F486237

General Info

Members Datasets Scaffolds Average Seq Length
937 533 1874 467

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368933|2728532475
Length 557
Sequence KLHWTEPGHPAYGVPCSLPPDWKRVFTSACKNVKILIVSNFRDMQDFVNEVDLFSSGRTLLSLTKDGILILREMDFTQIQVQRVENQMAKQQIGVIGLAVMGKNLALNIESRGFTVSVYNRSPEKTHDLISEAEGKNLTGTFSIEEFVESLEVPRKILIMVQAGKATDATIEQLLPHLDQGDIIIDGGNAYFPDTVRRNKELEAKGFRFIGTGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVNGEPCCTYIGPDGAGHYVKMVHNGIEYGDMQLIGEAYHLLKDVLGLDAKELHSIFADWNSGELDSYLIEITKDIFAEYDEETGKPMVDVILDAAGQKGTGKWTSQSSLDLGVPLSMITESVFSRFLSAMKEERVAASKVLSGPVTEPFRGDKAEFIENVRKALFASKIVSYAQGFAQLRVASEEYNWDLKYGNLAKIWRGGCIIRSRFLQNITDAYENNPELKNLLLDPFFKNIMDTYQAAWRQVVSAAVAQGVPVPGFSSALAYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHNWLSE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
68 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
69 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
70 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
132 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
133 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
223 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
224 2506520008 Serratia plymuthica AS12 Isolate Unclassified
225 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
226 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
227 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
228 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
229 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
230 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
231 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
232 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
233 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
234 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
235 2547132181 Kosakonia sacchari SP1 Isolate Stem
236 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
237 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
238 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
239 2554235283 Bacillus safensis VK Isolate Rhizosphere
240 2561511199 Enterobacter sp. R4-368 Isolate Nodule
241 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
242 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
243 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
244 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
245 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
246 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
247 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
248 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
249 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
250 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
251 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
252 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
253 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
254 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
255 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
256 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
257 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
258 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
259 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
260 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
261 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
262 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
263 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
264 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
265 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
266 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
267 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
268 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
269 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
270 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
271 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
272 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
273 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
274 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
275 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
276 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
277 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
278 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
279 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
280 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
281 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
282 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
283 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
284 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
285 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
286 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
287 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
288 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
289 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
290 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
291 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
292 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
293 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
294 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
295 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
296 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
297 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
298 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
299 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
300 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
301 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
302 2636415599 Klebsiella variicola DX120E Isolate Unclassified
303 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
304 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
305 2643221735 Bacillus sp. Root920 Isolate Unclassified
306 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
307 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
308 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
309 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
310 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
311 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
312 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
313 2671180694 Paenibacillus sp. A3 Isolate Unclassified
314 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
315 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
316 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
317 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
318 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
319 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
320 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
321 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
322 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
323 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
324 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
325 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
326 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
327 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
328 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
329 2738543017 Bacillus sp. OV186 Isolate Unclassified
330 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
331 2751185917 Enterobacter sp. HK169 Isolate Unclassified
332 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
333 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
334 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
335 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
336 2775507074 Klebsiella sp. D5A Isolate Unclassified
337 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
338 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
339 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
340 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
341 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
342 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
343 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
344 2808606372 Agromyces sp. 23-23 Isolate Unclassified
345 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
346 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
347 2811994870 Bacillus sp. JB4 Isolate Unclassified
348 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
349 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
350 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
351 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
352 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
353 2818991441 Niallia circulans 3243 Isolate Rhizosphere
354 2818991459 Paenibacillus sp. 597 Isolate Unclassified
355 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
356 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
357 2821118458 Enterobacter asburiae 609 Isolate Unclassified
358 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
359 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
360 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
361 2842682962 Bacillus sp. R-72492 Isolate Unclassified
362 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
363 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
364 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
365 2847085930 Erwinia persicina B64 Isolate Bulb
366 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
367 2849139964 Bacillus sp. R-71875 Isolate Unclassified
368 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
369 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
370 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
371 2857472729 Cohnella sp. R-74144 Isolate Unclassified
372 2857581216 Bacillus sp. R-71922 Isolate Unclassified
373 2857586860 Bacillus sp. R-71935 Isolate Unclassified
374 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
375 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
376 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
377 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
378 2860837431 Bacillus sp. WR11 Isolate Unclassified
379 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
380 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
381 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
382 2865014394 Pantoea sp. R-71966 Isolate Unclassified
383 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
384 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
385 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
386 2876601092 Pantoea endophytica 596 Isolate Unclassified
387 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
388 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
389 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
390 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
391 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
392 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
393 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
394 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
395 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
396 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
397 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
398 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
399 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
400 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
401 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
402 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
403 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
404 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
405 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
406 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
407 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
408 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
409 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
410 2904504865 Serratia marcescens 1822 Isolate Unclassified
411 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
412 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
413 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
414 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
415 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
416 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
417 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
418 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
419 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
420 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
421 2919150387 Rahnella aceris 1817 Isolate Unclassified
422 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
423 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
424 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
425 2919726948 Bacillus pumilus 4489 Isolate Unclassified
426 2922554459 Rhodococcus sp. 66b Isolate Unclassified
427 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
428 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
429 2927143783 Rahnella sp. 2050 Isolate Unclassified
430 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
431 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
432 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
433 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
434 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
435 2932406140 Serratia sp. 2723 Isolate Rhizosphere
436 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
437 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
438 2937539931 Pantoea sp. LS15 Isolate Unclassified
439 2937967321 Serratia sp. YC16 Isolate Unclassified
440 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
441 2938917290 Bacillus sp. CR71 Isolate Unclassified
442 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
443 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
444 2939577877 Serratia sp. 509 Isolate Rhizosphere
445 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
446 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
447 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
448 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
449 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
450 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
451 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
452 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
453 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
454 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
455 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
456 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
457 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
458 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
459 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
460 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
461 2965761152 Bacillus sp. COPE52 Isolate Unclassified
462 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
463 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
464 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
465 2969141011 Bacillus velezensis MH25 Isolate Unclassified
466 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
467 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
468 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
469 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
470 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
471 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
472 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
473 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
474 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
475 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
476 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
477 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
478 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
479 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
480 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
481 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
482 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
483 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
484 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
485 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
486 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
487 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
488 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
489 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
490 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
491 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
492 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
493 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
494 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
495 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
496 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
497 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
498 640753048 Serratia proteamaculans 568 Isolate Endosphere
499 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
500 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
501 8004592986 Serratia sp. S119 Isolate Unclassified
502 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
503 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
504 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
505 8018221730 Enterobacter sp. CM29 Isolate Unclassified
506 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
507 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
508 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
509 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
510 8022653035 Bacillus sp. Rc4 Isolate Unclassified
511 8022792930 Bacillus sp. Xin Isolate Rhizosphere
512 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
513 8023438354 Bacillus sp. BH2 Isolate Unclassified
514 8023444577 Bacillus sp. BH32 Isolate Unclassified
515 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
516 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
517 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
518 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
519 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
520 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
521 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
522 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
523 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
524 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
525 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
526 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
527 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
528 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
529 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
530 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
531 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
532 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
533 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 62.75
Metatranscriptomes 1.28
Isolates 35.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0.11
Endosphere 7.15
Nodule 2.35
Rhizoplane 7.04
Rhizosphere 52.93
Stem 0.11
Stem Tuber 0.53
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000274 3300001989 Bacteria 17327
2 JGI24744J21845_10014432 3300002077 Bacteria 1586
3 JGI25162J39368_1000019 3300002737 Bacteria 262053
4 JGI25162J39368_1001119 3300002737 Bacteria 16153
5 JGI25163J39215_1000121 3300002771 Bacteria 32543
6 JGI25164J39214_1000011 3300002772 Bacteria 262057
7 JGI25152J39213_1000139 3300002773 Bacteria 49588
8 JGI25151J46595_10000158 3300003187 Bacteria 87889
9 JGI25151J46595_10003023 3300003187 Bacteria 9556
10 JGI25151J46595_10014500 3300003187 Bacteria 3507
11 JGI25151J46595_10015640 3300003187 Bacteria 3336
12 JGI25151J46595_10027687 3300003187 Bacteria 2267
13 Ga0006562J51391_1002186 3300003578 Bacteria 1580
14 Ga0006562J51391_1006751 3300003578 Bacteria 7620
15 Ga0006562J51391_1016265 3300003578 Bacteria 1888
16 Ga0055538_1000021 3300003751 Bacteria 262057
17 Ga0055538_1000316 3300003751 Bacteria 22997
18 Ga0055539_1000026 3300003752 Bacteria 262057
19 Ga0055533_1000035 3300003756 Bacteria 262057
20 Ga0055532_1000233 3300003758 Bacteria 41111
21 Ga0055525_1000045 3300003759 Bacteria 262057
22 Ga0055535_1002935 3300003761 Bacteria 5291
23 Ga0055531_10000234 3300003794 Bacteria 60772
24 Ga0055541_1000020 3300003841 Bacteria 262057
25 Ga0055541_1000831 3300003841 Bacteria 7590
26 Ga0055541_1005311 3300003841 Bacteria 2257
27 Ga0058692_1000099 3300003856 Bacteria 57042
28 Ga0058692_1000261 3300003856 Bacteria 28622
29 Ga0058692_1000354 3300003856 Bacteria 22335
30 Ga0058692_1000393 3300003856 Bacteria 20974
31 Ga0058692_1000468 3300003856 Bacteria 18161
32 Ga0058692_1001738 3300003856 Bacteria 7757
33 Ga0058692_1004623 3300003856 Bacteria 4052
34 Ga0058692_1007067 3300003856 Bacteria 3014
35 Ga0058692_1009103 3300003856 Bacteria 2524
36 Ga0065703_1019809 3300005272 Bacteria 2385
37 Ga0065704_10000261 3300005289 Bacteria 53884
38 Ga0065704_10000708 3300005289 Bacteria 46350
39 Ga0065704_10070603 3300005289 Bacteria 19322
40 Ga0065704_10070657 3300005289 Bacteria 18234
41 Ga0065704_10112895 3300005289 Bacteria 1922
42 Ga0070658_10000763 3300005327 Bacteria 27616
43 Ga0070658_10013013 3300005327 Bacteria 6678
44 Ga0070690_100075534 3300005330 Bacteria 2197
45 Ga0068868_100003167 3300005338 Bacteria 11453
46 Ga0070660_100016489 3300005339 Bacteria 5362
47 Ga0070671_100002544 3300005355 Bacteria 14132
48 Ga0070708_100034203 3300005445 Bacteria 4421
49 Ga0070708_100069342 3300005445 Bacteria 3170
50 Ga0070706_100000084 3300005467 Bacteria 109077
51 Ga0070706_100000277 3300005467 Bacteria 62380
52 Ga0070706_100000858 3300005467 Bacteria 33483
53 Ga0070706_100025427 3300005467 Bacteria 5449
54 Ga0070706_100031538 3300005467 Bacteria 4886
55 Ga0070707_100000029 3300005468 Bacteria 123116
56 Ga0070707_100002389 3300005468 Bacteria 17929
57 Ga0070707_100008844 3300005468 Bacteria 9340
58 Ga0070707_100025604 3300005468 Bacteria 5599
59 Ga0070698_100000166 3300005471 Bacteria 60815
60 Ga0070698_100000793 3300005471 Bacteria 34351
61 Ga0070698_100005108 3300005471 Bacteria 14369
62 Ga0070698_100008670 3300005471 Bacteria 10957
63 Ga0070698_100014576 3300005471 Bacteria 8301
64 Ga0070698_100016460 3300005471 Bacteria 7801
65 Ga0070698_100107780 3300005471 Bacteria 2753
66 Ga0070698_100110789 3300005471 Bacteria 2710
67 Ga0070699_100000171 3300005518 Bacteria 62282
68 Ga0070699_100000395 3300005518 Bacteria 42275
69 Ga0070699_100006492 3300005518 Bacteria 10184
70 Ga0070699_100018451 3300005518 Bacteria 5993
71 Ga0070699_100072515 3300005518 Bacteria 2995
72 Ga0070684_100000077 3300005535 Bacteria 64172
73 Ga0070697_100000003 3300005536 Bacteria 322584
74 Ga0070697_100000806 3300005536 Bacteria 23524
75 Ga0070697_100000866 3300005536 Bacteria 22778
76 Ga0070697_100039204 3300005536 Bacteria 3830
77 Ga0070665_100000464 3300005548 Bacteria 58895
78 Ga0070665_100094141 3300005548 Bacteria 3001
79 Ga0068857_100000207 3300005577 Bacteria 38345
80 Ga0068859_100005482 3300005617 Bacteria 12917
81 Ga0068858_100220246 3300005842 Bacteria 1797
82 Ga0081455_10032838 3300005937 Bacteria 4671
83 Ga0081538_10022116 3300005981 Bacteria 4619
84 Ga0070717_10001202 3300006028 Bacteria 17535
85 Ga0070717_10004253 3300006028 Bacteria 10324
86 Ga0070717_10017018 3300006028 Bacteria 5647
87 Ga0075364_10003469 3300006051 Bacteria 8974
88 Ga0075364_10038878 3300006051 Bacteria 3083
89 Ga0075364_10094540 3300006051 Bacteria 1986
90 Ga0070716_100038075 3300006173 Bacteria 2661
91 Ga0075366_10002650 3300006195 Bacteria 9220
92 Ga0097620_100005480 3300006931 Bacteria 12917
93 Ga0079104_1000018 3300006946 Bacteria 271088
94 Ga0079104_1000163 3300006946 Bacteria 94189
95 Ga0079104_1000282 3300006946 Bacteria 65218
96 Ga0079104_1000384 3300006946 Bacteria 51458
97 Ga0079104_1000391 3300006946 Bacteria 50839
98 Ga0079104_1001061 3300006946 Bacteria 20757
99 Ga0079104_1001257 3300006946 Bacteria 17623
100 Ga0079104_1003314 3300006946 Bacteria 7635
101 Ga0079104_1006480 3300006946 Bacteria 4419
102 Ga0105251_10001421 3300009011 Bacteria 20627
103 Ga0105251_10001888 3300009011 Bacteria 17191
104 Ga0105251_10003233 3300009011 Bacteria 12002
105 Ga0105251_10003985 3300009011 Bacteria 10450
106 Ga0105251_10007214 3300009011 Bacteria 6900
107 Ga0105251_10014434 3300009011 Bacteria 4366
108 Ga0105251_10041405 3300009011 Bacteria 2242
109 Ga0105244_10000009 3300009036 Bacteria 286143
110 Ga0105244_10000347 3300009036 Bacteria 43582
111 Ga0105244_10000635 3300009036 Bacteria 31015
112 Ga0105244_10000636 3300009036 Bacteria 30959
113 Ga0105244_10000667 3300009036 Bacteria 30108
114 Ga0105244_10000818 3300009036 Bacteria 26304
115 Ga0105244_10000999 3300009036 Bacteria 23680
116 Ga0105244_10001459 3300009036 Bacteria 19110
117 Ga0105244_10003403 3300009036 Bacteria 11355
118 Ga0105244_10003888 3300009036 Bacteria 10508
119 Ga0105244_10007217 3300009036 Bacteria 7085
120 Ga0105244_10013124 3300009036 Bacteria 4856
121 Ga0105250_10000002 3300009092 Bacteria 566949
122 Ga0105250_10000101 3300009092 Bacteria 76942
123 Ga0105250_10000594 3300009092 Bacteria 23692
124 Ga0105250_10000614 3300009092 Bacteria 23253
125 Ga0105250_10001153 3300009092 Bacteria 14845
126 Ga0105250_10001182 3300009092 Bacteria 14657
127 Ga0105250_10004678 3300009092 Bacteria 6254
128 Ga0105250_10006179 3300009092 Bacteria 5262
129 Ga0105250_10011526 3300009092 Bacteria 3665
130 Ga0105240_10193625 3300009093 Bacteria 2389
131 Ga0105245_10010945 3300009098 Bacteria 7893
132 Ga0105245_10141483 3300009098 Bacteria 2266
133 Ga0105247_10000025 3300009101 Bacteria 208459
134 Ga0105243_10032193 3300009148 Bacteria 4050
135 Ga0105241_10000005 3300009174 Bacteria 384203
136 Ga0105248_10004273 3300009177 Bacteria 15809
137 Ga0105237_10000060 3300009545 Bacteria 146242
138 Ga0105238_10133244 3300009551 Bacteria 2463
139 Ga0105239_10027102 3300010375 Bacteria 6308
140 Ga0105246_10005098 3300011119 Bacteria 7993
141 Ga0105246_10005700 3300011119 Bacteria 7600
142 Ga0105246_10053878 3300011119 Bacteria 2770
143 Ga0157373_10000110 3300013100 Bacteria 64710
144 Ga0157373_10001965 3300013100 Bacteria 15579
145 Ga0157373_10017913 3300013100 Bacteria 5157
146 Ga0157373_10028353 3300013100 Bacteria 4038
147 Ga0157371_10000098 3300013102 Bacteria 134017
148 Ga0157371_10000528 3300013102 Bacteria 45611
149 Ga0157371_10000663 3300013102 Bacteria 40884
150 Ga0157371_10000673 3300013102 Bacteria 40561
151 Ga0157371_10000911 3300013102 Bacteria 33321
152 Ga0157371_10004595 3300013102 Bacteria 11988
153 Ga0157371_10025820 3300013102 Bacteria 4276
154 Ga0157370_10000683 3300013104 Bacteria 42237
155 Ga0157370_10001362 3300013104 Bacteria 30264
156 Ga0157370_10030269 3300013104 Bacteria 5304
157 Ga0157370_10086395 3300013104 Bacteria 2947
158 Ga0157369_10000589 3300013105 Bacteria 47375
159 Ga0157369_10000988 3300013105 Bacteria 35979
160 Ga0157369_10005106 3300013105 Bacteria 15365
161 Ga0157369_10012721 3300013105 Bacteria 9544
162 Ga0157369_10042245 3300013105 Bacteria 4974
163 Ga0157374_10008966 3300013296 Bacteria 8574
164 Ga0157374_10084100 3300013296 Bacteria 3024
165 Ga0163162_10007001 3300013306 Bacteria 10938
166 Ga0157372_10005333 3300013307 Bacteria 13654
167 Ga0157372_10012243 3300013307 Bacteria 9136
168 Ga0157375_10000052 3300013308 Bacteria 130032
169 Ga0157376_10000214 3300014969 Bacteria 40007
170 Ga0182006_1000018 3300015261 Bacteria 299376
171 Ga0183366_1001 3300015679 Bacteria 2743932
172 Ga0183370_1001 3300015680 Bacteria 2743932
173 Ga0183369_1001 3300015685 Bacteria 2743932
174 Ga0183368_1001 3300015687 Bacteria 2743932
175 Ga0163161_10000001 3300017792 Bacteria 2041488
176 Ga0213876_10000034 3300021384 Bacteria 202967
177 Ga0209760_100004 3300025207 Bacteria 254650
178 Ga0209784_100001 3300025224 Bacteria 3600592
179 Ga0209784_100183 3300025224 Bacteria 50174
180 Ga0209566_100001 3300025225 Bacteria 3600765
181 Ga0209566_100054 3300025225 Bacteria 221422
182 Ga0209566_100058 3300025225 Bacteria 201317
183 Ga0209566_100072 3300025225 Bacteria 167764
184 Ga0209566_100115 3300025225 Bacteria 107765
185 Ga0209566_100574 3300025225 Bacteria 23768
186 Ga0209566_100703 3300025225 Bacteria 19289
187 Ga0209566_101096 3300025225 Bacteria 10509
188 Ga0209674_100002 3300025226 Bacteria 3600592
189 Ga0209147_100088 3300025229 Bacteria 179728
190 Ga0209563_100002 3300025230 Bacteria 2045675
191 Ga0207427_100012 3300025231 Bacteria 585657
192 Ga0209437_100001 3300025233 Bacteria 2045675
193 Ga0209437_100238 3300025233 Bacteria 90380
194 Ga0209437_100302 3300025233 Bacteria 68690
195 Ga0209437_100909 3300025233 Bacteria 11539
196 Ga0209258_103608 3300025242 Bacteria 3264
197 Ga0209258_104781 3300025242 Bacteria 2465
198 Ga0209677_100002 3300025253 Bacteria 2045675
199 Ga0209129_1000077 3300025258 Bacteria 193474
200 Ga0209233_1004169 3300025261 Bacteria 4969
201 Ga0209130_1000320 3300025284 Bacteria 56333
202 Ga0209676_1001699 3300025292 Bacteria 19044
203 Ga0209025_1000001 3300025294 Bacteria 1888151
204 Ga0209025_1000368 3300025294 Bacteria 95103
205 Ga0209025_1003105 3300025294 Bacteria 16286
206 Ga0209025_1008379 3300025294 Bacteria 7450
207 Ga0209025_1008947 3300025294 Bacteria 7083
208 Ga0209025_1009924 3300025294 Bacteria 6543
209 Ga0209025_1013065 3300025294 Bacteria 5250
210 Ga0209025_1022408 3300025294 Bacteria 3351
211 Ga0209025_1033559 3300025294 Bacteria 2368
212 Ga0209051_1000025 3300025303 Bacteria 415397
213 Ga0209257_1000039 3300025304 Bacteria 591694
214 Ga0209257_1017430 3300025304 Bacteria 2828
215 Ga0207696_1000001 3300025711 Bacteria 2579611
216 Ga0207696_1000013 3300025711 Bacteria 524881
217 Ga0207696_1000021 3300025711 Bacteria 432606
218 Ga0207696_1000053 3300025711 Bacteria 268590
219 Ga0207696_1000058 3300025711 Bacteria 248495
220 Ga0207696_1000620 3300025711 Bacteria 26106
221 Ga0207696_1000622 3300025711 Bacteria 26024
222 Ga0207696_1001212 3300025711 Bacteria 14657
223 Ga0207696_1001317 3300025711 Bacteria 13720
224 Ga0207696_1001388 3300025711 Bacteria 13239
225 Ga0207696_1003318 3300025711 Bacteria 7404
226 Ga0207655_1000002 3300025728 Bacteria 1148694
227 Ga0207655_1000004 3300025728 Bacteria 1021221
228 Ga0207655_1000007 3300025728 Bacteria 773492
229 Ga0207655_1000036 3300025728 Bacteria 356747
230 Ga0207655_1000447 3300025728 Bacteria 54492
231 Ga0207655_1000604 3300025728 Bacteria 43480
232 Ga0207655_1000642 3300025728 Bacteria 41825
233 Ga0207655_1000733 3300025728 Bacteria 37019
234 Ga0207655_1000829 3300025728 Bacteria 33362
235 Ga0207655_1001670 3300025728 Bacteria 19607
236 Ga0207655_1002030 3300025728 Bacteria 17117
237 Ga0207655_1005626 3300025728 Bacteria 8482
238 Ga0207655_1021087 3300025728 Bacteria 3320
239 Ga0207713_1000001 3300025735 Bacteria 2295391
240 Ga0207713_1000012 3300025735 Bacteria 501860
241 Ga0207713_1000047 3300025735 Bacteria 229463
242 Ga0207713_1000132 3300025735 Bacteria 113216
243 Ga0207713_1000383 3300025735 Bacteria 47969
244 Ga0207713_1001567 3300025735 Bacteria 17940
245 Ga0207713_1002227 3300025735 Bacteria 14371
246 Ga0207713_1002776 3300025735 Bacteria 12377
247 Ga0207713_1005688 3300025735 Bacteria 7738
248 Ga0207713_1012704 3300025735 Bacteria 4483
249 Ga0207713_1049410 3300025735 Bacteria 1686
250 Ga0207710_10000150 3300025900 Bacteria 79270
251 Ga0207705_10002539 3300025909 Bacteria 14057
252 Ga0207705_10005126 3300025909 Bacteria 9824
253 Ga0207684_10000002 3300025910 Bacteria 1042751
254 Ga0207684_10000008 3300025910 Bacteria 601602
255 Ga0207684_10000040 3300025910 Bacteria 262703
256 Ga0207684_10017137 3300025910 Bacteria 6218
257 Ga0207654_10000007 3300025911 Bacteria 384211
258 Ga0207671_10000062 3300025914 Bacteria 172081
259 Ga0207657_10041612 3300025919 Bacteria 4062
260 Ga0207646_10000142 3300025922 Bacteria 98159
261 Ga0207646_10000333 3300025922 Bacteria 63824
262 Ga0207646_10000613 3300025922 Bacteria 46430
263 Ga0207646_10002050 3300025922 Bacteria 24191
264 Ga0207646_10003431 3300025922 Bacteria 17898
265 Ga0207646_10003981 3300025922 Bacteria 16377
266 Ga0207646_10009446 3300025922 Bacteria 9641
267 Ga0207646_10011676 3300025922 Bacteria 8493
268 Ga0207646_10012410 3300025922 Bacteria 8189
269 Ga0207687_10005575 3300025927 Bacteria 8316
270 Ga0207664_10161207 3300025929 Bacteria 1913
271 Ga0207709_10016891 3300025935 Bacteria 4066
272 Ga0207711_10021152 3300025941 Bacteria 5434
273 Ga0207661_10000015 3300025944 Bacteria 318960
274 Ga0207668_10018611 3300025972 Bacteria 4375
275 Ga0207677_10000048 3300026023 Bacteria 101555
276 Ga0207674_10002163 3300026116 Bacteria 24860
277 Ga0207674_10071284 3300026116 Bacteria 3492
278 Ga0209281_1000004 3300027111 Bacteria 1253949
279 Ga0209281_1000006 3300027111 Bacteria 1170244
280 Ga0209281_1000014 3300027111 Bacteria 643021
281 Ga0209281_1000064 3300027111 Bacteria 287876
282 Ga0209281_1000071 3300027111 Bacteria 274050
283 Ga0209281_1000257 3300027111 Bacteria 103090
284 Ga0209281_1000370 3300027111 Bacteria 72879
285 Ga0209281_1000714 3300027111 Bacteria 33175
286 Ga0209281_1000926 3300027111 Bacteria 24167
287 Ga0209281_1001332 3300027111 Bacteria 15526
288 Ga0209281_1001392 3300027111 Bacteria 14777
289 Ga0209371_1000001 3300027312 Bacteria 2771503
290 Ga0209371_1000002 3300027312 Bacteria 1551985
291 Ga0209371_1000005 3300027312 Bacteria 1061740
292 Ga0209371_1000015 3300027312 Bacteria 659640
293 Ga0209371_1000099 3300027312 Bacteria 154918
294 Ga0209371_1000100 3300027312 Bacteria 154467
295 Ga0209371_1000120 3300027312 Bacteria 132938
296 Ga0209371_1000466 3300027312 Bacteria 39817
297 Ga0209371_1000778 3300027312 Bacteria 26405
298 Ga0209371_1000832 3300027312 Bacteria 25391
299 Ga0209371_1000964 3300027312 Bacteria 22330
300 Ga0209371_1001051 3300027312 Bacteria 20781
301 Ga0209371_1006561 3300027312 Bacteria 4277
302 Ga0209371_1006984 3300027312 Bacteria 4047
303 Ga0209371_1008478 3300027312 Bacteria 3410
304 Ga0209371_1017486 3300027312 Bacteria 1856
305 Ga0268266_10000286 3300028379 Bacteria 83269
306 Ga0268266_10032002 3300028379 Bacteria 4469
307 Ga0237817_10010 3300030083 Bacteria 78285
308 Ga0268256_1000001 3300030500 Bacteria 2771065
309 Ga0268256_1000002 3300030500 Bacteria 1535763
310 Ga0268256_1000006 3300030500 Bacteria 1063991
311 Ga0268256_1000018 3300030500 Bacteria 594572
312 Ga0268256_1000035 3300030500 Bacteria 384794
313 Ga0268256_1000089 3300030500 Bacteria 154491
314 Ga0268256_1000423 3300030500 Bacteria 38191
315 Ga0268256_1000714 3300030500 Bacteria 24660
316 Ga0268256_1000815 3300030500 Bacteria 22341
317 Ga0268256_1001088 3300030500 Bacteria 17848
318 Ga0268256_1001187 3300030500 Bacteria 16663
319 Ga0268256_1001261 3300030500 Bacteria 15768
320 Ga0268256_1001364 3300030500 Bacteria 14847
321 Ga0268256_1004173 3300030500 Bacteria 6117
322 Ga0268256_1007114 3300030500 Bacteria 4047
323 Ga0268256_1010729 3300030500 Bacteria 2950
324 Ga0268256_1019486 3300030500 Bacteria 1856
325 Ga0265330_10006907 3300031235 Bacteria 5577
326 Ga0265330_10059295 3300031235 Bacteria 1667
327 Ga0265325_10008619 3300031241 Bacteria 6007
328 Ga0265339_10002811 3300031249 Bacteria 12365
329 Ga0265331_10052169 3300031250 Bacteria 1955
330 Ga0265316_10014201 3300031344 Bacteria 7026
331 Ga0307408_100121385 3300031548 Bacteria 2025
332 Ga0265314_10030356 3300031711 Bacteria 4002
333 Ga0265314_10057905 3300031711 Bacteria 2658
334 Ga0265342_10004166 3300031712 Bacteria 11508
335 Ga0316578_10026048 3300031728 Bacteria 3295
336 Ga0316578_10033102 3300031728 Bacteria 2958
337 Ga0307413_10033108 3300031824 Bacteria 2938
338 Ga0307410_10006702 3300031852 Bacteria 6240
339 Ga0307406_10024886 3300031901 Bacteria 3580
340 Ga0307510_10087683 3300033180 Bacteria 2976
341 Ga0316574_0076742 3300035398 Bacteria 2117
342 Ga0316582_0011868 3300036647 Bacteria 4838
343 Ga0316582_0067878 3300036647 Bacteria 2301
344 Ga0316584_0043456 3300036712 Bacteria 3350
345 Ga0373925_0087083 3300037068 Bacteria 2384
346 Ga0395900_0223228 3300037418 Bacteria 1898
347 Ga0237819_02091 3300038705 Bacteria 4335
348 Ga0400488_52971 3300038741 Bacteria 12949
349 Ga0400489_11819 3300039093 Bacteria 9617
350 Ga0436365_0965775 3300039437 Bacteria 470291
351 Ga0439436_0015324 3300041404 Bacteria 2306
352 Ga0439438_000002 3300041405 Bacteria 618223
353 Ga0439439_0002184 3300041406 Bacteria 4108
354 Ga0439466_0000001 3300041411 Bacteria 647258
355 Ga0439466_0000450 3300041411 Bacteria 15663
356 Ga0451853_3168715 3300041512 Bacteria 3791
357 Ga0439432_000295 3300042006 Bacteria 17930
358 Ga0439449_0000010 3300042007 Bacteria 58004
359 Ga0439452_000001 3300042010 Bacteria 1725439
360 Ga0439452_000002 3300042010 Bacteria 1377577
361 Ga0439452_000020 3300042010 Bacteria 309345
362 Ga0439452_000031 3300042010 Bacteria 196691
363 Ga0439452_000032 3300042010 Bacteria 184797
364 Ga0439462_0024401 3300042015 Bacteria 1588
365 Ga0451577_0007660 3300042876 Bacteria 10588
366 Ga0466969_0000115 3300044656 Bacteria 42292
367 Ga0466981_0000003 3300044669 Bacteria 248458
368 Ga0453684_0002622 3300044712 Bacteria 42982
369 Ga0451576_0042243 3300045051 Bacteria 4814
370 Ga0466967_0006590 3300045976 Bacteria 8246
371 Ga0495627_000018 3300046453 Bacteria 315125
372 Ga0495591_000001 3300046458 Bacteria 503087
373 Ga0495591_000050 3300046458 Bacteria 137772
374 Ga0495591_001001 3300046458 Bacteria 19212
375 Ga0495638_0039389 3300046460 Bacteria 3000
376 Ga0495650_0000031 3300046471 Bacteria 433811
377 Ga0495650_0000047 3300046471 Bacteria 335136
378 Ga0495650_0000182 3300046471 Bacteria 137031
379 Ga0495607_0071972 3300046501 Bacteria 1926
380 Ga0495606_0003900 3300046507 Bacteria 15370
381 Ga0495606_0015548 3300046507 Bacteria 5856
382 Ga0495648_0001866 3300046524 Bacteria 20143
383 Ga0495654_0000009 3300046530 Bacteria 381872
384 Ga0495654_0000068 3300046530 Bacteria 125533
385 Ga0495654_0000596 3300046530 Bacteria 28899
386 Ga0495654_0016346 3300046530 Bacteria 3926
387 Ga0495597_0002098 3300046542 Bacteria 13248
388 Ga0495622_0007079 3300046557 Bacteria 5212
389 Ga0495633_0000002 3300046558 Bacteria 488754
390 Ga0495656_0061371 3300046615 Bacteria 1642
391 Ga0495649_0000504 3300046694 Bacteria 33380
392 Ga0495649_0000543 3300046694 Bacteria 31982
393 Ga0495589_0000002 3300046794 Bacteria 758846
394 Ga0495660_0000004 3300046810 Bacteria 1003183
395 Ga0495660_0000015 3300046810 Bacteria 324892
396 Ga0495660_0001493 3300046810 Bacteria 15817
397 Ga0495672_0000001 3300047320 Bacteria 1458820
398 Ga0495672_0000009 3300047320 Bacteria 557755
399 Ga0495672_0000015 3300047320 Bacteria 502855
400 Ga0495683_0006239 3300047323 Bacteria 6522
401 Ga0495679_000309 3300047446 Bacteria 39033
402 Ga0495679_015728 3300047446 Bacteria 2758
403 Ga0495673_0000007 3300047469 Bacteria 796722
404 Ga0495673_0000019 3300047469 Bacteria 554389
405 Ga0495681_0034070 3300047470 Bacteria 2541
406 Ga0496101_0000157 3300048904 Bacteria 57989
407 Ga0496102_0057081 3300048905 Bacteria 3563
408 Ga0496102_0074750 3300048905 Bacteria 3115
409 Ga0496103_0018887 3300048906 Bacteria 4140
410 Ga0496104_0000100 3300048907 Bacteria 83437
411 Ga0496108_0101917 3300048911 Bacteria 2449
412 Ga0496108_0116454 3300048911 Bacteria 2289
413 Ga0496110_0000084 3300048913 Bacteria 49140
414 Ga0496111_0001174 3300048914 Bacteria 14587
415 Ga0496116_0000023 3300048919 Bacteria 475792
416 Ga0496116_0000094 3300048919 Bacteria 205588
417 Ga0496116_0000110 3300048919 Bacteria 185668
418 Ga0496116_0000140 3300048919 Bacteria 151165
419 Ga0496116_0000625 3300048919 Bacteria 46424
420 Ga0496116_0001704 3300048919 Bacteria 24089
421 Ga0496116_0001737 3300048919 Bacteria 23762
422 Ga0496116_0002154 3300048919 Bacteria 20968
423 Ga0496116_0003742 3300048919 Bacteria 14874
424 Ga0496116_0003924 3300048919 Bacteria 14491
425 Ga0496116_0004165 3300048919 Bacteria 13923
426 Ga0496116_0005211 3300048919 Bacteria 12176
427 Ga0496116_0008976 3300048919 Bacteria 8595
428 Ga0496116_0029920 3300048919 Bacteria 3918
429 Ga0496116_0033684 3300048919 Bacteria 3630
430 Ga0496116_0052606 3300048919 Bacteria 2696
431 Ga0496117_0000009 3300048920 Bacteria 613759
432 Ga0496117_0000138 3300048920 Bacteria 159456
433 Ga0496117_0000154 3300048920 Bacteria 146606
434 Ga0496117_0000380 3300048920 Bacteria 76671
435 Ga0496117_0000835 3300048920 Bacteria 47629
436 Ga0496117_0002117 3300048920 Bacteria 26059
437 Ga0496117_0002120 3300048920 Bacteria 26005
438 Ga0496117_0002436 3300048920 Bacteria 23465
439 Ga0496117_0003978 3300048920 Bacteria 16704
440 Ga0496117_0004061 3300048920 Bacteria 16439
441 Ga0496117_0008017 3300048920 Bacteria 10127
442 Ga0496117_0018285 3300048920 Bacteria 5813
443 Ga0496117_0019093 3300048920 Bacteria 5645
444 Ga0496117_0019839 3300048920 Bacteria 5504
445 Ga0496117_0024460 3300048920 Bacteria 4777
446 Ga0496117_0066848 3300048920 Bacteria 2436
447 Ga0496118_0000017 3300048921 Bacteria 549445
448 Ga0496118_0000150 3300048921 Bacteria 123251
449 Ga0496118_0000158 3300048921 Bacteria 121361
450 Ga0496118_0000894 3300048921 Bacteria 46807
451 Ga0496118_0001286 3300048921 Bacteria 38322
452 Ga0496118_0001914 3300048921 Bacteria 29615
453 Ga0496118_0003457 3300048921 Bacteria 19860
454 Ga0496118_0005328 3300048921 Bacteria 14648
455 Ga0496118_0038280 3300048921 Bacteria 3846
456 Ga0496118_0062714 3300048921 Bacteria 2740
457 Ga0496119_0000012 3300048922 Bacteria 411917
458 Ga0496119_0000027 3300048922 Bacteria 249124
459 Ga0496119_0000049 3300048922 Bacteria 185482
460 Ga0496119_0000166 3300048922 Bacteria 92117
461 Ga0496119_0000352 3300048922 Bacteria 64461
462 Ga0496119_0000468 3300048922 Bacteria 55018
463 Ga0496119_0001574 3300048922 Bacteria 27136
464 Ga0496119_0001730 3300048922 Bacteria 25447
465 Ga0496119_0002241 3300048922 Bacteria 21509
466 Ga0496119_0002860 3300048922 Bacteria 18410
467 Ga0496119_0004253 3300048922 Bacteria 14348
468 Ga0496119_0007695 3300048922 Bacteria 9641
469 Ga0496119_0057325 3300048922 Bacteria 2354
470 Ga0496120_0000004 3300048923 Bacteria 534793
471 Ga0496120_0000022 3300048923 Bacteria 249124
472 Ga0496120_0000048 3300048923 Bacteria 187988
473 Ga0496120_0000052 3300048923 Bacteria 186071
474 Ga0496120_0000057 3300048923 Bacteria 177460
475 Ga0496120_0000137 3300048923 Bacteria 123518
476 Ga0496120_0000207 3300048923 Bacteria 101327
477 Ga0496120_0000406 3300048923 Bacteria 69216
478 Ga0496120_0000673 3300048923 Bacteria 50130
479 Ga0496120_0000711 3300048923 Bacteria 48821
480 Ga0496120_0001027 3300048923 Bacteria 37319
481 Ga0496120_0001489 3300048923 Bacteria 27770
482 Ga0496120_0002104 3300048923 Bacteria 21311
483 Ga0496120_0002703 3300048923 Bacteria 17378
484 Ga0496120_0002884 3300048923 Bacteria 16472
485 Ga0496121_0000389 3300048924 Bacteria 89759
486 Ga0496121_0001226 3300048924 Bacteria 44634
487 Ga0496121_0001655 3300048924 Bacteria 36766
488 Ga0496121_0002208 3300048924 Bacteria 30406
489 Ga0496121_0003017 3300048924 Bacteria 24448
490 Ga0496121_0003296 3300048924 Bacteria 23186
491 Ga0496121_0004821 3300048924 Bacteria 17759
492 Ga0496121_0005634 3300048924 Bacteria 15936
493 Ga0496121_0008356 3300048924 Bacteria 12216
494 Ga0496121_0011405 3300048924 Bacteria 9874
495 Ga0496121_0058635 3300048924 Bacteria 3180
496 Ga0496122_0000003 3300048925 Bacteria 645810
497 Ga0496122_0000007 3300048925 Bacteria 606493
498 Ga0496122_0000088 3300048925 Bacteria 207600
499 Ga0496122_0001843 3300048925 Bacteria 32310
500 Ga0496122_0002182 3300048925 Bacteria 28670
501 Ga0496122_0002922 3300048925 Bacteria 23306
502 Ga0496122_0003024 3300048925 Bacteria 22811
503 Ga0496122_0003212 3300048925 Bacteria 21739
504 Ga0496122_0003434 3300048925 Bacteria 20839
505 Ga0496122_0003484 3300048925 Bacteria 20689
506 Ga0496122_0004956 3300048925 Bacteria 16133
507 Ga0496122_0005161 3300048925 Bacteria 15734
508 Ga0496122_0023005 3300048925 Bacteria 5515
509 Ga0496122_0074389 3300048925 Bacteria 2404
510 Ga0496122_0082854 3300048925 Bacteria 2226
511 Ga0496123_0000004 3300048926 Bacteria 777230
512 Ga0496123_0000012 3300048926 Bacteria 458760
513 Ga0496123_0000139 3300048926 Bacteria 151469
514 Ga0496123_0001504 3300048926 Bacteria 32310
515 Ga0496123_0001770 3300048926 Bacteria 28492
516 Ga0496123_0002717 3300048926 Bacteria 21261
517 Ga0496123_0003304 3300048926 Bacteria 18279
518 Ga0496123_0003928 3300048926 Bacteria 16133
519 Ga0496123_0006718 3300048926 Bacteria 11073
520 Ga0496123_0014520 3300048926 Bacteria 6521
521 Ga0496123_0069160 3300048926 Bacteria 2219
522 Ga0496124_0000017 3300048927 Bacteria 444389
523 Ga0496124_0000025 3300048927 Bacteria 405471
524 Ga0496124_0000045 3300048927 Bacteria 287396
525 Ga0496124_0000368 3300048927 Bacteria 82338
526 Ga0496124_0000484 3300048927 Bacteria 68281
527 Ga0496124_0000620 3300048927 Bacteria 59508
528 Ga0496124_0001484 3300048927 Bacteria 34470
529 Ga0496124_0001931 3300048927 Bacteria 28393
530 Ga0496124_0004039 3300048927 Bacteria 17427
531 Ga0496124_0004060 3300048927 Bacteria 17353
532 Ga0496124_0005302 3300048927 Bacteria 14569
533 Ga0496124_0006843 3300048927 Bacteria 12281
534 Ga0496124_0008449 3300048927 Bacteria 10765
535 Ga0496124_0009313 3300048927 Bacteria 10123
536 Ga0496124_0034182 3300048927 Bacteria 4465
537 Ga0496124_0079461 3300048927 Bacteria 2701
538 Ga0496125_0000013 3300048928 Bacteria 628761
539 Ga0496125_0000065 3300048928 Bacteria 249830
540 Ga0496125_0000728 3300048928 Bacteria 54555
541 Ga0496125_0001229 3300048928 Bacteria 38359
542 Ga0496125_0001911 3300048928 Bacteria 28512
543 Ga0496125_0001991 3300048928 Bacteria 27713
544 Ga0496125_0004865 3300048928 Bacteria 15247
545 Ga0496125_0007236 3300048928 Bacteria 11823
546 Ga0496125_0022076 3300048928 Bacteria 5917
547 Ga0496125_0070815 3300048928 Bacteria 2728
548 Ga0496125_0113723 3300048928 Bacteria 1952
549 Ga0496126_0000865 3300048929 Bacteria 53248
550 Ga0496126_0001727 3300048929 Bacteria 32416
551 Ga0496126_0002119 3300048929 Bacteria 27745
552 Ga0496126_0002405 3300048929 Bacteria 25405
553 Ga0496126_0004050 3300048929 Bacteria 17821
554 Ga0496126_0005402 3300048929 Bacteria 14587
555 Ga0496126_0013484 3300048929 Bacteria 8306
556 Ga0496126_0013750 3300048929 Bacteria 8208
557 Ga0496126_0042116 3300048929 Bacteria 4219
558 Ga0496126_0096786 3300048929 Bacteria 2587
559 Ga0496126_0100424 3300048929 Bacteria 2532
560 Ga0501306_000570 3300049127 Bacteria 2923
561 Ga0501309_000677 3300049129 Bacteria 2943
562 Ga0501305_003117 3300049161 Bacteria 1856
563 Ga0495678_000777 3300049459 Bacteria 28686
564 Ga0495682_0000001 3300049460 Bacteria 1559116
565 Ga0501312_002553 3300049528 Bacteria 1975
566 Ga0501312_006488 3300049528 Bacteria 1461
567 Ga0501316_002315 3300049532 Bacteria 1751
568 Ga0501335_002418 3300049551 Bacteria 1514
569 Ga0501031_0037347 3300049568 Bacteria 3170
570 Ga0501033_0010131 3300049570 Bacteria 7235
571 Ga0501034_0002371 3300049571 Bacteria 22883
572 Ga0501034_0065414 3300049571 Bacteria 3648
573 Ga0501034_0191312 3300049571 Bacteria 2008
574 Ga0501036_0006154 3300049572 Bacteria 9735
575 Ga0501036_0018299 3300049572 Bacteria 5866
576 Ga0501038_0009093 3300049574 Bacteria 9117
577 Ga0501040_0003798 3300049576 Bacteria 9794
578 Ga0501042_0004170 3300049578 Bacteria 9185
579 Ga0501042_0012426 3300049578 Bacteria 5769
580 Ga0501043_0001906 3300049579 Bacteria 17879
581 Ga0501047_0004030 3300049581 Bacteria 13813
582 Ga0501048_0021270 3300049582 Bacteria 4750
583 Ga0501048_0099152 3300049582 Bacteria 2055
584 Ga0501071_0015764 3300049587 Bacteria 5191
585 Ga0501072_0029589 3300049588 Bacteria 4280
586 Ga0501074_0000975 3300049590 Bacteria 18524
587 Ga0501074_0002363 3300049590 Bacteria 13134
588 Ga0501075_0135783 3300049591 Bacteria 1874
589 Ga0501077_0084641 3300049593 Bacteria 2010
590 Ga0501208_007007 3300049655 Bacteria 1462
591 Ga0501217_002322 3300049661 Bacteria 3728
592 Ga0501081_0076057 3300049743 Bacteria 2344
593 Ga0501083_0036383 3300049744 Bacteria 3358
594 nmdc:mga00v17_27254_c1 3300050491 Bacteria 3335
595 nmdc:mga0yw44_46769_c1 3300050492 Bacteria 2600
596 Ga0500621_000002 3300053126 Bacteria 849473
597 Ga0501084_0041452 3300054114 Bacteria 3851
598 Ga0587070_000683 3300059491 Bacteria 3035
599 Ga0587079_004153 3300059647 Bacteria 1947
600 Ga0501082_0015040 3300060353 Bacteria 6668
601 2728532475 2728368933 Bacteria 7044283
602 2506577637 2506520007 Bacteria 5442880
603 2506582775 2506520008 Bacteria 5443009
604 2508851572 2508501071 Bacteria 5454741
605 2511379904 2511231025 Bacteria 5324661
606 2511434759 2511231035 Bacteria 5341610
607 2511700177 2511231119 Bacteria 4019861
608 2512734762 2512564039 Bacteria 8739048
609 2524006727 2523533629 Bacteria 2982326
610 2524186486 2524023129 Bacteria 6762600
611 2524190970 2524023129 Bacteria 6762600
612 2538427431 2537561728 Bacteria 5149301
613 2540607322 2540341094 Bacteria 4061186
614 2545556859 2545555800 Bacteria 4222588
615 2547697174 2547132181 Bacteria 4945084
616 2548649647 2547132416 Bacteria 4633861
617 2550900507 2548877040 Bacteria 7507281
618 2555261286 2554235234 Bacteria 5762085
619 2555467569 2554235283 Bacteria 3683090
620 2562463330 2561511199 Bacteria 5155034
621 2563927045 2563366752 Bacteria 4961801
622 2563929288 2563366752 Bacteria 4961801
623 2566993980 2565956761 Bacteria 6601618
624 2571533549 2571042143 Bacteria 6986194
625 2573038021 2571042588 Bacteria 5045676
626 2578931110 2576861599 Bacteria 4217202
627 2580930488 2579778775 Bacteria 5360914
628 2585829855 2585427591 Bacteria 5482980
629 2585835015 2585427592 Bacteria 5370892
630 2587737934 2585428059 Bacteria 8696589
631 2587743737 2585428059 Bacteria 8696589
632 2590611802 2588254257 Bacteria 5436094
633 2595088022 2593339131 Bacteria 5116855
634 2595316615 2593339198 Bacteria 7267884
635 2599411442 2599185169 Bacteria 5441380
636 2599926354 2599185299 Bacteria 4854625
637 2601524439 2600255254 Bacteria 5281859
638 2601529593 2600255255 Bacteria 5282785
639 2601534814 2600255256 Bacteria 5597742
640 2601539557 2600255257 Bacteria 5597196
641 2601616427 2600255280 Bacteria 5292309
642 2601621149 2600255281 Bacteria 5288753
643 2601638668 2600255286 Bacteria 5390125
644 2601641862 2600255287 Bacteria 5210468
645 2601649546 2600255288 Bacteria 5282738
646 2601654473 2600255289 Bacteria 5281907
647 2601659895 2600255290 Bacteria 5282218
648 2601665920 2600255291 Bacteria 5217298
649 2601698777 2600255298 Bacteria 5215185
650 2601701605 2600255299 Bacteria 5218662
651 2601707217 2600255300 Bacteria 5287774
652 2601711831 2600255301 Bacteria 5280532
653 2601717734 2600255302 Bacteria 5288235
654 2601719669 2600255303 Bacteria 5219315
655 2601727662 2600255304 Bacteria 5283973
656 2601732273 2600255305 Bacteria 5282329
657 2601739496 2600255306 Bacteria 5281613
658 2601741492 2600255307 Bacteria 5439064
659 2601752254 2600255309 Bacteria 5431045
660 2601757907 2600255310 Bacteria 5600903
661 2601764265 2600255311 Bacteria 5598766
662 2602019095 2600255392 Bacteria 5437392
663 2603637081 2602042046 Bacteria 5483348
664 2603645036 2602042047 Bacteria 4697674
665 2603661361 2602042052 Bacteria 5215873
666 2603664315 2602042053 Bacteria 5214361
667 2603699160 2602042066 Bacteria 4423871
668 2603705175 2602042067 Bacteria 4863713
669 2603840088 2602042103 Bacteria 5284714
670 2603845165 2602042104 Bacteria 5281639
671 2603849830 2602042105 Bacteria 5282303
672 2603855306 2602042106 Bacteria 5282744
673 2603868774 2602042109 Bacteria 5152801
674 2603872887 2602042110 Bacteria 5283285
675 2603876658 2602042111 Bacteria 5212080
676 2606049656 2603880178 Bacteria 5283018
677 2606068745 2603880184 Bacteria 5217896
678 2606147750 2603880202 Bacteria 5284684
679 2606177545 2603880211 Bacteria 5284226
680 2608669894 2608642108 Bacteria 4104624
681 2609909853 2609459761 Bacteria 5513740
682 2621274931 2619619294 Bacteria 5575484
683 2631984442 2630968484 Bacteria 3876276
684 2637224263 2636415599 Bacteria 5718434
685 2643735519 2643221543 Bacteria 6628015
686 2643738110 2643221543 Bacteria 6628015
687 2644422972 2643221676 Bacteria 8119172
688 2644740738 2643221735 Bacteria 3676263
689 2650897101 2648501693 Bacteria 5069560
690 2651531945 2648501850 Bacteria 3975476
691 2656278681 2654587920 Bacteria 5475511
692 2671101324 2667528172 Bacteria 5170840
693 2671108739 2667528173 Bacteria 5375747
694 2671585545 2671180115 Bacteria 5353919
695 2672336854 2671180330 Bacteria 5521719
696 2673820885 2671180694 Bacteria 7506943
697 2674419014 2671180844 Bacteria 4164150
698 2676405668 2675903046 Bacteria 5451247
699 2681996411 2681812866 Bacteria 4552357
700 2682006240 2681812869 Bacteria 5014465
701 2686354009 2684622997 Bacteria 4624240
702 2686997393 2684623153 Bacteria 3878815
703 2687498703 2687453109 Bacteria 3860091
704 2689444127 2687453601 Bacteria 5546041
705 2695628154 2695420354 Bacteria 3922431
706 2712469423 2711768156 Bacteria 4471618
707 2717916138 2716884898 Bacteria 3928789
708 2723604845 2721755693 Bacteria 6126117
709 2730135482 2728369359 Bacteria 5621728
710 2738890151 2738541308 Bacteria 7020677
711 2739239501 2738543011 Bacteria 5731169
712 2739267941 2738543017 Bacteria 4271950
713 2753809715 2751185905 Bacteria 6142767
714 2753856726 2751185917 Bacteria 4551186
715 2757566000 2757320391 Bacteria 4746095
716 2765589820 2765235842 Bacteria 4799256
717 2772438155 2772190666 Bacteria 5117644
718 2775539755 2775506706 Bacteria 4873073
719 2777020765 2775507074 Bacteria 5532402
720 2777762229 2775507177 Bacteria 4384303
721 2791922023 2791354903 Bacteria 4937680
722 2792310359 2791355010 Bacteria 4864581
723 2793184584 2791355222 Bacteria 5898266
724 2793404935 2791355275 Bacteria 4429597
725 2802437100 2802428803 Bacteria 5806948
726 2807176500 2806310673 Bacteria 4801221
727 2808901384 2808606372 Bacteria 4649509
728 2809055998 2808606399 Bacteria 4021018
729 2809125562 2808606414 Bacteria 4917181
730 2812316586 2811994870 Bacteria 3776934
731 2813728091 2811995292 Bacteria 5303342
732 2814695643 2814123068 Bacteria 5687681
733 2816862686 2816332186 Bacteria 5331395
734 2817480676 2816332295 Bacteria 4352468
735 2819565263 2818991440 Bacteria 4774720
736 2819569166 2818991441 Bacteria 5062707
737 2819670353 2818991459 Bacteria 8736032
738 2819673610 2818991459 Bacteria 8736032
739 2819723650 2818991468 Bacteria 3723169
740 2821112011 2821111986 Bacteria 6894338
741 2821114592 2821111986 Bacteria 6894338
742 2821120840 2821118458 Bacteria 4714306
743 2823375474 2823373977 Bacteria 4779415
744 2823528569 2823526263 Bacteria 3765752
745 2831908025 2831905167 Bacteria 3319172
746 2842684391 2842682962 Bacteria 5589973
747 2842891766 2842888712 Bacteria 4279094
748 2844528987 2844528606 Bacteria 4733806
749 2846542110 2846540461 Bacteria 5471451
750 2847086786 2847085930 Bacteria 5070450
751 2847799135 2847797336 Bacteria 5176640
752 2849144358 2849139964 Bacteria 5613304
753 2852107593 2852103415 Bacteria 5193810
754 2855199390 2855195626 Bacteria 4927512
755 2857454566 2857453340 Bacteria 8090534
756 2857457147 2857453340 Bacteria 8090534
757 2857473139 2857472729 Bacteria 6568124
758 2857582421 2857581216 Bacteria 5522813
759 2857587168 2857586860 Bacteria 4354574
760 2857608584 2857604169 Bacteria 5111450
761 2857610251 2857609550 Bacteria 3753890
762 2857610874 2857609550 Bacteria 3753890
763 2858439760 2858438669 Bacteria 2058402
764 2858470187 2858466076 Bacteria 4722413
765 2860840009 2860837431 Bacteria 4202080
766 2864737936 2864733723 Bacteria 6770668
767 2864739032 2864733723 Bacteria 6770668
768 2865000148 2864997549 Bacteria 5139696
769 2865004176 2865002811 Bacteria 6333767
770 2865017437 2865014394 Bacteria 4764573
771 2869553486 2869551831 Bacteria 5474685
772 2871275380 2871272651 Bacteria 5042015
773 2871286594 2871282230 Bacteria 4917173
774 2876602919 2876601092 Bacteria 5114497
775 2877771058 2877768649 Bacteria 3957164
776 2880171923 2880169592 Bacteria 3900066
777 2881610213 2881609920 Bacteria 4405319
778 2881641109 2881636855 Bacteria 5205297
779 2884088137 2884086401 Bacteria 5005459
780 2885527642 2885526491 Bacteria 7164189
781 2888368174 2888366609 Bacteria 5155009
782 2888374215 2888373701 Bacteria 5098052
783 2888582713 2888578766 Bacteria 6743310
784 2888583106 2888578766 Bacteria 6743310
785 2889046247 2889042446 Bacteria 7618936
786 2889046738 2889042446 Bacteria 7618936
787 2889055081 2889049205 Bacteria 7524325
788 2889280756 2889276214 Bacteria 5979355
789 2889296271 2889295896 Bacteria 4704906
790 2889301920 2889300758 Bacteria 5690814
791 2891672151 2891670763 Bacteria 4967099
792 2897112133 2897109615 Bacteria 4009619
793 2900055667 2900051742 Bacteria 4985156
794 2904114865 2904113452 Bacteria 7796941
795 2904163295 2904162308 Bacteria 7086713
796 2904163725 2904162308 Bacteria 7086713
797 2904466933 2904463128 Bacteria 4775606
798 2904475565 2904474040 Bacteria 5504324
799 2904481536 2904479285 Bacteria 5073931
800 2904493150 2904490793 Bacteria 7046938
801 2904493559 2904490793 Bacteria 7046938
802 2904507966 2904504865 Bacteria 5152820
803 2904515581 2904513164 Bacteria 5476410
804 2904539480 2904535858 Bacteria 6308016
805 2904562013 2904560550 Bacteria 4029838
806 2904598452 2904595352 Bacteria 6124848
807 2904760218 2904755435 Bacteria 7986759
808 2907205711 2907202186 Bacteria 6632024
809 2907206273 2907202186 Bacteria 6632024
810 2908668227 2908665501 Bacteria 3678115
811 2908672271 2908669403 Bacteria 5740494
812 2919095996 2919093281 Bacteria 3660974
813 2919111256 2919108558 Bacteria 5897419
814 2919151734 2919150387 Bacteria 5500879
815 2919162439 2919160200 Bacteria 6929020
816 2919162724 2919160200 Bacteria 6929020
817 2919417298 2919414237 Bacteria 5429133
818 2919426985 2919425241 Bacteria 8055701
819 2919427274 2919425241 Bacteria 8055701
820 2919728285 2919726948 Bacteria 3696050
821 2922555442 2922554459 Bacteria 6683962
822 2923635641 2923634449 Bacteria 4753480
823 2925332481 2925326138 Bacteria 9652120
824 2927144403 2927143783 Bacteria 5504251
825 2927833391 2927833300 Bacteria 4923934
826 2928512210 2928510474 Bacteria 4815308
827 2928513585 2928510474 Bacteria 4815308
828 2928519851 2928519762 Bacteria 1953908
829 2929210490 2929206907 Bacteria 5918291
830 2931389696 2931384279 Bacteria 7299545
831 2931390186 2931384279 Bacteria 7299545
832 2932408394 2932406140 Bacteria 5134491
833 2935625963 2935625433 Bacteria 5042964
834 2936341867 2936340661 Bacteria 5139038
835 2937542644 2937539931 Bacteria 4639830
836 2937969900 2937967321 Bacteria 5094075
837 2938649829 2938649242 Bacteria 7118381
838 2938917510 2938917290 Bacteria 5914775
839 2939569842 2939568625 Bacteria 4542555
840 2939577858 2939573065 Bacteria 4926053
841 2939580055 2939577877 Bacteria 5132791
842 2939606954 2939602548 Bacteria 4950493
843 2939608879 2939607340 Bacteria 4719256
844 2939618282 2939617950 Bacteria 4820956
845 2939643154 2939642701 Bacteria 4475280
846 2939679792 2939679117 Bacteria 6921672
847 2939680887 2939679117 Bacteria 6921672
848 2939706696 2939702853 Bacteria 5139229
849 2939747071 2939743619 Bacteria 5762299
850 2945877060 2945874760 Bacteria 5527237
851 2945952369 2945951305 Bacteria 4918162
852 2945991613 2945991243 Bacteria 7008369
853 2945997585 2945991243 Bacteria 7008369
854 2946053799 2946053406 Bacteria 6978655
855 2946054325 2946053406 Bacteria 6978655
856 2954773913 2954773129 Bacteria 3741715
857 2956899071 2956897341 Bacteria 5447711
858 2956900368 2956897341 Bacteria 5447711
859 2962293282 2962290636 Bacteria 4072939
860 2964328820 2964326757 Bacteria 3290868
861 2964378490 2964375228 Bacteria 4909004
862 2965766869 2965761152 Bacteria 5806513
863 2968561215 2968558590 Bacteria 6956864
864 2969081303 2969079654 Bacteria 5439582
865 2969139294 2969136845 Bacteria 3923176
866 2969143506 2969141011 Bacteria 4118468
867 2969767261 2969765954 Bacteria 4216713
868 2969773427 2969770375 Bacteria 4271280
869 2971405724 2971403814 Bacteria 7370929
870 2971416285 2971410472 Bacteria 8311090
871 2971417189 2971410472 Bacteria 8311090
872 2971515626 2971511577 Bacteria 5404012
873 2971822727 2971820967 Bacteria 5823634
874 2971895705 2971893375 Bacteria 3929648
875 2974311311 2974310843 Bacteria 4947816
876 2974439071 2974435778 Bacteria 4876478
877 2978978856 2978975091 Bacteria 4704313
878 2980125673 2980125574 Bacteria 5567337
879 2980180129 2980176882 Bacteria 5397533
880 2980184531 2980182181 Bacteria 9454109
881 2980495048 2980492589 Bacteria 4072961
882 2981288015 2981284811 Bacteria 4641497
883 2981292271 2981289755 Bacteria 4641509
884 2981983634 2981980479 Bacteria 4641628
885 2981988328 2981985349 Bacteria 4641497
886 2984497370 2984494565 Bacteria 5000175
887 2984530281 2984527788 Bacteria 5288478
888 2984536390 2984532647 Bacteria 5288506
889 2984563766 2984559226 Bacteria 5683096
890 2984596499 2984595703 Bacteria 5682994
891 2988229393 2988225383 Bacteria 7221625
892 2990261321 2990261002 Bacteria 4919493
893 2996639012 2996632988 Bacteria 6921523
894 3000378585 3000376612 Bacteria 4705565
895 3001895335 3001892409 Bacteria 6328293
896 3006831361 3006826541 Bacteria 4678913
897 3006861022 3006858327 Bacteria 4317835
898 3006881518 3006879489 Bacteria 4064221
899 3006981674 3006978542 Bacteria 5328100
900 640937140 640753048 Bacteria 5495657
901 648170887 648028048 Bacteria 5394884
902 8002322259 8002317523 Bacteria 8051857
903 8004597530 8004592986 Bacteria 5122074
904 8007373238 8007371054 Bacteria 4849201
905 8015397720 8015394850 Bacteria 5064660
906 8016735218 8016733728 Bacteria 5274317
907 8018223944 8018221730 Bacteria 4616064
908 8018409449 8018405270 Bacteria 4978981
909 8019501302 8019499862 Bacteria 5169538
910 8019505381 8019504834 Bacteria 4819156
911 8022631799 8022630665 Bacteria 3886130
912 8022654174 8022653035 Bacteria 4035078
913 8022796402 8022792930 Bacteria 5693794
914 8022954057 8022948649 Bacteria 5366783
915 8023439654 8023438354 Bacteria 5779374
916 8023447532 8023444577 Bacteria 5661597
917 8046997710 8046991243 Bacteria 8497463
918 8051955369 8051952484 Bacteria 3926774
919 8052178137 8052174270 Bacteria 3881265
920 8054281346 8054280661 Bacteria 4232245
921 8054467901 8054465665 Bacteria 7323556
922 8054795793 8054795415 Bacteria 9785225
923 8054846431 8054844752 Bacteria 4450330
924 8054851753 8054849141 Bacteria 5232694
925 8055088011 8055087960 Bacteria 4784273
926 8055095297 8055092621 Bacteria 4873875
927 8055098406 8055097453 Bacteria 4865496
928 8055635060 8055632911 Bacteria 5283357
929 8055696694 8055693939 Bacteria 4772047
930 8056539896 8056533031 Bacteria 8964429
931 8056540378 8056533031 Bacteria 8964429
932 8057307005 8057304971 Bacteria 4649742
933 8057473813 8057473075 Bacteria 5892720
934 8057476263 8057473075 Bacteria 5892720
935 8057587574 8057582654 Bacteria 5218944
936 8057737687 8057733483 Bacteria 6578323
937 8057980395 8057977335 Bacteria 5694872
938 JGI24739J22299_10000274
939 JGI24744J21845_10014432
940 JGI25162J39368_1000019
941 JGI25162J39368_1001119
942 JGI25163J39215_1000121
943 JGI25164J39214_1000011
944 JGI25152J39213_1000139
945 JGI25151J46595_10000158
946 JGI25151J46595_10003023
947 JGI25151J46595_10014500
948 JGI25151J46595_10015640
949 JGI25151J46595_10027687
950 Ga0006562J51391_1002186
951 Ga0006562J51391_1006751
952 Ga0006562J51391_1016265
953 Ga0055538_1000021
954 Ga0055538_1000316
955 Ga0055539_1000026
956 Ga0055533_1000035
957 Ga0055532_1000233
958 Ga0055525_1000045
959 Ga0055535_1002935
960 Ga0055531_10000234
961 Ga0055541_1000020
962 Ga0055541_1000831
963 Ga0055541_1005311
964 Ga0058692_1000099
965 Ga0058692_1000261
966 Ga0058692_1000354
967 Ga0058692_1000393
968 Ga0058692_1000468
969 Ga0058692_1001738
970 Ga0058692_1004623
971 Ga0058692_1007067
972 Ga0058692_1009103
973 Ga0065703_1019809
974 Ga0065704_10000261
975 Ga0065704_10000708
976 Ga0065704_10070603
977 Ga0065704_10070657
978 Ga0065704_10112895
979 Ga0070658_10000763
980 Ga0070658_10013013
981 Ga0070690_100075534
982 Ga0068868_100003167
983 Ga0070660_100016489
984 Ga0070671_100002544
985 Ga0070708_100034203
986 Ga0070708_100069342
987 Ga0070706_100000084
988 Ga0070706_100000277
989 Ga0070706_100000858
990 Ga0070706_100025427
991 Ga0070706_100031538
992 Ga0070707_100000029
993 Ga0070707_100002389
994 Ga0070707_100008844
995 Ga0070707_100025604
996 Ga0070698_100000166
997 Ga0070698_100000793
998 Ga0070698_100005108
999 Ga0070698_100008670
1000 Ga0070698_100014576
1001 Ga0070698_100016460
1002 Ga0070698_100107780
1003 Ga0070698_100110789
1004 Ga0070699_100000171
1005 Ga0070699_100000395
1006 Ga0070699_100006492
1007 Ga0070699_100018451
1008 Ga0070699_100072515
1009 Ga0070684_100000077
1010 Ga0070697_100000003
1011 Ga0070697_100000806
1012 Ga0070697_100000866
1013 Ga0070697_100039204
1014 Ga0070665_100000464
1015 Ga0070665_100094141
1016 Ga0068857_100000207
1017 Ga0068859_100005482
1018 Ga0068858_100220246
1019 Ga0081455_10032838
1020 Ga0081538_10022116
1021 Ga0070717_10001202
1022 Ga0070717_10004253
1023 Ga0070717_10017018
1024 Ga0075364_10003469
1025 Ga0075364_10038878
1026 Ga0075364_10094540
1027 Ga0070716_100038075
1028 Ga0075366_10002650
1029 Ga0097620_100005480
1030 Ga0079104_1000018
1031 Ga0079104_1000163
1032 Ga0079104_1000282
1033 Ga0079104_1000384
1034 Ga0079104_1000391
1035 Ga0079104_1001061
1036 Ga0079104_1001257
1037 Ga0079104_1003314
1038 Ga0079104_1006480
1039 Ga0105251_10001421
1040 Ga0105251_10001888
1041 Ga0105251_10003233
1042 Ga0105251_10003985
1043 Ga0105251_10007214
1044 Ga0105251_10014434
1045 Ga0105251_10041405
1046 Ga0105244_10000009
1047 Ga0105244_10000347
1048 Ga0105244_10000635
1049 Ga0105244_10000636
1050 Ga0105244_10000667
1051 Ga0105244_10000818
1052 Ga0105244_10000999
1053 Ga0105244_10001459
1054 Ga0105244_10003403
1055 Ga0105244_10003888
1056 Ga0105244_10007217
1057 Ga0105244_10013124
1058 Ga0105250_10000002
1059 Ga0105250_10000101
1060 Ga0105250_10000594
1061 Ga0105250_10000614
1062 Ga0105250_10001153
1063 Ga0105250_10001182
1064 Ga0105250_10004678
1065 Ga0105250_10006179
1066 Ga0105250_10011526
1067 Ga0105240_10193625
1068 Ga0105245_10010945
1069 Ga0105245_10141483
1070 Ga0105247_10000025
1071 Ga0105243_10032193
1072 Ga0105241_10000005
1073 Ga0105248_10004273
1074 Ga0105237_10000060
1075 Ga0105238_10133244
1076 Ga0105239_10027102
1077 Ga0105246_10005098
1078 Ga0105246_10005700
1079 Ga0105246_10053878
1080 Ga0157373_10000110
1081 Ga0157373_10001965
1082 Ga0157373_10017913
1083 Ga0157373_10028353
1084 Ga0157371_10000098
1085 Ga0157371_10000528
1086 Ga0157371_10000663
1087 Ga0157371_10000673
1088 Ga0157371_10000911
1089 Ga0157371_10004595
1090 Ga0157371_10025820
1091 Ga0157370_10000683
1092 Ga0157370_10001362
1093 Ga0157370_10030269
1094 Ga0157370_10086395
1095 Ga0157369_10000589
1096 Ga0157369_10000988
1097 Ga0157369_10005106
1098 Ga0157369_10012721
1099 Ga0157369_10042245
1100 Ga0157374_10008966
1101 Ga0157374_10084100
1102 Ga0163162_10007001
1103 Ga0157372_10005333
1104 Ga0157372_10012243
1105 Ga0157375_10000052
1106 Ga0157376_10000214
1107 Ga0182006_1000018
1108 Ga0183366_1001
1109 Ga0183370_1001
1110 Ga0183369_1001
1111 Ga0183368_1001
1112 Ga0163161_10000001
1113 Ga0213876_10000034
1114 Ga0209760_100004
1115 Ga0209784_100001
1116 Ga0209784_100183
1117 Ga0209566_100001
1118 Ga0209566_100054
1119 Ga0209566_100058
1120 Ga0209566_100072
1121 Ga0209566_100115
1122 Ga0209566_100574
1123 Ga0209566_100703
1124 Ga0209566_101096
1125 Ga0209674_100002
1126 Ga0209147_100088
1127 Ga0209563_100002
1128 Ga0207427_100012
1129 Ga0209437_100001
1130 Ga0209437_100238
1131 Ga0209437_100302
1132 Ga0209437_100909
1133 Ga0209258_103608
1134 Ga0209258_104781
1135 Ga0209677_100002
1136 Ga0209129_1000077
1137 Ga0209233_1004169
1138 Ga0209130_1000320
1139 Ga0209676_1001699
1140 Ga0209025_1000001
1141 Ga0209025_1000368
1142 Ga0209025_1003105
1143 Ga0209025_1008379
1144 Ga0209025_1008947
1145 Ga0209025_1009924
1146 Ga0209025_1013065
1147 Ga0209025_1022408
1148 Ga0209025_1033559
1149 Ga0209051_1000025
1150 Ga0209257_1000039
1151 Ga0209257_1017430
1152 Ga0207696_1000001
1153 Ga0207696_1000013
1154 Ga0207696_1000021
1155 Ga0207696_1000053
1156 Ga0207696_1000058
1157 Ga0207696_1000620
1158 Ga0207696_1000622
1159 Ga0207696_1001212
1160 Ga0207696_1001317
1161 Ga0207696_1001388
1162 Ga0207696_1003318
1163 Ga0207655_1000002
1164 Ga0207655_1000004
1165 Ga0207655_1000007
1166 Ga0207655_1000036
1167 Ga0207655_1000447
1168 Ga0207655_1000604
1169 Ga0207655_1000642
1170 Ga0207655_1000733
1171 Ga0207655_1000829
1172 Ga0207655_1001670
1173 Ga0207655_1002030
1174 Ga0207655_1005626
1175 Ga0207655_1021087
1176 Ga0207713_1000001
1177 Ga0207713_1000012
1178 Ga0207713_1000047
1179 Ga0207713_1000132
1180 Ga0207713_1000383
1181 Ga0207713_1001567
1182 Ga0207713_1002227
1183 Ga0207713_1002776
1184 Ga0207713_1005688
1185 Ga0207713_1012704
1186 Ga0207713_1049410
1187 Ga0207710_10000150
1188 Ga0207705_10002539
1189 Ga0207705_10005126
1190 Ga0207684_10000002
1191 Ga0207684_10000008
1192 Ga0207684_10000040
1193 Ga0207684_10017137
1194 Ga0207654_10000007
1195 Ga0207671_10000062
1196 Ga0207657_10041612
1197 Ga0207646_10000142
1198 Ga0207646_10000333
1199 Ga0207646_10000613
1200 Ga0207646_10002050
1201 Ga0207646_10003431
1202 Ga0207646_10003981
1203 Ga0207646_10009446
1204 Ga0207646_10011676
1205 Ga0207646_10012410
1206 Ga0207687_10005575
1207 Ga0207664_10161207
1208 Ga0207709_10016891
1209 Ga0207711_10021152
1210 Ga0207661_10000015
1211 Ga0207668_10018611
1212 Ga0207677_10000048
1213 Ga0207674_10002163
1214 Ga0207674_10071284
1215 Ga0209281_1000004
1216 Ga0209281_1000006
1217 Ga0209281_1000014
1218 Ga0209281_1000064
1219 Ga0209281_1000071
1220 Ga0209281_1000257
1221 Ga0209281_1000370
1222 Ga0209281_1000714
1223 Ga0209281_1000926
1224 Ga0209281_1001332
1225 Ga0209281_1001392
1226 Ga0209371_1000001
1227 Ga0209371_1000002
1228 Ga0209371_1000005
1229 Ga0209371_1000015
1230 Ga0209371_1000099
1231 Ga0209371_1000100
1232 Ga0209371_1000120
1233 Ga0209371_1000466
1234 Ga0209371_1000778
1235 Ga0209371_1000832
1236 Ga0209371_1000964
1237 Ga0209371_1001051
1238 Ga0209371_1006561
1239 Ga0209371_1006984
1240 Ga0209371_1008478
1241 Ga0209371_1017486
1242 Ga0268266_10000286
1243 Ga0268266_10032002
1244 Ga0237817_10010
1245 Ga0268256_1000001
1246 Ga0268256_1000002
1247 Ga0268256_1000006
1248 Ga0268256_1000018
1249 Ga0268256_1000035
1250 Ga0268256_1000089
1251 Ga0268256_1000423
1252 Ga0268256_1000714
1253 Ga0268256_1000815
1254 Ga0268256_1001088
1255 Ga0268256_1001187
1256 Ga0268256_1001261
1257 Ga0268256_1001364
1258 Ga0268256_1004173
1259 Ga0268256_1007114
1260 Ga0268256_1010729
1261 Ga0268256_1019486
1262 Ga0265330_10006907
1263 Ga0265330_10059295
1264 Ga0265325_10008619
1265 Ga0265339_10002811
1266 Ga0265331_10052169
1267 Ga0265316_10014201
1268 Ga0307408_100121385
1269 Ga0265314_10030356
1270 Ga0265314_10057905
1271 Ga0265342_10004166
1272 Ga0316578_10026048
1273 Ga0316578_10033102
1274 Ga0307413_10033108
1275 Ga0307410_10006702
1276 Ga0307406_10024886
1277 Ga0307510_10087683
1278 Ga0316574_0076742
1279 Ga0316582_0011868
1280 Ga0316582_0067878
1281 Ga0316584_0043456
1282 Ga0373925_0087083
1283 Ga0395900_0223228
1284 Ga0237819_02091
1285 Ga0400488_52971
1286 Ga0400489_11819
1287 Ga0436365_0965775
1288 Ga0439436_0015324
1289 Ga0439438_000002
1290 Ga0439439_0002184
1291 Ga0439466_0000001
1292 Ga0439466_0000450
1293 Ga0451853_3168715
1294 Ga0439432_000295
1295 Ga0439449_0000010
1296 Ga0439452_000001
1297 Ga0439452_000002
1298 Ga0439452_000020
1299 Ga0439452_000031
1300 Ga0439452_000032
1301 Ga0439462_0024401
1302 Ga0451577_0007660
1303 Ga0466969_0000115
1304 Ga0466981_0000003
1305 Ga0453684_0002622
1306 Ga0451576_0042243
1307 Ga0466967_0006590
1308 Ga0495627_000018
1309 Ga0495591_000001
1310 Ga0495591_000050
1311 Ga0495591_001001
1312 Ga0495638_0039389
1313 Ga0495650_0000031
1314 Ga0495650_0000047
1315 Ga0495650_0000182
1316 Ga0495607_0071972
1317 Ga0495606_0003900
1318 Ga0495606_0015548
1319 Ga0495648_0001866
1320 Ga0495654_0000009
1321 Ga0495654_0000068
1322 Ga0495654_0000596
1323 Ga0495654_0016346
1324 Ga0495597_0002098
1325 Ga0495622_0007079
1326 Ga0495633_0000002
1327 Ga0495656_0061371
1328 Ga0495649_0000504
1329 Ga0495649_0000543
1330 Ga0495589_0000002
1331 Ga0495660_0000004
1332 Ga0495660_0000015
1333 Ga0495660_0001493
1334 Ga0495672_0000001
1335 Ga0495672_0000009
1336 Ga0495672_0000015
1337 Ga0495683_0006239
1338 Ga0495679_000309
1339 Ga0495679_015728
1340 Ga0495673_0000007
1341 Ga0495673_0000019
1342 Ga0495681_0034070
1343 Ga0496101_0000157
1344 Ga0496102_0057081
1345 Ga0496102_0074750
1346 Ga0496103_0018887
1347 Ga0496104_0000100
1348 Ga0496108_0101917
1349 Ga0496108_0116454
1350 Ga0496110_0000084
1351 Ga0496111_0001174
1352 Ga0496116_0000023
1353 Ga0496116_0000094
1354 Ga0496116_0000110
1355 Ga0496116_0000140
1356 Ga0496116_0000625
1357 Ga0496116_0001704
1358 Ga0496116_0001737
1359 Ga0496116_0002154
1360 Ga0496116_0003742
1361 Ga0496116_0003924
1362 Ga0496116_0004165
1363 Ga0496116_0005211
1364 Ga0496116_0008976
1365 Ga0496116_0029920
1366 Ga0496116_0033684
1367 Ga0496116_0052606
1368 Ga0496117_0000009
1369 Ga0496117_0000138
1370 Ga0496117_0000154
1371 Ga0496117_0000380
1372 Ga0496117_0000835
1373 Ga0496117_0002117
1374 Ga0496117_0002120
1375 Ga0496117_0002436
1376 Ga0496117_0003978
1377 Ga0496117_0004061
1378 Ga0496117_0008017
1379 Ga0496117_0018285
1380 Ga0496117_0019093
1381 Ga0496117_0019839
1382 Ga0496117_0024460
1383 Ga0496117_0066848
1384 Ga0496118_0000017
1385 Ga0496118_0000150
1386 Ga0496118_0000158
1387 Ga0496118_0000894
1388 Ga0496118_0001286
1389 Ga0496118_0001914
1390 Ga0496118_0003457
1391 Ga0496118_0005328
1392 Ga0496118_0038280
1393 Ga0496118_0062714
1394 Ga0496119_0000012
1395 Ga0496119_0000027
1396 Ga0496119_0000049
1397 Ga0496119_0000166
1398 Ga0496119_0000352
1399 Ga0496119_0000468
1400 Ga0496119_0001574
1401 Ga0496119_0001730
1402 Ga0496119_0002241
1403 Ga0496119_0002860
1404 Ga0496119_0004253
1405 Ga0496119_0007695
1406 Ga0496119_0057325
1407 Ga0496120_0000004
1408 Ga0496120_0000022
1409 Ga0496120_0000048
1410 Ga0496120_0000052
1411 Ga0496120_0000057
1412 Ga0496120_0000137
1413 Ga0496120_0000207
1414 Ga0496120_0000406
1415 Ga0496120_0000673
1416 Ga0496120_0000711
1417 Ga0496120_0001027
1418 Ga0496120_0001489
1419 Ga0496120_0002104
1420 Ga0496120_0002703
1421 Ga0496120_0002884
1422 Ga0496121_0000389
1423 Ga0496121_0001226
1424 Ga0496121_0001655
1425 Ga0496121_0002208
1426 Ga0496121_0003017
1427 Ga0496121_0003296
1428 Ga0496121_0004821
1429 Ga0496121_0005634
1430 Ga0496121_0008356
1431 Ga0496121_0011405
1432 Ga0496121_0058635
1433 Ga0496122_0000003
1434 Ga0496122_0000007
1435 Ga0496122_0000088
1436 Ga0496122_0001843
1437 Ga0496122_0002182
1438 Ga0496122_0002922
1439 Ga0496122_0003024
1440 Ga0496122_0003212
1441 Ga0496122_0003434
1442 Ga0496122_0003484
1443 Ga0496122_0004956
1444 Ga0496122_0005161
1445 Ga0496122_0023005
1446 Ga0496122_0074389
1447 Ga0496122_0082854
1448 Ga0496123_0000004
1449 Ga0496123_0000012
1450 Ga0496123_0000139
1451 Ga0496123_0001504
1452 Ga0496123_0001770
1453 Ga0496123_0002717
1454 Ga0496123_0003304
1455 Ga0496123_0003928
1456 Ga0496123_0006718
1457 Ga0496123_0014520
1458 Ga0496123_0069160
1459 Ga0496124_0000017
1460 Ga0496124_0000025
1461 Ga0496124_0000045
1462 Ga0496124_0000368
1463 Ga0496124_0000484
1464 Ga0496124_0000620
1465 Ga0496124_0001484
1466 Ga0496124_0001931
1467 Ga0496124_0004039
1468 Ga0496124_0004060
1469 Ga0496124_0005302
1470 Ga0496124_0006843
1471 Ga0496124_0008449
1472 Ga0496124_0009313
1473 Ga0496124_0034182
1474 Ga0496124_0079461
1475 Ga0496125_0000013
1476 Ga0496125_0000065
1477 Ga0496125_0000728
1478 Ga0496125_0001229
1479 Ga0496125_0001911
1480 Ga0496125_0001991
1481 Ga0496125_0004865
1482 Ga0496125_0007236
1483 Ga0496125_0022076
1484 Ga0496125_0070815
1485 Ga0496125_0113723
1486 Ga0496126_0000865
1487 Ga0496126_0001727
1488 Ga0496126_0002119
1489 Ga0496126_0002405
1490 Ga0496126_0004050
1491 Ga0496126_0005402
1492 Ga0496126_0013484
1493 Ga0496126_0013750
1494 Ga0496126_0042116
1495 Ga0496126_0096786
1496 Ga0496126_0100424
1497 Ga0501306_000570
1498 Ga0501309_000677
1499 Ga0501305_003117
1500 Ga0495678_000777
1501 Ga0495682_0000001
1502 Ga0501312_002553
1503 Ga0501312_006488
1504 Ga0501316_002315
1505 Ga0501335_002418
1506 Ga0501031_0037347
1507 Ga0501033_0010131
1508 Ga0501034_0002371
1509 Ga0501034_0065414
1510 Ga0501034_0191312
1511 Ga0501036_0006154
1512 Ga0501036_0018299
1513 Ga0501038_0009093
1514 Ga0501040_0003798
1515 Ga0501042_0004170
1516 Ga0501042_0012426
1517 Ga0501043_0001906
1518 Ga0501047_0004030
1519 Ga0501048_0021270
1520 Ga0501048_0099152
1521 Ga0501071_0015764
1522 Ga0501072_0029589
1523 Ga0501074_0000975
1524 Ga0501074_0002363
1525 Ga0501075_0135783
1526 Ga0501077_0084641
1527 Ga0501208_007007
1528 Ga0501217_002322
1529 Ga0501081_0076057
1530 Ga0501083_0036383
1531 nmdc:mga00v17_27254_c1
1532 nmdc:mga0yw44_46769_c1
1533 Ga0500621_000002
1534 Ga0501084_0041452
1535 Ga0587070_000683
1536 Ga0587079_004153
1537 Ga0501082_0015040
1538 2728532475
1539 2506577637
1540 2506582775
1541 2508851572
1542 2511379904
1543 2511434759
1544 2511700177
1545 2512734762
1546 2524006727
1547 2524186486
1548 2524190970
1549 2538427431
1550 2540607322
1551 2545556859
1552 2547697174
1553 2548649647
1554 2550900507
1555 2555261286
1556 2555467569
1557 2562463330
1558 2563927045
1559 2563929288
1560 2566993980
1561 2571533549
1562 2573038021
1563 2578931110
1564 2580930488
1565 2585829855
1566 2585835015
1567 2587737934
1568 2587743737
1569 2590611802
1570 2595088022
1571 2595316615
1572 2599411442
1573 2599926354
1574 2601524439
1575 2601529593
1576 2601534814
1577 2601539557
1578 2601616427
1579 2601621149
1580 2601638668
1581 2601641862
1582 2601649546
1583 2601654473
1584 2601659895
1585 2601665920
1586 2601698777
1587 2601701605
1588 2601707217
1589 2601711831
1590 2601717734
1591 2601719669
1592 2601727662
1593 2601732273
1594 2601739496
1595 2601741492
1596 2601752254
1597 2601757907
1598 2601764265
1599 2602019095
1600 2603637081
1601 2603645036
1602 2603661361
1603 2603664315
1604 2603699160
1605 2603705175
1606 2603840088
1607 2603845165
1608 2603849830
1609 2603855306
1610 2603868774
1611 2603872887
1612 2603876658
1613 2606049656
1614 2606068745
1615 2606147750
1616 2606177545
1617 2608669894
1618 2609909853
1619 2621274931
1620 2631984442
1621 2637224263
1622 2643735519
1623 2643738110
1624 2644422972
1625 2644740738
1626 2650897101
1627 2651531945
1628 2656278681
1629 2671101324
1630 2671108739
1631 2671585545
1632 2672336854
1633 2673820885
1634 2674419014
1635 2676405668
1636 2681996411
1637 2682006240
1638 2686354009
1639 2686997393
1640 2687498703
1641 2689444127
1642 2695628154
1643 2712469423
1644 2717916138
1645 2723604845
1646 2730135482
1647 2738890151
1648 2739239501
1649 2739267941
1650 2753809715
1651 2753856726
1652 2757566000
1653 2765589820
1654 2772438155
1655 2775539755
1656 2777020765
1657 2777762229
1658 2791922023
1659 2792310359
1660 2793184584
1661 2793404935
1662 2802437100
1663 2807176500
1664 2808901384
1665 2809055998
1666 2809125562
1667 2812316586
1668 2813728091
1669 2814695643
1670 2816862686
1671 2817480676
1672 2819565263
1673 2819569166
1674 2819670353
1675 2819673610
1676 2819723650
1677 2821112011
1678 2821114592
1679 2821120840
1680 2823375474
1681 2823528569
1682 2831908025
1683 2842684391
1684 2842891766
1685 2844528987
1686 2846542110
1687 2847086786
1688 2847799135
1689 2849144358
1690 2852107593
1691 2855199390
1692 2857454566
1693 2857457147
1694 2857473139
1695 2857582421
1696 2857587168
1697 2857608584
1698 2857610251
1699 2857610874
1700 2858439760
1701 2858470187
1702 2860840009
1703 2864737936
1704 2864739032
1705 2865000148
1706 2865004176
1707 2865017437
1708 2869553486
1709 2871275380
1710 2871286594
1711 2876602919
1712 2877771058
1713 2880171923
1714 2881610213
1715 2881641109
1716 2884088137
1717 2885527642
1718 2888368174
1719 2888374215
1720 2888582713
1721 2888583106
1722 2889046247
1723 2889046738
1724 2889055081
1725 2889280756
1726 2889296271
1727 2889301920
1728 2891672151
1729 2897112133
1730 2900055667
1731 2904114865
1732 2904163295
1733 2904163725
1734 2904466933
1735 2904475565
1736 2904481536
1737 2904493150
1738 2904493559
1739 2904507966
1740 2904515581
1741 2904539480
1742 2904562013
1743 2904598452
1744 2904760218
1745 2907205711
1746 2907206273
1747 2908668227
1748 2908672271
1749 2919095996
1750 2919111256
1751 2919151734
1752 2919162439
1753 2919162724
1754 2919417298
1755 2919426985
1756 2919427274
1757 2919728285
1758 2922555442
1759 2923635641
1760 2925332481
1761 2927144403
1762 2927833391
1763 2928512210
1764 2928513585
1765 2928519851
1766 2929210490
1767 2931389696
1768 2931390186
1769 2932408394
1770 2935625963
1771 2936341867
1772 2937542644
1773 2937969900
1774 2938649829
1775 2938917510
1776 2939569842
1777 2939577858
1778 2939580055
1779 2939606954
1780 2939608879
1781 2939618282
1782 2939643154
1783 2939679792
1784 2939680887
1785 2939706696
1786 2939747071
1787 2945877060
1788 2945952369
1789 2945991613
1790 2945997585
1791 2946053799
1792 2946054325
1793 2954773913
1794 2956899071
1795 2956900368
1796 2962293282
1797 2964328820
1798 2964378490
1799 2965766869
1800 2968561215
1801 2969081303
1802 2969139294
1803 2969143506
1804 2969767261
1805 2969773427
1806 2971405724
1807 2971416285
1808 2971417189
1809 2971515626
1810 2971822727
1811 2971895705
1812 2974311311
1813 2974439071
1814 2978978856
1815 2980125673
1816 2980180129
1817 2980184531
1818 2980495048
1819 2981288015
1820 2981292271
1821 2981983634
1822 2981988328
1823 2984497370
1824 2984530281
1825 2984536390
1826 2984563766
1827 2984596499
1828 2988229393
1829 2990261321
1830 2996639012
1831 3000378585
1832 3001895335
1833 3006831361
1834 3006861022
1835 3006881518
1836 3006981674
1837 640937140
1838 648170887
1839 8002322259
1840 8004597530
1841 8007373238
1842 8015397720
1843 8016735218
1844 8018223944
1845 8018409449
1846 8019501302
1847 8019505381
1848 8022631799
1849 8022654174
1850 8022796402
1851 8022954057
1852 8023439654
1853 8023447532
1854 8046997710
1855 8051955369
1856 8052178137
1857 8054281346
1858 8054467901
1859 8054795793
1860 8054846431
1861 8054851753
1862 8055088011
1863 8055095297
1864 8055098406
1865 8055635060
1866 8055696694
1867 8056539896
1868 8056540378
1869 8057307005
1870 8057473813
1871 8057476263
1872 8057587574
1873 8057737687
1874 8057980395

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

265

554

1

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

92

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9919 2 469
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9918 2 468
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9898 2 469
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9897 2 468
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9846 3 468
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.994 2 180 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.99 5 183 3.40.50.720
af_P41572_182_434_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9895 182 434 1.10.1040.10
1pgpA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.989 182 434 1.10.1040.10
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9885 2 180 3.40.50.720
ID Description Score Start End GO Terms
AF-Q79DY2-F1-model_v4 Gnd(745) gene encoding 6-phosphogluconate dehydrogenase, 5' end 1.004 1 124 GO:0004616
GO:0050661
AF-Q93CH7-F1-model_v4 6-phosphogluconate dehydrogenase 1.004 1 84 GO:0004616
GO:0050661
AF-A0A484ZTS4-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 1.001 2 132 GO:0004616
GO:0016020
GO:0050661
AF-E1J879-F1-model_v4 deleted 0.9986 1 154
AF-A0A447V0C9-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 0.9971 1 469 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661

Map