 | Ga0207646_10000142 | 3300025922 | Bacteria | 98159 |
| 261 | Ga0207646_10000333 | 3300025922 | Bacteria | 63824 |
| 262 | Ga0207646_10000613 | 3300025922 | Bacteria | 46430 |
| 263 | Ga0207646_10002050 | 3300025922 | Bacteria | 24191 |
| 264 | Ga0207646_10003431 | 3300025922 | Bacteria | 17898 |
| 265 | Ga0207646_10003981 | 3300025922 | Bacteria | 16377 |
| 266 | Ga0207646_10009446 | 3300025922 | Bacteria | 9641 |
| 267 | Ga0207646_10011676 | 3300025922 | Bacteria | 8493 |
| 268 | Ga0207646_10012410 | 3300025922 | Bacteria | 8189 |
| 269 | Ga0207687_10005575 | 3300025927 | Bacteria | 8316 |
| 270 | Ga0207664_10161207 | 3300025929 | Bacteria | 1913 |
| 271 | Ga0207709_10016891 | 3300025935 | Bacteria | 4066 |
| 272 | Ga0207711_10021152 | 3300025941 | Bacteria | 5434 |
| 273 | Ga0207661_10000015 | 3300025944 | Bacteria | 318960 |
| 274 | Ga0207668_10018611 | 3300025972 | Bacteria | 4375 |
| 275 | Ga0207677_10000048 | 3300026023 | Bacteria | 101555 |
| 276 | Ga0207674_10002163 | 3300026116 | Bacteria | 24860 |
| 277 | Ga0207674_10071284 | 3300026116 | Bacteria | 3492 |
| 278 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 279 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 280 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 281 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 282 | Ga0209281_1000071 | 3300027111 | Bacteria | 274050 |
| 283 | Ga0209281_1000257 | 3300027111 | Bacteria | 103090 |
| 284 | Ga0209281_1000370 | 3300027111 | Bacteria | 72879 |
| 285 | Ga0209281_1000714 | 3300027111 | Bacteria | 33175 |
| 286 | Ga0209281_1000926 | 3300027111 | Bacteria | 24167 |
| 287 | Ga0209281_1001332 | 3300027111 | Bacteria | 15526 |
| 288 | Ga0209281_1001392 | 3300027111 | Bacteria | 14777 |
| 289 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 290 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 291 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 292 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 293 | Ga0209371_1000099 | 3300027312 | Bacteria | 154918 |
| 294 | Ga0209371_1000100 | 3300027312 | Bacteria | 154467 |
| 295 | Ga0209371_1000120 | 3300027312 | Bacteria | 132938 |
| 296 | Ga0209371_1000466 | 3300027312 | Bacteria | 39817 |
| 297 | Ga0209371_1000778 | 3300027312 | Bacteria | 26405 |
| 298 | Ga0209371_1000832 | 3300027312 | Bacteria | 25391 |
| 299 | Ga0209371_1000964 | 3300027312 | Bacteria | 22330 |
| 300 | Ga0209371_1001051 | 3300027312 | Bacteria | 20781 |
| 301 | Ga0209371_1006561 | 3300027312 | Bacteria | 4277 |
| 302 | Ga0209371_1006984 | 3300027312 | Bacteria | 4047 |
| 303 | Ga0209371_1008478 | 3300027312 | Bacteria | 3410 |
| 304 | Ga0209371_1017486 | 3300027312 | Bacteria | 1856 |
| 305 | Ga0268266_10000286 | 3300028379 | Bacteria | 83269 |
| 306 | Ga0268266_10032002 | 3300028379 | Bacteria | 4469 |
| 307 | Ga0237817_10010 | 3300030083 | Bacteria | 78285 |
| 308 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 309 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 310 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 311 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 312 | Ga0268256_1000035 | 3300030500 | Bacteria | 384794 |
| 313 | Ga0268256_1000089 | 3300030500 | Bacteria | 154491 |
| 314 | Ga0268256_1000423 | 3300030500 | Bacteria | 38191 |
| 315 | Ga0268256_1000714 | 3300030500 | Bacteria | 24660 |
| 316 | Ga0268256_1000815 | 3300030500 | Bacteria | 22341 |
| 317 | Ga0268256_1001088 | 3300030500 | Bacteria | 17848 |
| 318 | Ga0268256_1001187 | 3300030500 | Bacteria | 16663 |
| 319 | Ga0268256_1001261 | 3300030500 | Bacteria | 15768 |
| 320 | Ga0268256_1001364 | 3300030500 | Bacteria | 14847 |
| 321 | Ga0268256_1004173 | 3300030500 | Bacteria | 6117 |
| 322 | Ga0268256_1007114 | 3300030500 | Bacteria | 4047 |
| 323 | Ga0268256_1010729 | 3300030500 | Bacteria | 2950 |
| 324 | Ga0268256_1019486 | 3300030500 | Bacteria | 1856 |
| 325 | Ga0265330_10006907 | 3300031235 | Bacteria | 5577 |
| 326 | Ga0265330_10059295 | 3300031235 | Bacteria | 1667 |
| 327 | Ga0265325_10008619 | 3300031241 | Bacteria | 6007 |
| 328 | Ga0265339_10002811 | 3300031249 | Bacteria | 12365 |
| 329 | Ga0265331_10052169 | 3300031250 | Bacteria | 1955 |
| 330 | Ga0265316_10014201 | 3300031344 | Bacteria | 7026 |
| 331 | Ga0307408_100121385 | 3300031548 | Bacteria | 2025 |
| 332 | Ga0265314_10030356 | 3300031711 | Bacteria | 4002 |
| 333 | Ga0265314_10057905 | 3300031711 | Bacteria | 2658 |
| 334 | Ga0265342_10004166 | 3300031712 | Bacteria | 11508 |
| 335 | Ga0316578_10026048 | 3300031728 | Bacteria | 3295 |
| 336 | Ga0316578_10033102 | 3300031728 | Bacteria | 2958 |
| 337 | Ga0307413_10033108 | 3300031824 | Bacteria | 2938 |
| 338 | Ga0307410_10006702 | 3300031852 | Bacteria | 6240 |
| 339 | Ga0307406_10024886 | 3300031901 | Bacteria | 3580 |
| 340 | Ga0307510_10087683 | 3300033180 | Bacteria | 2976 |
| 341 | Ga0316574_0076742 | 3300035398 | Bacteria | 2117 |
| 342 | Ga0316582_0011868 | 3300036647 | Bacteria | 4838 |
| 343 | Ga0316582_0067878 | 3300036647 | Bacteria | 2301 |
| 344 | Ga0316584_0043456 | 3300036712 | Bacteria | 3350 |
| 345 | Ga0373925_0087083 | 3300037068 | Bacteria | 2384 |
| 346 | Ga0395900_0223228 | 3300037418 | Bacteria | 1898 |
| 347 | Ga0237819_02091 | 3300038705 | Bacteria | 4335 |
| 348 | Ga0400488_52971 | 3300038741 | Bacteria | 12949 |
| 349 | Ga0400489_11819 | 3300039093 | Bacteria | 9617 |
| 350 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 351 | Ga0439436_0015324 | 3300041404 | Bacteria | 2306 |
| 352 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 353 | Ga0439439_0002184 | 3300041406 | Bacteria | 4108 |
| 354 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 355 | Ga0439466_0000450 | 3300041411 | Bacteria | 15663 |
| 356 | Ga0451853_3168715 | 3300041512 | Bacteria | 3791 |
| 357 | Ga0439432_000295 | 3300042006 | Bacteria | 17930 |
| 358 | Ga0439449_0000010 | 3300042007 | Bacteria | 58004 |
| 359 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 360 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 361 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 362 | Ga0439452_000031 | 3300042010 | Bacteria | 196691 |
| 363 | Ga0439452_000032 | 3300042010 | Bacteria | 184797 |
| 364 | Ga0439462_0024401 | 3300042015 | Bacteria | 1588 |
| 365 | Ga0451577_0007660 | 3300042876 | Bacteria | 10588 |
| 366 | Ga0466969_0000115 | 3300044656 | Bacteria | 42292 |
| 367 | Ga0466981_0000003 | 3300044669 | Bacteria | 248458 |
| 368 | Ga0453684_0002622 | 3300044712 | Bacteria | 42982 |
| 369 | Ga0451576_0042243 | 3300045051 | Bacteria | 4814 |
| 370 | Ga0466967_0006590 | 3300045976 | Bacteria | 8246 |
| 371 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 372 | Ga0495591_000001 | 3300046458 | Bacteria | 503087 |
| 373 | Ga0495591_000050 | 3300046458 | Bacteria | 137772 |
| 374 | Ga0495591_001001 | 3300046458 | Bacteria | 19212 |
| 375 | Ga0495638_0039389 | 3300046460 | Bacteria | 3000 |
| 376 | Ga0495650_0000031 | 3300046471 | Bacteria | 433811 |
| 377 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 378 | Ga0495650_0000182 | 3300046471 | Bacteria | 137031 |
| 379 | Ga0495607_0071972 | 3300046501 | Bacteria | 1926 |
| 380 | Ga0495606_0003900 | 3300046507 | Bacteria | 15370 |
| 381 | Ga0495606_0015548 | 3300046507 | Bacteria | 5856 |
| 382 | Ga0495648_0001866 | 3300046524 | Bacteria | 20143 |
| 383 | Ga0495654_0000009 | 3300046530 | Bacteria | 381872 |
| 384 | Ga0495654_0000068 | 3300046530 | Bacteria | 125533 |
| 385 | Ga0495654_0000596 | 3300046530 | Bacteria | 28899 |
| 386 | Ga0495654_0016346 | 3300046530 | Bacteria | 3926 |
| 387 | Ga0495597_0002098 | 3300046542 | Bacteria | 13248 |
| 388 | Ga0495622_0007079 | 3300046557 | Bacteria | 5212 |
| 389 | Ga0495633_0000002 | 3300046558 | Bacteria | 488754 |
| 390 | Ga0495656_0061371 | 3300046615 | Bacteria | 1642 |
| 391 | Ga0495649_0000504 | 3300046694 | Bacteria | 33380 |
| 392 | Ga0495649_0000543 | 3300046694 | Bacteria | 31982 |
| 393 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 394 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 395 | Ga0495660_0000015 | 3300046810 | Bacteria | 324892 |
| 396 | Ga0495660_0001493 | 3300046810 | Bacteria | 15817 |
| 397 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 398 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 399 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 400 | Ga0495683_0006239 | 3300047323 | Bacteria | 6522 |
| 401 | Ga0495679_000309 | 3300047446 | Bacteria | 39033 |
| 402 | Ga0495679_015728 | 3300047446 | Bacteria | 2758 |
| 403 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 404 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 405 | Ga0495681_0034070 | 3300047470 | Bacteria | 2541 |
| 406 | Ga0496101_0000157 | 3300048904 | Bacteria | 57989 |
| 407 | Ga0496102_0057081 | 3300048905 | Bacteria | 3563 |
| 408 | Ga0496102_0074750 | 3300048905 | Bacteria | 3115 |
| 409 | Ga0496103_0018887 | 3300048906 | Bacteria | 4140 |
| 410 | Ga0496104_0000100 | 3300048907 | Bacteria | 83437 |
| 411 | Ga0496108_0101917 | 3300048911 | Bacteria | 2449 |
| 412 | Ga0496108_0116454 | 3300048911 | Bacteria | 2289 |
| 413 | Ga0496110_0000084 | 3300048913 | Bacteria | 49140 |
| 414 | Ga0496111_0001174 | 3300048914 | Bacteria | 14587 |
| 415 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 416 | Ga0496116_0000094 | 3300048919 | Bacteria | 205588 |
| 417 | Ga0496116_0000110 | 3300048919 | Bacteria | 185668 |
| 418 | Ga0496116_0000140 | 3300048919 | Bacteria | 151165 |
| 419 | Ga0496116_0000625 | 3300048919 | Bacteria | 46424 |
| 420 | Ga0496116_0001704 | 3300048919 | Bacteria | 24089 |
| 421 | Ga0496116_0001737 | 3300048919 | Bacteria | 23762 |
| 422 | Ga0496116_0002154 | 3300048919 | Bacteria | 20968 |
| 423 | Ga0496116_0003742 | 3300048919 | Bacteria | 14874 |
| 424 | Ga0496116_0003924 | 3300048919 | Bacteria | 14491 |
| 425 | Ga0496116_0004165 | 3300048919 | Bacteria | 13923 |
| 426 | Ga0496116_0005211 | 3300048919 | Bacteria | 12176 |
| 427 | Ga0496116_0008976 | 3300048919 | Bacteria | 8595 |
| 428 | Ga0496116_0029920 | 3300048919 | Bacteria | 3918 |
| 429 | Ga0496116_0033684 | 3300048919 | Bacteria | 3630 |
| 430 | Ga0496116_0052606 | 3300048919 | Bacteria | 2696 |
| 431 | Ga0496117_0000009 | 3300048920 | Bacteria | 613759 |
| 432 | Ga0496117_0000138 | 3300048920 | Bacteria | 159456 |
| 433 | Ga0496117_0000154 | 3300048920 | Bacteria | 146606 |
| 434 | Ga0496117_0000380 | 3300048920 | Bacteria | 76671 |
| 435 | Ga0496117_0000835 | 3300048920 | Bacteria | 47629 |
| 436 | Ga0496117_0002117 | 3300048920 | Bacteria | 26059 |
| 437 | Ga0496117_0002120 | 3300048920 | Bacteria | 26005 |
| 438 | Ga0496117_0002436 | 3300048920 | Bacteria | 23465 |
| 439 | Ga0496117_0003978 | 3300048920 | Bacteria | 16704 |
| 440 | Ga0496117_0004061 | 3300048920 | Bacteria | 16439 |
| 441 | Ga0496117_0008017 | 3300048920 | Bacteria | 10127 |
| 442 | Ga0496117_0018285 | 3300048920 | Bacteria | 5813 |
| 443 | Ga0496117_0019093 | 3300048920 | Bacteria | 5645 |
| 444 | Ga0496117_0019839 | 3300048920 | Bacteria | 5504 |
| 445 | Ga0496117_0024460 | 3300048920 | Bacteria | 4777 |
| 446 | Ga0496117_0066848 | 3300048920 | Bacteria | 2436 |
| 447 | Ga0496118_0000017 | 3300048921 | Bacteria | 549445 |
| 448 | Ga0496118_0000150 | 3300048921 | Bacteria | 123251 |
| 449 | Ga0496118_0000158 | 3300048921 | Bacteria | 121361 |
| 450 | Ga0496118_0000894 | 3300048921 | Bacteria | 46807 |
| 451 | Ga0496118_0001286 | 3300048921 | Bacteria | 38322 |
| 452 | Ga0496118_0001914 | 3300048921 | Bacteria | 29615 |
| 453 | Ga0496118_0003457 | 3300048921 | Bacteria | 19860 |
| 454 | Ga0496118_0005328 | 3300048921 | Bacteria | 14648 |
| 455 | Ga0496118_0038280 | 3300048921 | Bacteria | 3846 |
| 456 | Ga0496118_0062714 | 3300048921 | Bacteria | 2740 |
| 457 | Ga0496119_0000012 | 3300048922 | Bacteria | 411917 |
| 458 | Ga0496119_0000027 | 3300048922 | Bacteria | 249124 |
| 459 | Ga0496119_0000049 | 3300048922 | Bacteria | 185482 |
| 460 | Ga0496119_0000166 | 3300048922 | Bacteria | 92117 |
| 461 | Ga0496119_0000352 | 3300048922 | Bacteria | 64461 |
| 462 | Ga0496119_0000468 | 3300048922 | Bacteria | 55018 |
| 463 | Ga0496119_0001574 | 3300048922 | Bacteria | 27136 |
| 464 | Ga0496119_0001730 | 3300048922 | Bacteria | 25447 |
| 465 | Ga0496119_0002241 | 3300048922 | Bacteria | 21509 |
| 466 | Ga0496119_0002860 | 3300048922 | Bacteria | 18410 |
| 467 | Ga0496119_0004253 | 3300048922 | Bacteria | 14348 |
| 468 | Ga0496119_0007695 | 3300048922 | Bacteria | 9641 |
| 469 | Ga0496119_0057325 | 3300048922 | Bacteria | 2354 |
| 470 | Ga0496120_0000004 | 3300048923 | Bacteria | 534793 |
| 471 | Ga0496120_0000022 | 3300048923 | Bacteria | 249124 |
| 472 | Ga0496120_0000048 | 3300048923 | Bacteria | 187988 |
| 473 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 474 | Ga0496120_0000057 | 3300048923 | Bacteria | 177460 |
| 475 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 476 | Ga0496120_0000207 | 3300048923 | Bacteria | 101327 |
| 477 | Ga0496120_0000406 | 3300048923 | Bacteria | 69216 |
| 478 | Ga0496120_0000673 | 3300048923 | Bacteria | 50130 |
| 479 | Ga0496120_0000711 | 3300048923 | Bacteria | 48821 |
| 480 | Ga0496120_0001027 | 3300048923 | Bacteria | 37319 |
| 481 | Ga0496120_0001489 | 3300048923 | Bacteria | 27770 |
| 482 | Ga0496120_0002104 | 3300048923 | Bacteria | 21311 |
| 483 | Ga0496120_0002703 | 3300048923 | Bacteria | 17378 |
| 484 | Ga0496120_0002884 | 3300048923 | Bacteria | 16472 |
| 485 | Ga0496121_0000389 | 3300048924 | Bacteria | 89759 |
| 486 | Ga0496121_0001226 | 3300048924 | Bacteria | 44634 |
| 487 | Ga0496121_0001655 | 3300048924 | Bacteria | 36766 |
| 488 | Ga0496121_0002208 | 3300048924 | Bacteria | 30406 |
| 489 | Ga0496121_0003017 | 3300048924 | Bacteria | 24448 |
| 490 | Ga0496121_0003296 | 3300048924 | Bacteria | 23186 |
| 491 | Ga0496121_0004821 | 3300048924 | Bacteria | 17759 |
| 492 | Ga0496121_0005634 | 3300048924 | Bacteria | 15936 |
| 493 | Ga0496121_0008356 | 3300048924 | Bacteria | 12216 |
| 494 | Ga0496121_0011405 | 3300048924 | Bacteria | 9874 |
| 495 | Ga0496121_0058635 | 3300048924 | Bacteria | 3180 |
| 496 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 497 | Ga0496122_0000007 | 3300048925 | Bacteria | 606493 |
| 498 | Ga0496122_0000088 | 3300048925 | Bacteria | 207600 |
| 499 | Ga0496122_0001843 | 3300048925 | Bacteria | 32310 |
| 500 | Ga0496122_0002182 | 3300048925 | Bacteria | 28670 |
| 501 | Ga0496122_0002922 | 3300048925 | Bacteria | 23306 |
| 502 | Ga0496122_0003024 | 3300048925 | Bacteria | 22811 |
| 503 | Ga0496122_0003212 | 3300048925 | Bacteria | 21739 |
| 504 | Ga0496122_0003434 | 3300048925 | Bacteria | 20839 |
| 505 | Ga0496122_0003484 | 3300048925 | Bacteria | 20689 |
| 506 | Ga0496122_0004956 | 3300048925 | Bacteria | 16133 |
| 507 | Ga0496122_0005161 | 3300048925 | Bacteria | 15734 |
| 508 | Ga0496122_0023005 | 3300048925 | Bacteria | 5515 |
| 509 | Ga0496122_0074389 | 3300048925 | Bacteria | 2404 |
| 510 | Ga0496122_0082854 | 3300048925 | Bacteria | 2226 |
| 511 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 512 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 513 | Ga0496123_0000139 | 3300048926 | Bacteria | 151469 |
| 514 | Ga0496123_0001504 | 3300048926 | Bacteria | 32310 |
| 515 | Ga0496123_0001770 | 3300048926 | Bacteria | 28492 |
| 516 | Ga0496123_0002717 | 3300048926 | Bacteria | 21261 |
| 517 | Ga0496123_0003304 | 3300048926 | Bacteria | 18279 |
| 518 | Ga0496123_0003928 | 3300048926 | Bacteria | 16133 |
| 519 | Ga0496123_0006718 | 3300048926 | Bacteria | 11073 |
| 520 | Ga0496123_0014520 | 3300048926 | Bacteria | 6521 |
| 521 | Ga0496123_0069160 | 3300048926 | Bacteria | 2219 |
| 522 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 523 | Ga0496124_0000025 | 3300048927 | Bacteria | 405471 |
| 524 | Ga0496124_0000045 | 3300048927 | Bacteria | 287396 |
| 525 | Ga0496124_0000368 | 3300048927 | Bacteria | 82338 |
| 526 | Ga0496124_0000484 | 3300048927 | Bacteria | 68281 |
| 527 | Ga0496124_0000620 | 3300048927 | Bacteria | 59508 |
| 528 | Ga0496124_0001484 | 3300048927 | Bacteria | 34470 |
| 529 | Ga0496124_0001931 | 3300048927 | Bacteria | 28393 |
| 530 | Ga0496124_0004039 | 3300048927 | Bacteria | 17427 |
| 531 | Ga0496124_0004060 | 3300048927 | Bacteria | 17353 |
| 532 | Ga0496124_0005302 | 3300048927 | Bacteria | 14569 |
| 533 | Ga0496124_0006843 | 3300048927 | Bacteria | 12281 |
| 534 | Ga0496124_0008449 | 3300048927 | Bacteria | 10765 |
| 535 | Ga0496124_0009313 | 3300048927 | Bacteria | 10123 |
| 536 | Ga0496124_0034182 | 3300048927 | Bacteria | 4465 |
| 537 | Ga0496124_0079461 | 3300048927 | Bacteria | 2701 |
| 538 | Ga0496125_0000013 | 3300048928 | Bacteria | 628761 |
| 539 | Ga0496125_0000065 | 3300048928 | Bacteria | 249830 |
| 540 | Ga0496125_0000728 | 3300048928 | Bacteria | 54555 |
| 541 | Ga0496125_0001229 | 3300048928 | Bacteria | 38359 |
| 542 | Ga0496125_0001911 | 3300048928 | Bacteria | 28512 |
| 543 | Ga0496125_0001991 | 3300048928 | Bacteria | 27713 |
| 544 | Ga0496125_0004865 | 3300048928 | Bacteria | 15247 |
| 545 | Ga0496125_0007236 | 3300048928 | Bacteria | 11823 |
| 546 | Ga0496125_0022076 | 3300048928 | Bacteria | 5917 |
| 547 | Ga0496125_0070815 | 3300048928 | Bacteria | 2728 |
| 548 | Ga0496125_0113723 | 3300048928 | Bacteria | 1952 |
| 549 | Ga0496126_0000865 | 3300048929 | Bacteria | 53248 |
| 550 | Ga0496126_0001727 | 3300048929 | Bacteria | 32416 |
| 551 | Ga0496126_0002119 | 3300048929 | Bacteria | 27745 |
| 552 | Ga0496126_0002405 | 3300048929 | Bacteria | 25405 |
| 553 | Ga0496126_0004050 | 3300048929 | Bacteria | 17821 |
| 554 | Ga0496126_0005402 | 3300048929 | Bacteria | 14587 |
| 555 | Ga0496126_0013484 | 3300048929 | Bacteria | 8306 |
| 556 | Ga0496126_0013750 | 3300048929 | Bacteria | 8208 |
| 557 | Ga0496126_0042116 | 3300048929 | Bacteria | 4219 |
| 558 | Ga0496126_0096786 | 3300048929 | Bacteria | 2587 |
| 559 | Ga0496126_0100424 | 3300048929 | Bacteria | 2532 |
| 560 | Ga0501306_000570 | 3300049127 | Bacteria | 2923 |
| 561 | Ga0501309_000677 | 3300049129 | Bacteria | 2943 |
| 562 | Ga0501305_003117 | 3300049161 | Bacteria | 1856 |
| 563 | Ga0495678_000777 | 3300049459 | Bacteria | 28686 |
| 564 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 565 | Ga0501312_002553 | 3300049528 | Bacteria | 1975 |
| 566 | Ga0501312_006488 | 3300049528 | Bacteria | 1461 |
| 567 | Ga0501316_002315 | 3300049532 | Bacteria | 1751 |
| 568 | Ga0501335_002418 | 3300049551 | Bacteria | 1514 |
| 569 | Ga0501031_0037347 | 3300049568 | Bacteria | 3170 |
| 570 | Ga0501033_0010131 | 3300049570 | Bacteria | 7235 |
| 571 | Ga0501034_0002371 | 3300049571 | Bacteria | 22883 |
| 572 | Ga0501034_0065414 | 3300049571 | Bacteria | 3648 |
| 573 | Ga0501034_0191312 | 3300049571 | Bacteria | 2008 |
| 574 | Ga0501036_0006154 | 3300049572 | Bacteria | 9735 |
| 575 | Ga0501036_0018299 | 3300049572 | Bacteria | 5866 |
| 576 | Ga0501038_0009093 | 3300049574 | Bacteria | 9117 |
| 577 | Ga0501040_0003798 | 3300049576 | Bacteria | 9794 |
| 578 | Ga0501042_0004170 | 3300049578 | Bacteria | 9185 |
| 579 | Ga0501042_0012426 | 3300049578 | Bacteria | 5769 |
| 580 | Ga0501043_0001906 | 3300049579 | Bacteria | 17879 |
| 581 | Ga0501047_0004030 | 3300049581 | Bacteria | 13813 |
| 582 | Ga0501048_0021270 | 3300049582 | Bacteria | 4750 |
| 583 | Ga0501048_0099152 | 3300049582 | Bacteria | 2055 |
| 584 | Ga0501071_0015764 | 3300049587 | Bacteria | 5191 |
| 585 | Ga0501072_0029589 | 3300049588 | Bacteria | 4280 |
| 586 | Ga0501074_0000975 | 3300049590 | Bacteria | 18524 |
| 587 | Ga0501074_0002363 | 3300049590 | Bacteria | 13134 |
| 588 | Ga0501075_0135783 | 3300049591 | Bacteria | 1874 |
| 589 | Ga0501077_0084641 | 3300049593 | Bacteria | 2010 |
| 590 | Ga0501208_007007 | 3300049655 | Bacteria | 1462 |
| 591 | Ga0501217_002322 | 3300049661 | Bacteria | 3728 |
| 592 | Ga0501081_0076057 | 3300049743 | Bacteria | 2344 |
| 593 | Ga0501083_0036383 | 3300049744 | Bacteria | 3358 |
| 594 | nmdc:mga00v17_27254_c1 | 3300050491 | Bacteria | 3335 |
| 595 | nmdc:mga0yw44_46769_c1 | 3300050492 | Bacteria | 2600 |
| 596 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 597 | Ga0501084_0041452 | 3300054114 | Bacteria | 3851 |
| 598 | Ga0587070_000683 | 3300059491 | Bacteria | 3035 |
| 599 | Ga0587079_004153 | 3300059647 | Bacteria | 1947 |
| 600 | Ga0501082_0015040 | 3300060353 | Bacteria | 6668 |
| 601 | 2728532475 | 2728368933 | Bacteria | 7044283 |
| 602 | 2506577637 | 2506520007 | Bacteria | 5442880 |
| 603 | 2506582775 | 2506520008 | Bacteria | 5443009 |
| 604 | 2508851572 | 2508501071 | Bacteria | 5454741 |
| 605 | 2511379904 | 2511231025 | Bacteria | 5324661 |
| 606 | 2511434759 | 2511231035 | Bacteria | 5341610 |
| 607 | 2511700177 | 2511231119 | Bacteria | 4019861 |
| 608 | 2512734762 | 2512564039 | Bacteria | 8739048 |
| 609 | 2524006727 | 2523533629 | Bacteria | 2982326 |
| 610 | 2524186486 | 2524023129 | Bacteria | 6762600 |
| 611 | 2524190970 | 2524023129 | Bacteria | 6762600 |
| 612 | 2538427431 | 2537561728 | Bacteria | 5149301 |
| 613 | 2540607322 | 2540341094 | Bacteria | 4061186 |
| 614 | 2545556859 | 2545555800 | Bacteria | 4222588 |
| 615 | 2547697174 | 2547132181 | Bacteria | 4945084 |
| 616 | 2548649647 | 2547132416 | Bacteria | 4633861 |
| 617 | 2550900507 | 2548877040 | Bacteria | 7507281 |
| 618 | 2555261286 | 2554235234 | Bacteria | 5762085 |
| 619 | 2555467569 | 2554235283 | Bacteria | 3683090 |
| 620 | 2562463330 | 2561511199 | Bacteria | 5155034 |
| 621 | 2563927045 | 2563366752 | Bacteria | 4961801 |
| 622 | 2563929288 | 2563366752 | Bacteria | 4961801 |
| 623 | 2566993980 | 2565956761 | Bacteria | 6601618 |
| 624 | 2571533549 | 2571042143 | Bacteria | 6986194 |
| 625 | 2573038021 | 2571042588 | Bacteria | 5045676 |
| 626 | 2578931110 | 2576861599 | Bacteria | 4217202 |
| 627 | 2580930488 | 2579778775 | Bacteria | 5360914 |
| 628 | 2585829855 | 2585427591 | Bacteria | 5482980 |
| 629 | 2585835015 | 2585427592 | Bacteria | 5370892 |
| 630 | 2587737934 | 2585428059 | Bacteria | 8696589 |
| 631 | 2587743737 | 2585428059 | Bacteria | 8696589 |
| 632 | 2590611802 | 2588254257 | Bacteria | 5436094 |
| 633 | 2595088022 | 2593339131 | Bacteria | 5116855 |
| 634 | 2595316615 | 2593339198 | Bacteria | 7267884 |
| 635 | 2599411442 | 2599185169 | Bacteria | 5441380 |
| 636 | 2599926354 | 2599185299 | Bacteria | 4854625 |
| 637 | 2601524439 | 2600255254 | Bacteria | 5281859 |
| 638 | 2601529593 | 2600255255 | Bacteria | 5282785 |
| 639 | 2601534814 | 2600255256 | Bacteria | 5597742 |
| 640 | 2601539557 | 2600255257 | Bacteria | 5597196 |
| 641 | 2601616427 | 2600255280 | Bacteria | 5292309 |
| 642 | 2601621149 | 2600255281 | Bacteria | 5288753 |
| 643 | 2601638668 | 2600255286 | Bacteria | 5390125 |
| 644 | 2601641862 | 2600255287 | Bacteria | 5210468 |
| 645 | 2601649546 | 2600255288 | Bacteria | 5282738 |
| 646 | 2601654473 | 2600255289 | Bacteria | 5281907 |
| 647 | 2601659895 | 2600255290 | Bacteria | 5282218 |
| 648 | 2601665920 | 2600255291 | Bacteria | 5217298 |
| 649 | 2601698777 | 2600255298 | Bacteria | 5215185 |
| 650 | 2601701605 | 2600255299 | Bacteria | 5218662 |
| 651 | 2601707217 | 2600255300 | Bacteria | 5287774 |
| 652 | 2601711831 | 2600255301 | Bacteria | 5280532 |
| 653 | 2601717734 | 2600255302 | Bacteria | 5288235 |
| 654 | 2601719669 | 2600255303 | Bacteria | 5219315 |
| 655 | 2601727662 | 2600255304 | Bacteria | 5283973 |
| 656 | 2601732273 | 2600255305 | Bacteria | 5282329 |
| 657 | 2601739496 | 2600255306 | Bacteria | 5281613 |
| 658 | 2601741492 | 2600255307 | Bacteria | 5439064 |
| 659 | 2601752254 | 2600255309 | Bacteria | 5431045 |
| 660 | 2601757907 | 2600255310 | Bacteria | 5600903 |
| 661 | 2601764265 | 2600255311 | Bacteria | 5598766 |
| 662 | 2602019095 | 2600255392 | Bacteria | 5437392 |
| 663 | 2603637081 | 2602042046 | Bacteria | 5483348 |
| 664 | 2603645036 | 2602042047 | Bacteria | 4697674 |
| 665 | 2603661361 | 2602042052 | Bacteria | 5215873 |
| 666 | 2603664315 | 2602042053 | Bacteria | 5214361 |
| 667 | 2603699160 | 2602042066 | Bacteria | 4423871 |
| 668 | 2603705175 | 2602042067 | Bacteria | 4863713 |
| 669 | 2603840088 | 2602042103 | Bacteria | 5284714 |
| 670 | 2603845165 | 2602042104 | Bacteria | 5281639 |
| 671 | 2603849830 | 2602042105 | Bacteria | 5282303 |
| 672 | 2603855306 | 2602042106 | Bacteria | 5282744 |
| 673 | 2603868774 | 2602042109 | Bacteria | 5152801 |
| 674 | 2603872887 | 2602042110 | Bacteria | 5283285 |
| 675 | 2603876658 | 2602042111 | Bacteria | 5212080 |
| 676 | 2606049656 | 2603880178 | Bacteria | 5283018 |
| 677 | 2606068745 | 2603880184 | Bacteria | 5217896 |
| 678 | 2606147750 | 2603880202 | Bacteria | 5284684 |
| 679 | 2606177545 | 2603880211 | Bacteria | 5284226 |
| 680 | 2608669894 | 2608642108 | Bacteria | 4104624 |
| 681 | 2609909853 | 2609459761 | Bacteria | 5513740 |
| 682 | 2621274931 | 2619619294 | Bacteria | 5575484 |
| 683 | 2631984442 | 2630968484 | Bacteria | 3876276 |
| 684 | 2637224263 | 2636415599 | Bacteria | 5718434 |
| 685 | 2643735519 | 2643221543 | Bacteria | 6628015 |
| 686 | 2643738110 | 2643221543 | Bacteria | 6628015 |
| 687 | 2644422972 | 2643221676 | Bacteria | 8119172 |
| 688 | 2644740738 | 2643221735 | Bacteria | 3676263 |
| 689 | 2650897101 | 2648501693 | Bacteria | 5069560 |
| 690 | 2651531945 | 2648501850 | Bacteria | 3975476 |
| 691 | 2656278681 | 2654587920 | Bacteria | 5475511 |
| 692 | 2671101324 | 2667528172 | Bacteria | 5170840 |
| 693 | 2671108739 | 2667528173 | Bacteria | 5375747 |
| 694 | 2671585545 | 2671180115 | Bacteria | 5353919 |
| 695 | 2672336854 | 2671180330 | Bacteria | 5521719 |
| 696 | 2673820885 | 2671180694 | Bacteria | 7506943 |
| 697 | 2674419014 | 2671180844 | Bacteria | 4164150 |
| 698 | 2676405668 | 2675903046 | Bacteria | 5451247 |
| 699 | 2681996411 | 2681812866 | Bacteria | 4552357 |
| 700 | 2682006240 | 2681812869 | Bacteria | 5014465 |
| 701 | 2686354009 | 2684622997 | Bacteria | 4624240 |
| 702 | 2686997393 | 2684623153 | Bacteria | 3878815 |
| 703 | 2687498703 | 2687453109 | Bacteria | 3860091 |
| 704 | 2689444127 | 2687453601 | Bacteria | 5546041 |
| 705 | 2695628154 | 2695420354 | Bacteria | 3922431 |
| 706 | 2712469423 | 2711768156 | Bacteria | 4471618 |
| 707 | 2717916138 | 2716884898 | Bacteria | 3928789 |
| 708 | 2723604845 | 2721755693 | Bacteria | 6126117 |
| 709 | 2730135482 | 2728369359 | Bacteria | 5621728 |
| 710 | 2738890151 | 2738541308 | Bacteria | 7020677 |
| 711 | 2739239501 | 2738543011 | Bacteria | 5731169 |
| 712 | 2739267941 | 2738543017 | Bacteria | 4271950 |
| 713 | 2753809715 | 2751185905 | Bacteria | 6142767 |
| 714 | 2753856726 | 2751185917 | Bacteria | 4551186 |
| 715 | 2757566000 | 2757320391 | Bacteria | 4746095 |
| 716 | 2765589820 | 2765235842 | Bacteria | 4799256 |
| 717 | 2772438155 | 2772190666 | Bacteria | 5117644 |
| 718 | 2775539755 | 2775506706 | Bacteria | 4873073 |
| 719 | 2777020765 | 2775507074 | Bacteria | 5532402 |
| 720 | 2777762229 | 2775507177 | Bacteria | 4384303 |
| 721 | 2791922023 | 2791354903 | Bacteria | 4937680 |
| 722 | 2792310359 | 2791355010 | Bacteria | 4864581 |
| 723 | 2793184584 | 2791355222 | Bacteria | 5898266 |
| 724 | 2793404935 | 2791355275 | Bacteria | 4429597 |
| 725 | 2802437100 | 2802428803 | Bacteria | 5806948 |
| 726 | 2807176500 | 2806310673 | Bacteria | 4801221 |
| 727 | 2808901384 | 2808606372 | Bacteria | 4649509 |
| 728 | 2809055998 | 2808606399 | Bacteria | 4021018 |
| 729 | 2809125562 | 2808606414 | Bacteria | 4917181 |
| 730 | 2812316586 | 2811994870 | Bacteria | 3776934 |
| 731 | 2813728091 | 2811995292 | Bacteria | 5303342 |
| 732 | 2814695643 | 2814123068 | Bacteria | 5687681 |
| 733 | 2816862686 | 2816332186 | Bacteria | 5331395 |
| 734 | 2817480676 | 2816332295 | Bacteria | 4352468 |
| 735 | 2819565263 | 2818991440 | Bacteria | 4774720 |
| 736 | 2819569166 | 2818991441 | Bacteria | 5062707 |
| 737 | 2819670353 | 2818991459 | Bacteria | 8736032 |
| 738 | 2819673610 | 2818991459 | Bacteria | 8736032 |
| 739 | 2819723650 | 2818991468 | Bacteria | 3723169 |
| 740 | 2821112011 | 2821111986 | Bacteria | 6894338 |
| 741 | 2821114592 | 2821111986 | Bacteria | 6894338 |
| 742 | 2821120840 | 2821118458 | Bacteria | 4714306 |
| 743 | 2823375474 | 2823373977 | Bacteria | 4779415 |
| 744 | 2823528569 | 2823526263 | Bacteria | 3765752 |
| 745 | 2831908025 | 2831905167 | Bacteria | 3319172 |
| 746 | 2842684391 | 2842682962 | Bacteria | 5589973 |
| 747 | 2842891766 | 2842888712 | Bacteria | 4279094 |
| 748 | 2844528987 | 2844528606 | Bacteria | 4733806 |
| 749 | 2846542110 | 2846540461 | Bacteria | 5471451 |
| 750 | 2847086786 | 2847085930 | Bacteria | 5070450 |
| 751 | 2847799135 | 2847797336 | Bacteria | 5176640 |
| 752 | 2849144358 | 2849139964 | Bacteria | 5613304 |
| 753 | 2852107593 | 2852103415 | Bacteria | 5193810 |
| 754 | 2855199390 | 2855195626 | Bacteria | 4927512 |
| 755 | 2857454566 | 2857453340 | Bacteria | 8090534 |
| 756 | 2857457147 | 2857453340 | Bacteria | 8090534 |
| 757 | 2857473139 | 2857472729 | Bacteria | 6568124 |
| 758 | 2857582421 | 2857581216 | Bacteria | 5522813 |
| 759 | 2857587168 | 2857586860 | Bacteria | 4354574 |
| 760 | 2857608584 | 2857604169 | Bacteria | 5111450 |
| 761 | 2857610251 | 2857609550 | Bacteria | 3753890 |
| 762 | 2857610874 | 2857609550 | Bacteria | 3753890 |
| 763 | 2858439760 | 2858438669 | Bacteria | 2058402 |
| 764 | 2858470187 | 2858466076 | Bacteria | 4722413 |
| 765 | 2860840009 | 2860837431 | Bacteria | 4202080 |
| 766 | 2864737936 | 2864733723 | Bacteria | 6770668 |
| 767 | 2864739032 | 2864733723 | Bacteria | 6770668 |
| 768 | 2865000148 | 2864997549 | Bacteria | 5139696 |
| 769 | 2865004176 | 2865002811 | Bacteria | 6333767 |
| 770 | 2865017437 | 2865014394 | Bacteria | 4764573 |
| 771 | 2869553486 | 2869551831 | Bacteria | 5474685 |
| 772 | 2871275380 | 2871272651 | Bacteria | 5042015 |
| 773 | 2871286594 | 2871282230 | Bacteria | 4917173 |
| 774 | 2876602919 | 2876601092 | Bacteria | 5114497 |
| 775 | 2877771058 | 2877768649 | Bacteria | 3957164 |
| 776 | 2880171923 | 2880169592 | Bacteria | 3900066 |
| 777 | 2881610213 | 2881609920 | Bacteria | 4405319 |
| 778 | 2881641109 | 2881636855 | Bacteria | 5205297 |
| 779 | 2884088137 | 2884086401 | Bacteria | 5005459 |
| 780 | 2885527642 | 2885526491 | Bacteria | 7164189 |
| 781 | 2888368174 | 2888366609 | Bacteria | 5155009 |
| 782 | 2888374215 | 2888373701 | Bacteria | 5098052 |
| 783 | 2888582713 | 2888578766 | Bacteria | 6743310 |
| 784 | 2888583106 | 2888578766 | Bacteria | 6743310 |
| 785 | 2889046247 | 2889042446 | Bacteria | 7618936 |
| 786 | 2889046738 | 2889042446 | Bacteria | 7618936 |
| 787 | 2889055081 | 2889049205 | Bacteria | 7524325 |
| 788 | 2889280756 | 2889276214 | Bacteria | 5979355 |
| 789 | 2889296271 | 2889295896 | Bacteria | 4704906 |
| 790 | 2889301920 | 2889300758 | Bacteria | 5690814 |
| 791 | 2891672151 | 2891670763 | Bacteria | 4967099 |
| 792 | 2897112133 | 2897109615 | Bacteria | 4009619 |
| 793 | 2900055667 | 2900051742 | Bacteria | 4985156 |
| 794 | 2904114865 | 2904113452 | Bacteria | 7796941 |
| 795 | 2904163295 | 2904162308 | Bacteria | 7086713 |
| 796 | 2904163725 | 2904162308 | Bacteria | 7086713 |
| 797 | 2904466933 | 2904463128 | Bacteria | 4775606 |
| 798 | 2904475565 | 2904474040 | Bacteria | 5504324 |
| 799 | 2904481536 | 2904479285 | Bacteria | 5073931 |
| 800 | 2904493150 | 2904490793 | Bacteria | 7046938 |
| 801 | 2904493559 | 2904490793 | Bacteria | 7046938 |
| 802 | 2904507966 | 2904504865 | Bacteria | 5152820 |
| 803 | 2904515581 | 2904513164 | Bacteria | 5476410 |
| 804 | 2904539480 | 2904535858 | Bacteria | 6308016 |
| 805 | 2904562013 | 2904560550 | Bacteria | 4029838 |
| 806 | 2904598452 | 2904595352 | Bacteria | 6124848 |
| 807 | 2904760218 | 2904755435 | Bacteria | 7986759 |
| 808 | 2907205711 | 2907202186 | Bacteria | 6632024 |
| 809 | 2907206273 | 2907202186 | Bacteria | 6632024 |
| 810 | 2908668227 | 2908665501 | Bacteria | 3678115 |
| 811 | 2908672271 | 2908669403 | Bacteria | 5740494 |
| 812 | 2919095996 | 2919093281 | Bacteria | 3660974 |
| 813 | 2919111256 | 2919108558 | Bacteria | 5897419 |
| 814 | 2919151734 | 2919150387 | Bacteria | 5500879 |
| 815 | 2919162439 | 2919160200 | Bacteria | 6929020 |
| 816 | 2919162724 | 2919160200 | Bacteria | 6929020 |
| 817 | 2919417298 | 2919414237 | Bacteria | 5429133 |
| 818 | 2919426985 | 2919425241 | Bacteria | 8055701 |
| 819 | 2919427274 | 2919425241 | Bacteria | 8055701 |
| 820 | 2919728285 | 2919726948 | Bacteria | 3696050 |
| 821 | 2922555442 | 2922554459 | Bacteria | 6683962 |
| 822 | 2923635641 | 2923634449 | Bacteria | 4753480 |
| 823 | 2925332481 | 2925326138 | Bacteria | 9652120 |
| 824 | 2927144403 | 2927143783 | Bacteria | 5504251 |
| 825 | 2927833391 | 2927833300 | Bacteria | 4923934 |
| 826 | 2928512210 | 2928510474 | Bacteria | 4815308 |
| 827 | 2928513585 | 2928510474 | Bacteria | 4815308 |
| 828 | 2928519851 | 2928519762 | Bacteria | 1953908 |
| 829 | 2929210490 | 2929206907 | Bacteria | 5918291 |
| 830 | 2931389696 | 2931384279 | Bacteria | 7299545 |
| 831 | 2931390186 | 2931384279 | Bacteria | 7299545 |
| 832 | 2932408394 | 2932406140 | Bacteria | 5134491 |
| 833 | 2935625963 | 2935625433 | Bacteria | 5042964 |
| 834 | 2936341867 | 2936340661 | Bacteria | 5139038 |
| 835 | 2937542644 | 2937539931 | Bacteria | 4639830 |
| 836 | 2937969900 | 2937967321 | Bacteria | 5094075 |
| 837 | 2938649829 | 2938649242 | Bacteria | 7118381 |
| 838 | 2938917510 | 2938917290 | Bacteria | 5914775 |
| 839 | 2939569842 | 2939568625 | Bacteria | 4542555 |
| 840 | 2939577858 | 2939573065 | Bacteria | 4926053 |
| 841 | 2939580055 | 2939577877 | Bacteria | 5132791 |
| 842 | 2939606954 | 2939602548 | Bacteria | 4950493 |
| 843 | 2939608879 | 2939607340 | Bacteria | 4719256 |
| 844 | 2939618282 | 2939617950 | Bacteria | 4820956 |
| 845 | 2939643154 | 2939642701 | Bacteria | 4475280 |
| 846 | 2939679792 | 2939679117 | Bacteria | 6921672 |
| 847 | 2939680887 | 2939679117 | Bacteria | 6921672 |
| 848 | 2939706696 | 2939702853 | Bacteria | 5139229 |
| 849 | 2939747071 | 2939743619 | Bacteria | 5762299 |
| 850 | 2945877060 | 2945874760 | Bacteria | 5527237 |
| 851 | 2945952369 | 2945951305 | Bacteria | 4918162 |
| 852 | 2945991613 | 2945991243 | Bacteria | 7008369 |
| 853 | 2945997585 | 2945991243 | Bacteria | 7008369 |
| 854 | 2946053799 | 2946053406 | Bacteria | 6978655 |
| 855 | 2946054325 | 2946053406 | Bacteria | 6978655 |
| 856 | 2954773913 | 2954773129 | Bacteria | 3741715 |
| 857 | 2956899071 | 2956897341 | Bacteria | 5447711 |
| 858 | 2956900368 | 2956897341 | Bacteria | 5447711 |
| 859 | 2962293282 | 2962290636 | Bacteria | 4072939 |
| 860 | 2964328820 | 2964326757 | Bacteria | 3290868 |
| 861 | 2964378490 | 2964375228 | Bacteria | 4909004 |
| 862 | 2965766869 | 2965761152 | Bacteria | 5806513 |
| 863 | 2968561215 | 2968558590 | Bacteria | 6956864 |
| 864 | 2969081303 | 2969079654 | Bacteria | 5439582 |
| 865 | 2969139294 | 2969136845 | Bacteria | 3923176 |
| 866 | 2969143506 | 2969141011 | Bacteria | 4118468 |
| 867 | 2969767261 | 2969765954 | Bacteria | 4216713 |
| 868 | 2969773427 | 2969770375 | Bacteria | 4271280 |
| 869 | 2971405724 | 2971403814 | Bacteria | 7370929 |
| 870 | 2971416285 | 2971410472 | Bacteria | 8311090 |
| 871 | 2971417189 | 2971410472 | Bacteria | 8311090 |
| 872 | 2971515626 | 2971511577 | Bacteria | 5404012 |
| 873 | 2971822727 | 2971820967 | Bacteria | 5823634 |
| 874 | 2971895705 | 2971893375 | Bacteria | 3929648 |
| 875 | 2974311311 | 2974310843 | Bacteria | 4947816 |
| 876 | 2974439071 | 2974435778 | Bacteria | 4876478 |
| 877 | 2978978856 | 2978975091 | Bacteria | 4704313 |
| 878 | 2980125673 | 2980125574 | Bacteria | 5567337 |
| 879 | 2980180129 | 2980176882 | Bacteria | 5397533 |
| 880 | 2980184531 | 2980182181 | Bacteria | 9454109 |
| 881 | 2980495048 | 2980492589 | Bacteria | 4072961 |
| 882 | 2981288015 | 2981284811 | Bacteria | 4641497 |
| 883 | 2981292271 | 2981289755 | Bacteria | 4641509 |
| 884 | 2981983634 | 2981980479 | Bacteria | 4641628 |
| 885 | 2981988328 | 2981985349 | Bacteria | 4641497 |
| 886 | 2984497370 | 2984494565 | Bacteria | 5000175 |
| 887 | 2984530281 | 2984527788 | Bacteria | 5288478 |
| 888 | 2984536390 | 2984532647 | Bacteria | 5288506 |
| 889 | 2984563766 | 2984559226 | Bacteria | 5683096 |
| 890 | 2984596499 | 2984595703 | Bacteria | 5682994 |
| 891 | 2988229393 | 2988225383 | Bacteria | 7221625 |
| 892 | 2990261321 | 2990261002 | Bacteria | 4919493 |
| 893 | 2996639012 | 2996632988 | Bacteria | 6921523 |
| 894 | 3000378585 | 3000376612 | Bacteria | 4705565 |
| 895 | 3001895335 | 3001892409 | Bacteria | 6328293 |
| 896 | 3006831361 | 3006826541 | Bacteria | 4678913 |
| 897 | 3006861022 | 3006858327 | Bacteria | 4317835 |
| 898 | 3006881518 | 3006879489 | Bacteria | 4064221 |
| 899 | 3006981674 | 3006978542 | Bacteria | 5328100 |
| 900 | 640937140 | 640753048 | Bacteria | 5495657 |
| 901 | 648170887 | 648028048 | Bacteria | 5394884 |
| 902 | 8002322259 | 8002317523 | Bacteria | 8051857 |
| 903 | 8004597530 | 8004592986 | Bacteria | 5122074 |
| 904 | 8007373238 | 8007371054 | Bacteria | 4849201 |
| 905 | 8015397720 | 8015394850 | Bacteria | 5064660 |
| 906 | 8016735218 | 8016733728 | Bacteria | 5274317 |
| 907 | 8018223944 | 8018221730 | Bacteria | 4616064 |
| 908 | 8018409449 | 8018405270 | Bacteria | 4978981 |
| 909 | 8019501302 | 8019499862 | Bacteria | 5169538 |
| 910 | 8019505381 | 8019504834 | Bacteria | 4819156 |
| 911 | 8022631799 | 8022630665 | Bacteria | 3886130 |
| 912 | 8022654174 | 8022653035 | Bacteria | 4035078 |
| 913 | 8022796402 | 8022792930 | Bacteria | 5693794 |
| 914 | 8022954057 | 8022948649 | Bacteria | 5366783 |
| 915 | 8023439654 | 8023438354 | Bacteria | 5779374 |
| 916 | 8023447532 | 8023444577 | Bacteria | 5661597 |
| 917 | 8046997710 | 8046991243 | Bacteria | 8497463 |
| 918 | 8051955369 | 8051952484 | Bacteria | 3926774 |
| 919 | 8052178137 | 8052174270 | Bacteria | 3881265 |
| 920 | 8054281346 | 8054280661 | Bacteria | 4232245 |
| 921 | 8054467901 | 8054465665 | Bacteria | 7323556 |
| 922 | 8054795793 | 8054795415 | Bacteria | 9785225 |
| 923 | 8054846431 | 8054844752 | Bacteria | 4450330 |
| 924 | 8054851753 | 8054849141 | Bacteria | 5232694 |
| 925 | 8055088011 | 8055087960 | Bacteria | 4784273 |
| 926 | 8055095297 | 8055092621 | Bacteria | 4873875 |
| 927 | 8055098406 | 8055097453 | Bacteria | 4865496 |
| 928 | 8055635060 | 8055632911 | Bacteria | 5283357 |
| 929 | 8055696694 | 8055693939 | Bacteria | 4772047 |
| 930 | 8056539896 | 8056533031 | Bacteria | 8964429 |
| 931 | 8056540378 | 8056533031 | Bacteria | 8964429 |
| 932 | 8057307005 | 8057304971 | Bacteria | 4649742 |
| 933 | 8057473813 | 8057473075 | Bacteria | 5892720 |
| 934 | 8057476263 | 8057473075 | Bacteria | 5892720 |
| 935 | 8057587574 | 8057582654 | Bacteria | 5218944 |
| 936 | 8057737687 | 8057733483 | Bacteria | 6578323 |
| 937 | 8057980395 | 8057977335 | Bacteria | 5694872 |
| 938 | JGI24739J22299_10000274 | |||
| 939 | JGI24744J21845_10014432 | |||
| 940 | JGI25162J39368_1000019 | |||
| 941 | JGI25162J39368_1001119 | |||
| 942 | JGI25163J39215_1000121 | |||
| 943 | JGI25164J39214_1000011 | |||
| 944 | JGI25152J39213_1000139 | |||
| 945 | JGI25151J46595_10000158 | |||
| 946 | JGI25151J46595_10003023 | |||
| 947 | JGI25151J46595_10014500 | |||
| 948 | JGI25151J46595_10015640 | |||
| 949 | JGI25151J46595_10027687 | |||
| 950 | Ga0006562J51391_1002186 | |||
| 951 | Ga0006562J51391_1006751 | |||
| 952 | Ga0006562J51391_1016265 | |||
| 953 | Ga0055538_1000021 | |||
| 954 | Ga0055538_1000316 | |||
| 955 | Ga0055539_1000026 | |||
| 956 | Ga0055533_1000035 | |||
| 957 | Ga0055532_1000233 | |||
| 958 | Ga0055525_1000045 | |||
| 959 | Ga0055535_1002935 | |||
| 960 | Ga0055531_10000234 | |||
| 961 | Ga0055541_1000020 | |||
| 962 | Ga0055541_1000831 | |||
| 963 | Ga0055541_1005311 | |||
| 964 | Ga0058692_1000099 | |||
| 965 | Ga0058692_1000261 | |||
| 966 | Ga0058692_1000354 | |||
| 967 | Ga0058692_1000393 | |||
| 968 | Ga0058692_1000468 | |||
| 969 | Ga0058692_1001738 | |||
| 970 | Ga0058692_1004623 | |||
| 971 | Ga0058692_1007067 | |||
| 972 | Ga0058692_1009103 | |||
| 973 | Ga0065703_1019809 | |||
| 974 | Ga0065704_10000261 | |||
| 975 | Ga0065704_10000708 | |||
| 976 | Ga0065704_10070603 | |||
| 977 | Ga0065704_10070657 | |||
| 978 | Ga0065704_10112895 | |||
| 979 | Ga0070658_10000763 | |||
| 980 | Ga0070658_10013013 | |||
| 981 | Ga0070690_100075534 | |||
| 982 | Ga0068868_100003167 | |||
| 983 | Ga0070660_100016489 | |||
| 984 | Ga0070671_100002544 | |||
| 985 | Ga0070708_100034203 | |||
| 986 | Ga0070708_100069342 | |||
| 987 | Ga0070706_100000084 | |||
| 988 | Ga0070706_100000277 | |||
| 989 | Ga0070706_100000858 | |||
| 990 | Ga0070706_100025427 | |||
| 991 | Ga0070706_100031538 | |||
| 992 | Ga0070707_100000029 | |||
| 993 | Ga0070707_100002389 | |||
| 994 | Ga0070707_100008844 | |||
| 995 | Ga0070707_100025604 | |||
| 996 | Ga0070698_100000166 | |||
| 997 | Ga0070698_100000793 | |||
| 998 | Ga0070698_100005108 | |||
| 999 | Ga0070698_100008670 | |||
| 1000 | Ga0070698_100014576 | |||
| 1001 | Ga0070698_100016460 | |||
| 1002 | Ga0070698_100107780 | |||
| 1003 | Ga0070698_100110789 | |||
| 1004 | Ga0070699_100000171 | |||
| 1005 | Ga0070699_100000395 | |||
| 1006 | Ga0070699_100006492 | |||
| 1007 | Ga0070699_100018451 | |||
| 1008 | Ga0070699_100072515 | |||
| 1009 | Ga0070684_100000077 | |||
| 1010 | Ga0070697_100000003 | |||
| 1011 | Ga0070697_100000806 | |||
| 1012 | Ga0070697_100000866 | |||
| 1013 | Ga0070697_100039204 | |||
| 1014 | Ga0070665_100000464 | |||
| 1015 | Ga0070665_100094141 | |||
| 1016 | Ga0068857_100000207 | |||
| 1017 | Ga0068859_100005482 | |||
| 1018 | Ga0068858_100220246 | |||
| 1019 | Ga0081455_10032838 | |||
| 1020 | Ga0081538_10022116 | |||
| 1021 | Ga0070717_10001202 | |||
| 1022 | Ga0070717_10004253 | |||
| 1023 | Ga0070717_10017018 | |||
| 1024 | Ga0075364_10003469 | |||
| 1025 | Ga0075364_10038878 | |||
| 1026 | Ga0075364_10094540 | |||
| 1027 | Ga0070716_100038075 | |||
| 1028 | Ga0075366_10002650 | |||
| 1029 | Ga0097620_100005480 | |||
| 1030 | Ga0079104_1000018 | |||
| 1031 | Ga0079104_1000163 | |||
| 1032 | Ga0079104_1000282 | |||
| 1033 | Ga0079104_1000384 | |||
| 1034 | Ga0079104_1000391 | |||
| 1035 | Ga0079104_1001061 | |||
| 1036 | Ga0079104_1001257 | |||
| 1037 | Ga0079104_1003314 | |||
| 1038 | Ga0079104_1006480 | |||
| 1039 | Ga0105251_10001421 | |||
| 1040 | Ga0105251_10001888 | |||
| 1041 | Ga0105251_10003233 | |||
| 1042 | Ga0105251_10003985 | |||
| 1043 | Ga0105251_10007214 | |||
| 1044 | Ga0105251_10014434 | |||
| 1045 | Ga0105251_10041405 | |||
| 1046 | Ga0105244_10000009 | |||
| 1047 | Ga0105244_10000347 | |||
| 1048 | Ga0105244_10000635 | |||
| 1049 | Ga0105244_10000636 | |||
| 1050 | Ga0105244_10000667 | |||
| 1051 | Ga0105244_10000818 | |||
| 1052 | Ga0105244_10000999 | |||
| 1053 | Ga0105244_10001459 | |||
| 1054 | Ga0105244_10003403 | |||
| 1055 | Ga0105244_10003888 | |||
| 1056 | Ga0105244_10007217 | |||
| 1057 | Ga0105244_10013124 | |||
| 1058 | Ga0105250_10000002 | |||
| 1059 | Ga0105250_10000101 | |||
| 1060 | Ga0105250_10000594 | |||
| 1061 | Ga0105250_10000614 | |||
| 1062 | Ga0105250_10001153 | |||
| 1063 | Ga0105250_10001182 | |||
| 1064 | Ga0105250_10004678 | |||
| 1065 | Ga0105250_10006179 | |||
| 1066 | Ga0105250_10011526 | |||
| 1067 | Ga0105240_10193625 | |||
| 1068 | Ga0105245_10010945 | |||
| 1069 | Ga0105245_10141483 | |||
| 1070 | Ga0105247_10000025 | |||
| 1071 | Ga0105243_10032193 | |||
| 1072 | Ga0105241_10000005 | |||
| 1073 | Ga0105248_10004273 | |||
| 1074 | Ga0105237_10000060 | |||
| 1075 | Ga0105238_10133244 | |||
| 1076 | Ga0105239_10027102 | |||
| 1077 | Ga0105246_10005098 | |||
| 1078 | Ga0105246_10005700 | |||
| 1079 | Ga0105246_10053878 | |||
| 1080 | Ga0157373_10000110 | |||
| 1081 | Ga0157373_10001965 | |||
| 1082 | Ga0157373_10017913 | |||
| 1083 | Ga0157373_10028353 | |||
| 1084 | Ga0157371_10000098 | |||
| 1085 | Ga0157371_10000528 | |||
| 1086 | Ga0157371_10000663 | |||
| 1087 | Ga0157371_10000673 | |||
| 1088 | Ga0157371_10000911 | |||
| 1089 | Ga0157371_10004595 | |||
| 1090 | Ga0157371_10025820 | |||
| 1091 | Ga0157370_10000683 | |||
| 1092 | Ga0157370_10001362 | |||
| 1093 | Ga0157370_10030269 | |||
| 1094 | Ga0157370_10086395 | |||
| 1095 | Ga0157369_10000589 | |||
| 1096 | Ga0157369_10000988 | |||
| 1097 | Ga0157369_10005106 | |||
| 1098 | Ga0157369_10012721 | |||
| 1099 | Ga0157369_10042245 | |||
| 1100 | Ga0157374_10008966 | |||
| 1101 | Ga0157374_10084100 | |||
| 1102 | Ga0163162_10007001 | |||
| 1103 | Ga0157372_10005333 | |||
| 1104 | Ga0157372_10012243 | |||
| 1105 | Ga0157375_10000052 | |||
| 1106 | Ga0157376_10000214 | |||
| 1107 | Ga0182006_1000018 | |||
| 1108 | Ga0183366_1001 | |||
| 1109 | Ga0183370_1001 | |||
| 1110 | Ga0183369_1001 | |||
| 1111 | Ga0183368_1001 | |||
| 1112 | Ga0163161_10000001 | |||
| 1113 | Ga0213876_10000034 | |||
| 1114 | Ga0209760_100004 | |||
| 1115 | Ga0209784_100001 | |||
| 1116 | Ga0209784_100183 | |||
| 1117 | Ga0209566_100001 | |||
| 1118 | Ga0209566_100054 | |||
| 1119 | Ga0209566_100058 | |||
| 1120 | Ga0209566_100072 | |||
| 1121 | Ga0209566_100115 | |||
| 1122 | Ga0209566_100574 | |||
| 1123 | Ga0209566_100703 | |||
| 1124 | Ga0209566_101096 | |||
| 1125 | Ga0209674_100002 | |||
| 1126 | Ga0209147_100088 | |||
| 1127 | Ga0209563_100002 | |||
| 1128 | Ga0207427_100012 | |||
| 1129 | Ga0209437_100001 | |||
| 1130 | Ga0209437_100238 | |||
| 1131 | Ga0209437_100302 | |||
| 1132 | Ga0209437_100909 | |||
| 1133 | Ga0209258_103608 | |||
| 1134 | Ga0209258_104781 | |||
| 1135 | Ga0209677_100002 | |||
| 1136 | Ga0209129_1000077 | |||
| 1137 | Ga0209233_1004169 | |||
| 1138 | Ga0209130_1000320 | |||
| 1139 | Ga0209676_1001699 | |||
| 1140 | Ga0209025_1000001 | |||
| 1141 | Ga0209025_1000368 | |||
| 1142 | Ga0209025_1003105 | |||
| 1143 | Ga0209025_1008379 | |||
| 1144 | Ga0209025_1008947 | |||
| 1145 | Ga0209025_1009924 | |||
| 1146 | Ga0209025_1013065 | |||
| 1147 | Ga0209025_1022408 | |||
| 1148 | Ga0209025_1033559 | |||
| 1149 | Ga0209051_1000025 | |||
| 1150 | Ga0209257_1000039 | |||
| 1151 | Ga0209257_1017430 | |||
| 1152 | Ga0207696_1000001 | |||
| 1153 | Ga0207696_1000013 | |||
| 1154 | Ga0207696_1000021 | |||
| 1155 | Ga0207696_1000053 | |||
| 1156 | Ga0207696_1000058 | |||
| 1157 | Ga0207696_1000620 | |||
| 1158 | Ga0207696_1000622 | |||
| 1159 | Ga0207696_1001212 | |||
| 1160 | Ga0207696_1001317 | |||
| 1161 | Ga0207696_1001388 | |||
| 1162 | Ga0207696_1003318 | |||
| 1163 | Ga0207655_1000002 | |||
| 1164 | Ga0207655_1000004 | |||
| 1165 | Ga0207655_1000007 | |||
| 1166 | Ga0207655_1000036 | |||
| 1167 | Ga0207655_1000447 | |||
| 1168 | Ga0207655_1000604 | |||
| 1169 | Ga0207655_1000642 | |||
| 1170 | Ga0207655_1000733 | |||
| 1171 | Ga0207655_1000829 | |||
| 1172 | Ga0207655_1001670 | |||
| 1173 | Ga0207655_1002030 | |||
| 1174 | Ga0207655_1005626 | |||
| 1175 | Ga0207655_1021087 | |||
| 1176 | Ga0207713_1000001 | |||
| 1177 | Ga0207713_1000012 | |||
| 1178 | Ga0207713_1000047 | |||
| 1179 | Ga0207713_1000132 | |||
| 1180 | Ga0207713_1000383 | |||
| 1181 | Ga0207713_1001567 | |||
| 1182 | Ga0207713_1002227 | |||
| 1183 | Ga0207713_1002776 | |||
| 1184 | Ga0207713_1005688 | |||
| 1185 | Ga0207713_1012704 | |||
| 1186 | Ga0207713_1049410 | |||
| 1187 | Ga0207710_10000150 | |||
| 1188 | Ga0207705_10002539 | |||
| 1189 | Ga0207705_10005126 | |||
| 1190 | Ga0207684_10000002 | |||
| 1191 | Ga0207684_10000008 | |||
| 1192 | Ga0207684_10000040 | |||
| 1193 | Ga0207684_10017137 | |||
| 1194 | Ga0207654_10000007 | |||
| 1195 | Ga0207671_10000062 | |||
| 1196 | Ga0207657_10041612 | |||
| 1197 | Ga0207646_10000142 | |||
| 1198 | Ga0207646_10000333 | |||
| 1199 | Ga0207646_10000613 | |||
| 1200 | Ga0207646_10002050 | |||
| 1201 | Ga0207646_10003431 | |||
| 1202 | Ga0207646_10003981 | |||
| 1203 | Ga0207646_10009446 | |||
| 1204 | Ga0207646_10011676 | |||
| 1205 | Ga0207646_10012410 | |||
| 1206 | Ga0207687_10005575 | |||
| 1207 | Ga0207664_10161207 | |||
| 1208 | Ga0207709_10016891 | |||
| 1209 | Ga0207711_10021152 | |||
| 1210 | Ga0207661_10000015 | |||
| 1211 | Ga0207668_10018611 | |||
| 1212 | Ga0207677_10000048 | |||
| 1213 | Ga0207674_10002163 | |||
| 1214 | Ga0207674_10071284 | |||
| 1215 | Ga0209281_1000004 | |||
| 1216 | Ga0209281_1000006 | |||
| 1217 | Ga0209281_1000014 | |||
| 1218 | Ga0209281_1000064 | |||
| 1219 | Ga0209281_1000071 | |||
| 1220 | Ga0209281_1000257 | |||
| 1221 | Ga0209281_1000370 | |||
| 1222 | Ga0209281_1000714 | |||
| 1223 | Ga0209281_1000926 | |||
| 1224 | Ga0209281_1001332 | |||
| 1225 | Ga0209281_1001392 | |||
| 1226 | Ga0209371_1000001 | |||
| 1227 | Ga0209371_1000002 | |||
| 1228 | Ga0209371_1000005 | |||
| 1229 | Ga0209371_1000015 | |||
| 1230 | Ga0209371_1000099 | |||
| 1231 | Ga0209371_1000100 | |||
| 1232 | Ga0209371_1000120 | |||
| 1233 | Ga0209371_1000466 | |||
| 1234 | Ga0209371_1000778 | |||
| 1235 | Ga0209371_1000832 | |||
| 1236 | Ga0209371_1000964 | |||
| 1237 | Ga0209371_1001051 | |||
| 1238 | Ga0209371_1006561 | |||
| 1239 | Ga0209371_1006984 | |||
| 1240 | Ga0209371_1008478 | |||
| 1241 | Ga0209371_1017486 | |||
| 1242 | Ga0268266_10000286 | |||
| 1243 | Ga0268266_10032002 | |||
| 1244 | Ga0237817_10010 | |||
| 1245 | Ga0268256_1000001 | |||
| 1246 | Ga0268256_1000002 | |||
| 1247 | Ga0268256_1000006 | |||
| 1248 | Ga0268256_1000018 | |||
| 1249 | Ga0268256_1000035 | |||
| 1250 | Ga0268256_1000089 | |||
| 1251 | Ga0268256_1000423 | |||
| 1252 | Ga0268256_1000714 | |||
| 1253 | Ga0268256_1000815 | |||
| 1254 | Ga0268256_1001088 | |||
| 1255 | Ga0268256_1001187 | |||
| 1256 | Ga0268256_1001261 | |||
| 1257 | Ga0268256_1001364 | |||
| 1258 | Ga0268256_1004173 | |||
| 1259 | Ga0268256_1007114 | |||
| 1260 | Ga0268256_1010729 | |||
| 1261 | Ga0268256_1019486 | |||
| 1262 | Ga0265330_10006907 | |||
| 1263 | Ga0265330_10059295 | |||
| 1264 | Ga0265325_10008619 | |||
| 1265 | Ga0265339_10002811 | |||
| 1266 | Ga0265331_10052169 | |||
| 1267 | Ga0265316_10014201 | |||
| 1268 | Ga0307408_100121385 | |||
| 1269 | Ga0265314_10030356 | |||
| 1270 | Ga0265314_10057905 | |||
| 1271 | Ga0265342_10004166 | |||
| 1272 | Ga0316578_10026048 | |||
| 1273 | Ga0316578_10033102 | |||
| 1274 | Ga0307413_10033108 | |||
| 1275 | Ga0307410_10006702 | |||
| 1276 | Ga0307406_10024886 | |||
| 1277 | Ga0307510_10087683 | |||
| 1278 | Ga0316574_0076742 | |||
| 1279 | Ga0316582_0011868 | |||
| 1280 | Ga0316582_0067878 | |||
| 1281 | Ga0316584_0043456 | |||
| 1282 | Ga0373925_0087083 | |||
| 1283 | Ga0395900_0223228 | |||
| 1284 | Ga0237819_02091 | |||
| 1285 | Ga0400488_52971 | |||
| 1286 | Ga0400489_11819 | |||
| 1287 | Ga0436365_0965775 | |||
| 1288 | Ga0439436_0015324 | |||
| 1289 | Ga0439438_000002 | |||
| 1290 | Ga0439439_0002184 | |||
| 1291 | Ga0439466_0000001 | |||
| 1292 | Ga0439466_0000450 | |||
| 1293 | Ga0451853_3168715 | |||
| 1294 | Ga0439432_000295 | |||
| 1295 | Ga0439449_0000010 | |||
| 1296 | Ga0439452_000001 | |||
| 1297 | Ga0439452_000002 | |||
| 1298 | Ga0439452_000020 | |||
| 1299 | Ga0439452_000031 | |||
| 1300 | Ga0439452_000032 | |||
| 1301 | Ga0439462_0024401 | |||
| 1302 | Ga0451577_0007660 | |||
| 1303 | Ga0466969_0000115 | |||
| 1304 | Ga0466981_0000003 | |||
| 1305 | Ga0453684_0002622 | |||
| 1306 | Ga0451576_0042243 | |||
| 1307 | Ga0466967_0006590 | |||
| 1308 | Ga0495627_000018 | |||
| 1309 | Ga0495591_000001 | |||
| 1310 | Ga0495591_000050 | |||
| 1311 | Ga0495591_001001 | |||
| 1312 | Ga0495638_0039389 | |||
| 1313 | Ga0495650_0000031 | |||
| 1314 | Ga0495650_0000047 | |||
| 1315 | Ga0495650_0000182 | |||
| 1316 | Ga0495607_0071972 | |||
| 1317 | Ga0495606_0003900 | |||
| 1318 | Ga0495606_0015548 | |||
| 1319 | Ga0495648_0001866 | |||
| 1320 | Ga0495654_0000009 | |||
| 1321 | Ga0495654_0000068 | |||
| 1322 | Ga0495654_0000596 | |||
| 1323 | Ga0495654_0016346 | |||
| 1324 | Ga0495597_0002098 | |||
| 1325 | Ga0495622_0007079 | |||
| 1326 | Ga0495633_0000002 | |||
| 1327 | Ga0495656_0061371 | |||
| 1328 | Ga0495649_0000504 | |||
| 1329 | Ga0495649_0000543 | |||
| 1330 | Ga0495589_0000002 | |||
| 1331 | Ga0495660_0000004 | |||
| 1332 | Ga0495660_0000015 | |||
| 1333 | Ga0495660_0001493 | |||
| 1334 | Ga0495672_0000001 | |||
| 1335 | Ga0495672_0000009 | |||
| 1336 | Ga0495672_0000015 | |||
| 1337 | Ga0495683_0006239 | |||
| 1338 | Ga0495679_000309 | |||
| 1339 | Ga0495679_015728 | |||
| 1340 | Ga0495673_0000007 | |||
| 1341 | Ga0495673_0000019 | |||
| 1342 | Ga0495681_0034070 | |||
| 1343 | Ga0496101_0000157 | |||
| 1344 | Ga0496102_0057081 | |||
| 1345 | Ga0496102_0074750 | |||
| 1346 | Ga0496103_0018887 | |||
| 1347 | Ga0496104_0000100 | |||
| 1348 | Ga0496108_0101917 | |||
| 1349 | Ga0496108_0116454 | |||
| 1350 | Ga0496110_0000084 | |||
| 1351 | Ga0496111_0001174 | |||
| 1352 | Ga0496116_0000023 | |||
| 1353 | Ga0496116_0000094 | |||
| 1354 | Ga0496116_0000110 | |||
| 1355 | Ga0496116_0000140 | |||
| 1356 | Ga0496116_0000625 | |||
| 1357 | Ga0496116_0001704 | |||
| 1358 | Ga0496116_0001737 | |||
| 1359 | Ga0496116_0002154 | |||
| 1360 | Ga0496116_0003742 | |||
| 1361 | Ga0496116_0003924 | |||
| 1362 | Ga0496116_0004165 | |||
| 1363 | Ga0496116_0005211 | |||
| 1364 | Ga0496116_0008976 | |||
| 1365 | Ga0496116_0029920 | |||
| 1366 | Ga0496116_0033684 | |||
| 1367 | Ga0496116_0052606 | |||
| 1368 | Ga0496117_0000009 | |||
| 1369 | Ga0496117_0000138 | |||
| 1370 | Ga0496117_0000154 | |||
| 1371 | Ga0496117_0000380 | |||
| 1372 | Ga0496117_0000835 | |||
| 1373 | Ga0496117_0002117 | |||
| 1374 | Ga0496117_0002120 | |||
| 1375 | Ga0496117_0002436 | |||
| 1376 | Ga0496117_0003978 | |||
| 1377 | Ga0496117_0004061 | |||
| 1378 | Ga0496117_0008017 | |||
| 1379 | Ga0496117_0018285 | |||
| 1380 | Ga0496117_0019093 | |||
| 1381 | Ga0496117_0019839 | |||
| 1382 | Ga0496117_0024460 | |||
| 1383 | Ga0496117_0066848 | |||
| 1384 | Ga0496118_0000017 | |||
| 1385 | Ga0496118_0000150 | |||
| 1386 | Ga0496118_0000158 | |||
| 1387 | Ga0496118_0000894 | |||
| 1388 | Ga0496118_0001286 | |||
| 1389 | Ga0496118_0001914 | |||
| 1390 | Ga0496118_0003457 | |||
| 1391 | Ga0496118_0005328 | |||
| 1392 | Ga0496118_0038280 | |||
| 1393 | Ga0496118_0062714 | |||
| 1394 | Ga0496119_0000012 | |||
| 1395 | Ga0496119_0000027 | |||
| 1396 | Ga0496119_0000049 | |||
| 1397 | Ga0496119_0000166 | |||
| 1398 | Ga0496119_0000352 | |||
| 1399 | Ga0496119_0000468 | |||
| 1400 | Ga0496119_0001574 | |||
| 1401 | Ga0496119_0001730 | |||
| 1402 | Ga0496119_0002241 | |||
| 1403 | Ga0496119_0002860 | |||
| 1404 | Ga0496119_0004253 | |||
| 1405 | Ga0496119_0007695 | |||
| 1406 | Ga0496119_0057325 | |||
| 1407 | Ga0496120_0000004 | |||
| 1408 | Ga0496120_0000022 | |||
| 1409 | Ga0496120_0000048 | |||
| 1410 | Ga0496120_0000052 | |||
| 1411 | Ga0496120_0000057 | |||
| 1412 | Ga0496120_0000137 | |||
| 1413 | Ga0496120_0000207 | |||
| 1414 | Ga0496120_0000406 | |||
| 1415 | Ga0496120_0000673 | |||
| 1416 | Ga0496120_0000711 | |||
| 1417 | Ga0496120_0001027 | |||
| 1418 | Ga0496120_0001489 | |||
| 1419 | Ga0496120_0002104 | |||
| 1420 | Ga0496120_0002703 | |||
| 1421 | Ga0496120_0002884 | |||
| 1422 | Ga0496121_0000389 | |||
| 1423 | Ga0496121_0001226 | |||
| 1424 | Ga0496121_0001655 | |||
| 1425 | Ga0496121_0002208 | |||
| 1426 | Ga0496121_0003017 | |||
| 1427 | Ga0496121_0003296 | |||
| 1428 | Ga0496121_0004821 | |||
| 1429 | Ga0496121_0005634 | |||
| 1430 | Ga0496121_0008356 | |||
| 1431 | Ga0496121_0011405 | |||
| 1432 | Ga0496121_0058635 | |||
| 1433 | Ga0496122_0000003 | |||
| 1434 | Ga0496122_0000007 | |||
| 1435 | Ga0496122_0000088 | |||
| 1436 | Ga0496122_0001843 | |||
| 1437 | Ga0496122_0002182 | |||
| 1438 | Ga0496122_0002922 | |||
| 1439 | Ga0496122_0003024 | |||
| 1440 | Ga0496122_0003212 | |||
| 1441 | Ga0496122_0003434 | |||
| 1442 | Ga0496122_0003484 | |||
| 1443 | Ga0496122_0004956 | |||
| 1444 | Ga0496122_0005161 | |||
| 1445 | Ga0496122_0023005 | |||
| 1446 | Ga0496122_0074389 | |||
| 1447 | Ga0496122_0082854 | |||
| 1448 | Ga0496123_0000004 | |||
| 1449 | Ga0496123_0000012 | |||
| 1450 | Ga0496123_0000139 | |||
| 1451 | Ga0496123_0001504 | |||
| 1452 | Ga0496123_0001770 | |||
| 1453 | Ga0496123_0002717 | |||
| 1454 | Ga0496123_0003304 | |||
| 1455 | Ga0496123_0003928 | |||
| 1456 | Ga0496123_0006718 | |||
| 1457 | Ga0496123_0014520 | |||
| 1458 | Ga0496123_0069160 | |||
| 1459 | Ga0496124_0000017 | |||
| 1460 | Ga0496124_0000025 | |||
| 1461 | Ga0496124_0000045 | |||
| 1462 | Ga0496124_0000368 | |||
| 1463 | Ga0496124_0000484 | |||
| 1464 | Ga0496124_0000620 | |||
| 1465 | Ga0496124_0001484 | |||
| 1466 | Ga0496124_0001931 | |||
| 1467 | Ga0496124_0004039 | |||
| 1468 | Ga0496124_0004060 | |||
| 1469 | Ga0496124_0005302 | |||
| 1470 | Ga0496124_0006843 | |||
| 1471 | Ga0496124_0008449 | |||
| 1472 | Ga0496124_0009313 | |||
| 1473 | Ga0496124_0034182 | |||
| 1474 | Ga0496124_0079461 | |||
| 1475 | Ga0496125_0000013 | |||
| 1476 | Ga0496125_0000065 | |||
| 1477 | Ga0496125_0000728 | |||
| 1478 | Ga0496125_0001229 | |||
| 1479 | Ga0496125_0001911 | |||
| 1480 | Ga0496125_0001991 | |||
| 1481 | Ga0496125_0004865 | |||
| 1482 | Ga0496125_0007236 | |||
| 1483 | Ga0496125_0022076 | |||
| 1484 | Ga0496125_0070815 | |||
| 1485 | Ga0496125_0113723 | |||
| 1486 | Ga0496126_0000865 | |||
| 1487 | Ga0496126_0001727 | |||
| 1488 | Ga0496126_0002119 | |||
| 1489 | Ga0496126_0002405 | |||
| 1490 | Ga0496126_0004050 | |||
| 1491 | Ga0496126_0005402 | |||
| 1492 | Ga0496126_0013484 | |||
| 1493 | Ga0496126_0013750 | |||
| 1494 | Ga0496126_0042116 | |||
| 1495 | Ga0496126_0096786 | |||
| 1496 | Ga0496126_0100424 | |||
| 1497 | Ga0501306_000570 | |||
| 1498 | Ga0501309_000677 | |||
| 1499 | Ga0501305_003117 | |||
| 1500 | Ga0495678_000777 | |||
| 1501 | Ga0495682_0000001 | |||
| 1502 | Ga0501312_002553 | |||
| 1503 | Ga0501312_006488 | |||
| 1504 | Ga0501316_002315 | |||
| 1505 | Ga0501335_002418 | |||
| 1506 | Ga0501031_0037347 | |||
| 1507 | Ga0501033_0010131 | |||
| 1508 | Ga0501034_0002371 | |||
| 1509 | Ga0501034_0065414 | |||
| 1510 | Ga0501034_0191312 | |||
| 1511 | Ga0501036_0006154 | |||
| 1512 | Ga0501036_0018299 | |||
| 1513 | Ga0501038_0009093 | |||
| 1514 | Ga0501040_0003798 | |||
| 1515 | Ga0501042_0004170 | |||
| 1516 | Ga0501042_0012426 | |||
| 1517 | Ga0501043_0001906 | |||
| 1518 | Ga0501047_0004030 | |||
| 1519 | Ga0501048_0021270 | |||
| 1520 | Ga0501048_0099152 | |||
| 1521 | Ga0501071_0015764 | |||
| 1522 | Ga0501072_0029589 | |||
| 1523 | Ga0501074_0000975 | |||
| 1524 | Ga0501074_0002363 | |||
| 1525 | Ga0501075_0135783 | |||
| 1526 | Ga0501077_0084641 | |||
| 1527 | Ga0501208_007007 | |||
| 1528 | Ga0501217_002322 | |||
| 1529 | Ga0501081_0076057 | |||
| 1530 | Ga0501083_0036383 | |||
| 1531 | nmdc:mga00v17_27254_c1 | |||
| 1532 | nmdc:mga0yw44_46769_c1 | |||
| 1533 | Ga0500621_000002 | |||
| 1534 | Ga0501084_0041452 | |||
| 1535 | Ga0587070_000683 | |||
| 1536 | Ga0587079_004153 | |||
| 1537 | Ga0501082_0015040 | |||
| 1538 | 2728532475 | |||
| 1539 | 2506577637 | |||
| 1540 | 2506582775 | |||
| 1541 | 2508851572 | |||
| 1542 | 2511379904 | |||
| 1543 | 2511434759 | |||
| 1544 | 2511700177 | |||
| 1545 | 2512734762 | |||
| 1546 | 2524006727 | |||
| 1547 | 2524186486 | |||
| 1548 | 2524190970 | |||
| 1549 | 2538427431 | |||
| 1550 | 2540607322 | |||
| 1551 | 2545556859 | |||
| 1552 | 2547697174 | |||
| 1553 | 2548649647 | |||
| 1554 | 2550900507 | |||
| 1555 | 2555261286 | |||
| 1556 | 2555467569 | |||
| 1557 | 2562463330 | |||
| 1558 | 2563927045 | |||
| 1559 | 2563929288 | |||
| 1560 | 2566993980 | |||
| 1561 | 2571533549 | |||
| 1562 | 2573038021 | |||
| 1563 | 2578931110 | |||
| 1564 | 2580930488 | |||
| 1565 | 2585829855 | |||
| 1566 | 2585835015 | |||
| 1567 | 2587737934 | |||
| 1568 | 2587743737 | |||
| 1569 | 2590611802 | |||
| 1570 | 2595088022 | |||
| 1571 | 2595316615 | |||
| 1572 | 2599411442 | |||
| 1573 | 2599926354 | |||
| 1574 | 2601524439 | |||
| 1575 | 2601529593 | |||
| 1576 | 2601534814 | |||
| 1577 | 2601539557 | |||
| 1578 | 2601616427 | |||
| 1579 | 2601621149 | |||
| 1580 | 2601638668 | |||
| 1581 | 2601641862 | |||
| 1582 | 2601649546 | |||
| 1583 | 2601654473 | |||
| 1584 | 2601659895 | |||
| 1585 | 2601665920 | |||
| 1586 | 2601698777 | |||
| 1587 | 2601701605 | |||
| 1588 | 2601707217 | |||
| 1589 | 2601711831 | |||
| 1590 | 2601717734 | |||
| 1591 | 2601719669 | |||
| 1592 | 2601727662 | |||
| 1593 | 2601732273 | |||
| 1594 | 2601739496 | |||
| 1595 | 2601741492 | |||
| 1596 | 2601752254 | |||
| 1597 | 2601757907 | |||
| 1598 | 2601764265 | |||
| 1599 | 2602019095 | |||
| 1600 | 2603637081 | |||
| 1601 | 2603645036 | |||
| 1602 | 2603661361 | |||
| 1603 | 2603664315 | |||
| 1604 | 2603699160 | |||
| 1605 | 2603705175 | |||
| 1606 | 2603840088 | |||
| 1607 | 2603845165 | |||
| 1608 | 2603849830 | |||
| 1609 | 2603855306 | |||
| 1610 | 2603868774 | |||
| 1611 | 2603872887 | |||
| 1612 | 2603876658 | |||
| 1613 | 2606049656 | |||
| 1614 | 2606068745 | |||
| 1615 | 2606147750 | |||
| 1616 | 2606177545 | |||
| 1617 | 2608669894 | |||
| 1618 | 2609909853 | |||
| 1619 | 2621274931 | |||
| 1620 | 2631984442 | |||
| 1621 | 2637224263 | |||
| 1622 | 2643735519 | |||
| 1623 | 2643738110 | |||
| 1624 | 2644422972 | |||
| 1625 | 2644740738 | |||
| 1626 | 2650897101 | |||
| 1627 | 2651531945 | |||
| 1628 | 2656278681 | |||
| 1629 | 2671101324 | |||
| 1630 | 2671108739 | |||
| 1631 | 2671585545 | |||
| 1632 | 2672336854 | |||
| 1633 | 2673820885 | |||
| 1634 | 2674419014 | |||
| 1635 | 2676405668 | |||
| 1636 | 2681996411 | |||
| 1637 | 2682006240 | |||
| 1638 | 2686354009 | |||
| 1639 | 2686997393 | |||
| 1640 | 2687498703 | |||
| 1641 | 2689444127 | |||
| 1642 | 2695628154 | |||
| 1643 | 2712469423 | |||
| 1644 | 2717916138 | |||
| 1645 | 2723604845 | |||
| 1646 | 2730135482 | |||
| 1647 | 2738890151 | |||
| 1648 | 2739239501 | |||
| 1649 | 2739267941 | |||
| 1650 | 2753809715 | |||
| 1651 | 2753856726 | |||
| 1652 | 2757566000 | |||
| 1653 | 2765589820 | |||
| 1654 | 2772438155 | |||
| 1655 | 2775539755 | |||
| 1656 | 2777020765 | |||
| 1657 | 2777762229 | |||
| 1658 | 2791922023 | |||
| 1659 | 2792310359 | |||
| 1660 | 2793184584 | |||
| 1661 | 2793404935 | |||
| 1662 | 2802437100 | |||
| 1663 | 2807176500 | |||
| 1664 | 2808901384 | |||
| 1665 | 2809055998 | |||
| 1666 | 2809125562 | |||
| 1667 | 2812316586 | |||
| 1668 | 2813728091 | |||
| 1669 | 2814695643 | |||
| 1670 | 2816862686 | |||
| 1671 | 2817480676 | |||
| 1672 | 2819565263 | |||
| 1673 | 2819569166 | |||
| 1674 | 2819670353 | |||
| 1675 | 2819673610 | |||
| 1676 | 2819723650 | |||
| 1677 | 2821112011 | |||
| 1678 | 2821114592 | |||
| 1679 | 2821120840 | |||
| 1680 | 2823375474 | |||
| 1681 | 2823528569 | |||
| 1682 | 2831908025 | |||
| 1683 | 2842684391 | |||
| 1684 | 2842891766 | |||
| 1685 | 2844528987 | |||
| 1686 | 2846542110 | |||
| 1687 | 2847086786 | |||
| 1688 | 2847799135 | |||
| 1689 | 2849144358 | |||
| 1690 | 2852107593 | |||
| 1691 | 2855199390 | |||
| 1692 | 2857454566 | |||
| 1693 | 2857457147 | |||
| 1694 | 2857473139 | |||
| 1695 | 2857582421 | |||
| 1696 | 2857587168 | |||
| 1697 | 2857608584 | |||
| 1698 | 2857610251 | |||
| 1699 | 2857610874 | |||
| 1700 | 2858439760 | |||
| 1701 | 2858470187 | |||
| 1702 | 2860840009 | |||
| 1703 | 2864737936 | |||
| 1704 | 2864739032 | |||
| 1705 | 2865000148 | |||
| 1706 | 2865004176 | |||
| 1707 | 2865017437 | |||
| 1708 | 2869553486 | |||
| 1709 | 2871275380 | |||
| 1710 | 2871286594 | |||
| 1711 | 2876602919 | |||
| 1712 | 2877771058 | |||
| 1713 | 2880171923 | |||
| 1714 | 2881610213 | |||
| 1715 | 2881641109 | |||
| 1716 | 2884088137 | |||
| 1717 | 2885527642 | |||
| 1718 | 2888368174 | |||
| 1719 | 2888374215 | |||
| 1720 | 2888582713 | |||
| 1721 | 2888583106 | |||
| 1722 | 2889046247 | |||
| 1723 | 2889046738 | |||
| 1724 | 2889055081 | |||
| 1725 | 2889280756 | |||
| 1726 | 2889296271 | |||
| 1727 | 2889301920 | |||
| 1728 | 2891672151 | |||
| 1729 | 2897112133 | |||
| 1730 | 2900055667 | |||
| 1731 | 2904114865 | |||
| 1732 | 2904163295 | |||
| 1733 | 2904163725 | |||
| 1734 | 2904466933 | |||
| 1735 | 2904475565 | |||
| 1736 | 2904481536 | |||
| 1737 | 2904493150 | |||
| 1738 | 2904493559 | |||
| 1739 | 2904507966 | |||
| 1740 | 2904515581 | |||
| 1741 | 2904539480 | |||
| 1742 | 2904562013 | |||
| 1743 | 2904598452 | |||
| 1744 | 2904760218 | |||
| 1745 | 2907205711 | |||
| 1746 | 2907206273 | |||
| 1747 | 2908668227 | |||
| 1748 | 2908672271 | |||
| 1749 | 2919095996 | |||
| 1750 | 2919111256 | |||
| 1751 | 2919151734 | |||
| 1752 | 2919162439 | |||
| 1753 | 2919162724 | |||
| 1754 | 2919417298 | |||
| 1755 | 2919426985 | |||
| 1756 | 2919427274 | |||
| 1757 | 2919728285 | |||
| 1758 | 2922555442 | |||
| 1759 | 2923635641 | |||
| 1760 | 2925332481 | |||
| 1761 | 2927144403 | |||
| 1762 | 2927833391 | |||
| 1763 | 2928512210 | |||
| 1764 | 2928513585 | |||
| 1765 | 2928519851 | |||
| 1766 | 2929210490 | |||
| 1767 | 2931389696 | |||
| 1768 | 2931390186 | |||
| 1769 | 2932408394 | |||
| 1770 | 2935625963 | |||
| 1771 | 2936341867 | |||
| 1772 | 2937542644 | |||
| 1773 | 2937969900 | |||
| 1774 | 2938649829 | |||
| 1775 | 2938917510 | |||
| 1776 | 2939569842 | |||
| 1777 | 2939577858 | |||
| 1778 | 2939580055 | |||
| 1779 | 2939606954 | |||
| 1780 | 2939608879 | |||
| 1781 | 2939618282 | |||
| 1782 | 2939643154 | |||
| 1783 | 2939679792 | |||
| 1784 | 2939680887 | |||
| 1785 | 2939706696 | |||
| 1786 | 2939747071 | |||
| 1787 | 2945877060 | |||
| 1788 | 2945952369 | |||
| 1789 | 2945991613 | |||
| 1790 | 2945997585 | |||
| 1791 | 2946053799 | |||
| 1792 | 2946054325 | |||
| 1793 | 2954773913 | |||
| 1794 | 2956899071 | |||
| 1795 | 2956900368 | |||
| 1796 | 2962293282 | |||
| 1797 | 2964328820 | |||
| 1798 | 2964378490 | |||
| 1799 | 2965766869 | |||
| 1800 | 2968561215 | |||
| 1801 | 2969081303 | |||
| 1802 | 2969139294 | |||
| 1803 | 2969143506 | |||
| 1804 | 2969767261 | |||
| 1805 | 2969773427 | |||
| 1806 | 2971405724 | |||
| 1807 | 2971416285 | |||
| 1808 | 2971417189 | |||
| 1809 | 2971515626 | |||
| 1810 | 2971822727 | |||
| 1811 | 2971895705 | |||
| 1812 | 2974311311 | |||
| 1813 | 2974439071 | |||
| 1814 | 2978978856 | |||
| 1815 | 2980125673 | |||
| 1816 | 2980180129 | |||
| 1817 | 2980184531 | |||
| 1818 | 2980495048 | |||
| 1819 | 2981288015 | |||
| 1820 | 2981292271 | |||
| 1821 | 2981983634 | |||
| 1822 | 2981988328 | |||
| 1823 | 2984497370 | |||
| 1824 | 2984530281 | |||
| 1825 | 2984536390 | |||
| 1826 | 2984563766 | |||
| 1827 | 2984596499 | |||
| 1828 | 2988229393 | |||
| 1829 | 2990261321 | |||
| 1830 | 2996639012 | |||
| 1831 | 3000378585 | |||
| 1832 | 3001895335 | |||
| 1833 | 3006831361 | |||
| 1834 | 3006861022 | |||
| 1835 | 3006881518 | |||
| 1836 | 3006981674 | |||
| 1837 | 640937140 | |||
| 1838 | 648170887 | |||
| 1839 | 8002322259 | |||
| 1840 | 8004597530 | |||
| 1841 | 8007373238 | |||
| 1842 | 8015397720 | |||
| 1843 | 8016735218 | |||
| 1844 | 8018223944 | |||
| 1845 | 8018409449 | |||
| 1846 | 8019501302 | |||
| 1847 | 8019505381 | |||
| 1848 | 8022631799 | |||
| 1849 | 8022654174 | |||
| 1850 | 8022796402 | |||
| 1851 | 8022954057 | |||
| 1852 | 8023439654 | |||
| 1853 | 8023447532 | |||
| 1854 | 8046997710 | |||
| 1855 | 8051955369 | |||
| 1856 | 8052178137 | |||
| 1857 | 8054281346 | |||
| 1858 | 8054467901 | |||
| 1859 | 8054795793 | |||
| 1860 | 8054846431 | |||
| 1861 | 8054851753 | |||
| 1862 | 8055088011 | |||
| 1863 | 8055095297 | |||
| 1864 | 8055098406 | |||
| 1865 | 8055635060 | |||
| 1866 | 8055696694 | |||
| 1867 | 8056539896 | |||
| 1868 | 8056540378 | |||
| 1869 | 8057307005 | |||
| 1870 | 8057473813 | |||
| 1871 | 8057476263 | |||
| 1872 | 8057587574 | |||
| 1873 | 8057737687 | |||
| 1874 | 8057980395 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fwn-assembly1.cif.gz_B | dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate | 0.9919 | 2 | 469 |
| 2zya-assembly1.cif.gz_B | dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate | 0.9918 | 2 | 468 |
| 3fwn-assembly1.cif.gz_B | dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate | 0.9898 | 2 | 469 |
| 2zya-assembly1.cif.gz_B | dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate | 0.9897 | 2 | 468 |
| 7cb2-assembly1.cif.gz_A | the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus | 0.9846 | 3 | 468 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2w8zA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.994 | 2 | 180 | 3.40.50.720 |
| af_Q4D0X5_1_185_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.99 | 5 | 183 | 3.40.50.720 |
| af_P41572_182_434_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9895 | 182 | 434 | 1.10.1040.10 |
| 1pgpA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.989 | 182 | 434 | 1.10.1040.10 |
| 2w8zA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9885 | 2 | 180 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q79DY2-F1-model_v4 | Gnd(745) gene encoding 6-phosphogluconate dehydrogenase, 5' end | 1.004 | 1 | 124 |
GO:0004616
GO:0050661 |
| AF-Q93CH7-F1-model_v4 | 6-phosphogluconate dehydrogenase | 1.004 | 1 | 84 |
GO:0004616
GO:0050661 |
| AF-A0A484ZTS4-F1-model_v4 | 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) | 1.001 | 2 | 132 |
GO:0004616
GO:0016020 GO:0050661 |
| AF-E1J879-F1-model_v4 | deleted | 0.9986 | 1 | 154 |
|
| AF-A0A447V0C9-F1-model_v4 | 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) | 0.9971 | 1 | 469 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |