F486238

General Info

Members Datasets Scaffolds Average Seq Length
938 364 1876 138

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070364|Ga0065704_100703643
Length 159
Sequence MLRPALQFLPKPLALPAPALKCGAMRSLDDIREEYEFLDGDERYRLLIELGRELDEMPDALKTDATRVRGCSASVWVYPAAKDDGTLHFLADSNAAITKGIVALVIAAVQDRPAREVAETDIAAALEPFELRKQLSSNRTQGVPNMIALIRETAARYAD

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
322 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
323 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
334 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
338 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
341 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
342 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
343 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
346 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
347 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
348 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
349 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
350 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
351 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
352 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
353 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
354 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
355 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
356 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
357 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
358 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
359 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
360 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
361 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
362 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
363 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
364 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 12.05
Nodule 0.53
Rhizoplane 4.16
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10070364 3300005289 Bacteria 29548
2 SwRhRL2b_contig_1406535 2162886007 Bacteria 6769
3 SwRhRL2b_contig_3703961 2162886007 Bacteria 12985
4 ARcpr5yngRDRAFT_c002434 3300000043 Bacteria 1933
5 JGI24736J21556_1053072 3300001904 Bacteria 625
6 JGI24752J21851_1000535 3300001976 Bacteria 5053
7 JGI24740J21852_10006386 3300001979 Bacteria 4887
8 JGI24739J22299_10000378 3300001989 Bacteria 15359
9 JGI24739J22299_10002487 3300001989 Bacteria 7113
10 JGI24739J22299_10030758 3300001989 Bacteria 1860
11 JGI24737J22298_10000438 3300001990 Bacteria 14246
12 JGI24737J22298_10001931 3300001990 Bacteria 7414
13 JGI24737J22298_10034699 3300001990 Bacteria 1564
14 JGI24738J21930_10003426 3300002075 Bacteria 4002
15 JGI24738J21930_10012231 3300002075 Bacteria 1875
16 JGI24034J26672_10062163 3300002239 Bacteria 657
17 JGI24751J29686_10000388 3300002459 Bacteria 14720
18 Ga0055537_1002075 3300003773 Bacteria 7055
19 Ga0055524_1000654 3300003775 Bacteria 24493
20 Ga0055536_1002435 3300003781 Bacteria 10457
21 Ga0055536_1008890 3300003781 Bacteria 4242
22 Ga0055534_1026657 3300003784 Bacteria 917
23 Ga0055534_1028314 3300003784 Bacteria 879
24 Ga0055528_1034380 3300003790 Bacteria 1250
25 Ga0055530_10000522 3300003791 Bacteria 33291
26 Ga0055531_10004791 3300003794 Bacteria 8082
27 Ga0055531_10017316 3300003794 Bacteria 3050
28 Ga0065165_1004978 3300005262 Bacteria 7794
29 Ga0065165_1007901 3300005262 Bacteria 5102
30 Ga0065704_10076703 3300005289 Bacteria 5010
31 Ga0065704_10092310 3300005289 Bacteria 2662
32 Ga0065712_10158463 3300005290 Bacteria 1319
33 Ga0065712_10288054 3300005290 Bacteria 883
34 Ga0065707_10081738 3300005295 Bacteria 54410
35 Ga0065707_10119699 3300005295 Bacteria 2153
36 Ga0065707_10245569 3300005295 Bacteria 1141
37 Ga0070658_10003538 3300005327 Bacteria 12823
38 Ga0070658_10004563 3300005327 Bacteria 11255
39 Ga0070658_10005934 3300005327 Bacteria 9911
40 Ga0070676_10005815 3300005328 Bacteria 6575
41 Ga0070683_100005945 3300005329 Bacteria 10211
42 Ga0070690_100643257 3300005330 Bacteria 809
43 Ga0070690_101170409 3300005330 Bacteria 612
44 Ga0070670_100000168 3300005331 Bacteria 59111
45 Ga0070670_100000340 3300005331 Bacteria 39096
46 Ga0070670_100034717 3300005331 Bacteria 4340
47 Ga0070670_100061834 3300005331 Bacteria 3214
48 Ga0070670_100273001 3300005331 Bacteria 1476
49 Ga0070677_10000460 3300005333 Bacteria 13951
50 Ga0070677_10457904 3300005333 Bacteria 684
51 Ga0068869_100000736 3300005334 Bacteria 18613
52 Ga0068869_100054511 3300005334 Bacteria 2911
53 Ga0070666_10000380 3300005335 Bacteria 27930
54 Ga0070666_10060890 3300005335 Bacteria 2555
55 Ga0070666_10346367 3300005335 Bacteria 1063
56 Ga0070680_100651464 3300005336 Bacteria 905
57 Ga0070682_100098702 3300005337 Bacteria 1924
58 Ga0068868_100006361 3300005338 Bacteria 8354
59 Ga0070660_100000061 3300005339 Bacteria 63766
60 Ga0070660_100000560 3300005339 Bacteria 24966
61 Ga0070660_100050689 3300005339 Bacteria 3194
62 Ga0070660_100323789 3300005339 Bacteria 1267
63 Ga0070689_100075351 3300005340 Bacteria 2642
64 Ga0070689_100613862 3300005340 Bacteria 943
65 Ga0070687_100203935 3300005343 Bacteria 1200
66 Ga0070687_101223316 3300005343 Bacteria 555
67 Ga0070661_100000075 3300005344 Bacteria 79164
68 Ga0070661_100080858 3300005344 Bacteria 2398
69 Ga0070661_100181140 3300005344 Bacteria 1603
70 Ga0070661_100335319 3300005344 Unclassified 1184
71 Ga0070661_100511561 3300005344 Bacteria 962
72 Ga0070692_10015367 3300005345 Bacteria 3621
73 Ga0070692_10236840 3300005345 Bacteria 1086
74 Ga0070692_10875241 3300005345 Bacteria 619
75 Ga0070668_100001470 3300005347 Bacteria 17008
76 Ga0070668_100005494 3300005347 Bacteria 9398
77 Ga0070668_100027478 3300005347 Bacteria 4320
78 Ga0070668_100599030 3300005347 Bacteria 964
79 Ga0070669_100000013 3300005353 Bacteria 210577
80 Ga0070669_100000270 3300005353 Bacteria 42327
81 Ga0070669_100000565 3300005353 Bacteria 27565
82 Ga0070669_100002327 3300005353 Bacteria 13743
83 Ga0070669_100004540 3300005353 Bacteria 10022
84 Ga0070669_100071233 3300005353 Bacteria 2571
85 Ga0070669_100115681 3300005353 Bacteria 2040
86 Ga0070669_100894534 3300005353 Bacteria 758
87 Ga0070671_100000116 3300005355 Bacteria 51559
88 Ga0070671_100018850 3300005355 Bacteria 5609
89 Ga0070671_100031625 3300005355 Bacteria 4373
90 Ga0070671_100049808 3300005355 Bacteria 3485
91 Ga0070671_100062925 3300005355 Bacteria 3089
92 Ga0070671_100136987 3300005355 Bacteria 2064
93 Ga0070671_100158643 3300005355 Bacteria 1912
94 Ga0070671_100531558 3300005355 Bacteria 1013
95 Ga0070674_100011953 3300005356 Bacteria 5310
96 Ga0070673_100010306 3300005364 Bacteria 6321
97 Ga0070673_100084376 3300005364 Bacteria 2583
98 Ga0070659_100004211 3300005366 Bacteria 10269
99 Ga0070659_100004345 3300005366 Bacteria 10118
100 Ga0070667_100000290 3300005367 Bacteria 56841
101 Ga0070667_100000968 3300005367 Bacteria 26399
102 Ga0070667_100001907 3300005367 Bacteria 18505
103 Ga0070667_100002091 3300005367 Bacteria 17620
104 Ga0070667_100013168 3300005367 Bacteria 6837
105 Ga0070667_100017180 3300005367 Bacteria 5993
106 Ga0070667_100083429 3300005367 Bacteria 2737
107 Ga0070667_100091190 3300005367 Bacteria 2620
108 Ga0070667_100125790 3300005367 Bacteria 2234
109 Ga0070667_100155986 3300005367 Bacteria 2008
110 Ga0070705_100026577 3300005440 Bacteria 3151
111 Ga0070705_100161075 3300005440 Bacteria 1500
112 Ga0070705_100178167 3300005440 Bacteria 1437
113 Ga0070663_100004025 3300005455 Bacteria 8576
114 Ga0070663_100040950 3300005455 Bacteria 3246
115 Ga0070663_100068831 3300005455 Bacteria 2570
116 Ga0070663_100160610 3300005455 Bacteria 1729
117 Ga0070663_100361851 3300005455 Bacteria 1177
118 Ga0070678_100922221 3300005456 Bacteria 799
119 Ga0070678_101597531 3300005456 Bacteria 612
120 Ga0070662_100003155 3300005457 Bacteria 10241
121 Ga0070662_100003479 3300005457 Bacteria 9817
122 Ga0070681_10599326 3300005458 Bacteria 1016
123 Ga0068867_100008041 3300005459 Bacteria 7453
124 Ga0070685_10265149 3300005466 Bacteria 1144
125 Ga0070707_100126344 3300005468 Bacteria 2485
126 Ga0070679_101463737 3300005530 Bacteria 630
127 Ga0070684_100097876 3300005535 Bacteria 2617
128 Ga0070684_101912474 3300005535 Bacteria 560
129 Ga0068853_100006609 3300005539 Bacteria 9230
130 Ga0068853_100032999 3300005539 Bacteria 4389
131 Ga0068853_102118200 3300005539 Bacteria 545
132 Ga0070672_100061279 3300005543 Bacteria 2965
133 Ga0070672_100558772 3300005543 Bacteria 994
134 Ga0070672_101043930 3300005543 Bacteria 725
135 Ga0070686_101126069 3300005544 Bacteria 649
136 Ga0070696_100040501 3300005546 Bacteria 3217
137 Ga0070693_100011908 3300005547 Bacteria 4389
138 Ga0070665_100001031 3300005548 Bacteria 34955
139 Ga0070665_100005836 3300005548 Bacteria 12629
140 Ga0070665_100015813 3300005548 Bacteria 7578
141 Ga0070665_100019518 3300005548 Bacteria 6806
142 Ga0070665_100027367 3300005548 Bacteria 5744
143 Ga0070665_100176304 3300005548 Bacteria 2139
144 Ga0068855_100000480 3300005563 Bacteria 49187
145 Ga0068855_100002720 3300005563 Bacteria 21788
146 Ga0068855_100010731 3300005563 Bacteria 11054
147 Ga0068855_100154599 3300005563 Bacteria 2607
148 Ga0068855_100169820 3300005563 Bacteria 2471
149 Ga0068855_100396531 3300005563 Bacteria 1513
150 Ga0070664_100004841 3300005564 Bacteria 10784
151 Ga0070664_100126949 3300005564 Bacteria 2238
152 Ga0070664_100283199 3300005564 Bacteria 1495
153 Ga0070664_100917863 3300005564 Bacteria 821
154 Ga0068857_100011311 3300005577 Bacteria 7764
155 Ga0068857_100068787 3300005577 Bacteria 3152
156 Ga0068857_100178585 3300005577 Bacteria 1932
157 Ga0068857_100188390 3300005577 Bacteria 1879
158 Ga0068857_100250219 3300005577 Bacteria 1624
159 Ga0068857_100290962 3300005577 Bacteria 1504
160 Ga0068854_100001621 3300005578 Bacteria 13690
161 Ga0068854_100020124 3300005578 Bacteria 4509
162 Ga0068854_100028696 3300005578 Bacteria 3847
163 Ga0068854_100070209 3300005578 Bacteria 2560
164 Ga0068854_100422727 3300005578 Bacteria 1107
165 Ga0068856_100000538 3300005614 Bacteria 41802
166 Ga0068856_100049729 3300005614 Bacteria 4132
167 Ga0068856_100059828 3300005614 Bacteria 3763
168 Ga0068856_100658421 3300005614 Bacteria 1068
169 Ga0068852_100000117 3300005616 Bacteria 53907
170 Ga0068852_100001259 3300005616 Bacteria 16883
171 Ga0068852_100072095 3300005616 Bacteria 3035
172 Ga0068852_101048393 3300005616 Bacteria 835
173 Ga0068859_100000390 3300005617 Bacteria 43803
174 Ga0068859_100028682 3300005617 Bacteria 5581
175 Ga0068859_100060129 3300005617 Bacteria 3829
176 Ga0068859_100071713 3300005617 Bacteria 3500
177 Ga0068859_100106828 3300005617 Bacteria 2858
178 Ga0068859_100189251 3300005617 Bacteria 2142
179 Ga0068864_100000063 3300005618 Bacteria 119845
180 Ga0068864_100001241 3300005618 Bacteria 21225
181 Ga0068864_100001790 3300005618 Bacteria 17627
182 Ga0068864_100179807 3300005618 Bacteria 1933
183 Ga0068864_100274952 3300005618 Bacteria 1570
184 Ga0068864_100291310 3300005618 Bacteria 1526
185 Ga0068861_100000026 3300005719 Bacteria 69553
186 Ga0068861_100109047 3300005719 Bacteria 2215
187 Ga0068861_100561436 3300005719 Bacteria 1042
188 Ga0068861_100627333 3300005719 Bacteria 990
189 Ga0068851_10033091 3300005834 Bacteria 2575
190 Ga0068851_10078667 3300005834 Bacteria 1718
191 Ga0068851_10341629 3300005834 Bacteria 869
192 Ga0068870_10082254 3300005840 Bacteria 1783
193 Ga0068870_11217787 3300005840 Bacteria 546
194 Ga0068863_100000062 3300005841 Bacteria 119845
195 Ga0068863_100006362 3300005841 Bacteria 11582
196 Ga0068863_100008110 3300005841 Bacteria 10251
197 Ga0068863_100046312 3300005841 Bacteria 4127
198 Ga0068863_100403611 3300005841 Bacteria 1337
199 Ga0068858_100000713 3300005842 Bacteria 34726
200 Ga0068858_100001247 3300005842 Bacteria 26301
201 Ga0068858_100001777 3300005842 Bacteria 21988
202 Ga0068858_100026353 3300005842 Bacteria 5403
203 Ga0068858_100043444 3300005842 Bacteria 4167
204 Ga0068858_100057071 3300005842 Bacteria 3608
205 Ga0068858_100104177 3300005842 Bacteria 2647
206 Ga0068858_100157761 3300005842 Bacteria 2135
207 Ga0068858_100391700 3300005842 Bacteria 1334
208 Ga0068858_101877700 3300005842 Bacteria 592
209 Ga0068860_100000386 3300005843 Bacteria 57855
210 Ga0068860_100003383 3300005843 Bacteria 16406
211 Ga0068860_100009605 3300005843 Bacteria 9613
212 Ga0068860_100032878 3300005843 Bacteria 4982
213 Ga0068860_100033307 3300005843 Bacteria 4945
214 Ga0068860_100074959 3300005843 Bacteria 3218
215 Ga0068860_100228223 3300005843 Bacteria 1809
216 Ga0068860_100582217 3300005843 Bacteria 1123
217 Ga0068860_100652764 3300005843 Bacteria 1060
218 Ga0068862_100000069 3300005844 Bacteria 122535
219 Ga0068862_100000560 3300005844 Bacteria 38687
220 Ga0068862_100022890 3300005844 Bacteria 5231
221 Ga0068862_100100800 3300005844 Bacteria 2525
222 Ga0068862_100105647 3300005844 Bacteria 2468
223 Ga0068862_101142259 3300005844 Bacteria 775
224 Ga0081539_10405381 3300005985 Bacteria 567
225 Ga0075363_100000864 3300006048 Bacteria 10611
226 Ga0075364_10006189 3300006051 Bacteria 7013
227 Ga0075364_10140699 3300006051 Bacteria 1623
228 Ga0075364_10319801 3300006051 Bacteria 1057
229 Ga0075362_10000003 3300006177 Bacteria 171099
230 Ga0075362_10034915 3300006177 Bacteria 2194
231 Ga0075367_10582484 3300006178 Bacteria 711
232 Ga0075369_10005083 3300006186 Bacteria 4906
233 Ga0075369_10029336 3300006186 Bacteria 2310
234 Ga0075369_10607114 3300006186 Bacteria 524
235 Ga0075366_10000006 3300006195 Bacteria 106522
236 Ga0075366_10003942 3300006195 Bacteria 7917
237 Ga0075366_10058083 3300006195 Bacteria 2298
238 Ga0075366_10715764 3300006195 Bacteria 622
239 Ga0075366_10870028 3300006195 Bacteria 561
240 Ga0097621_100185722 3300006237 Bacteria 1798
241 Ga0097621_101942584 3300006237 Bacteria 562
242 Ga0075370_10000008 3300006353 Bacteria 97966
243 Ga0075370_10055793 3300006353 Bacteria 2244
244 Ga0075370_10062887 3300006353 Bacteria 2115
245 Ga0075370_10083223 3300006353 Bacteria 1841
246 Ga0075370_10471773 3300006353 Bacteria 756
247 Ga0068871_100067451 3300006358 Bacteria 2935
248 Ga0068865_100047978 3300006881 Bacteria 2938
249 Ga0068865_100083717 3300006881 Bacteria 2296
250 Ga0097620_100000390 3300006931 Bacteria 43803
251 Ga0097620_100028682 3300006931 Bacteria 5581
252 Ga0097620_100060129 3300006931 Bacteria 3829
253 Ga0097620_100071712 3300006931 Bacteria 3500
254 Ga0097620_100106825 3300006931 Bacteria 2858
255 Ga0097620_100189261 3300006931 Bacteria 2142
256 Ga0079104_1024009 3300006946 Bacteria 1612
257 Ga0079104_1057170 3300006946 Bacteria 851
258 Ga0079104_1079198 3300006946 Bacteria 678
259 Ga0075435_100726874 3300007076 Bacteria 863
260 Ga0105251_10001526 3300009011 Bacteria 19872
261 Ga0105251_10003021 3300009011 Bacteria 12550
262 Ga0105251_10009342 3300009011 Bacteria 5798
263 Ga0105251_10113933 3300009011 Bacteria 1230
264 Ga0105250_10143007 3300009092 Bacteria 992
265 Ga0105250_10183843 3300009092 Bacteria 878
266 Ga0105240_10007704 3300009093 Bacteria 15580
267 Ga0105240_10063792 3300009093 Bacteria 4581
268 Ga0105240_10540999 3300009093 Bacteria 1290
269 Ga0105245_10000782 3300009098 Bacteria 28837
270 Ga0105247_10007366 3300009101 Bacteria 6760
271 Ga0105247_10058521 3300009101 Bacteria 2384
272 Ga0105243_10042556 3300009148 Bacteria 3556
273 Ga0105243_10124096 3300009148 Bacteria 2182
274 Ga0105243_10975884 3300009148 Bacteria 848
275 Ga0105241_10250298 3300009174 Bacteria 1502
276 Ga0105241_12191896 3300009174 Bacteria 548
277 Ga0105248_10000443 3300009177 Bacteria 47083
278 Ga0105248_10000536 3300009177 Bacteria 43208
279 Ga0105248_10003369 3300009177 Bacteria 17753
280 Ga0105248_10028337 3300009177 Bacteria 6240
281 Ga0105248_10047856 3300009177 Bacteria 4796
282 Ga0105248_10255746 3300009177 Bacteria 1972
283 Ga0105248_10366421 3300009177 Bacteria 1622
284 Ga0105237_11492110 3300009545 Bacteria 683
285 Ga0105238_10079835 3300009551 Bacteria 3261
286 Ga0105238_10235939 3300009551 Bacteria 1806
287 Ga0105249_10000160 3300009553 Bacteria 81883
288 Ga0105249_10000355 3300009553 Bacteria 45955
289 Ga0105249_10031761 3300009553 Bacteria 4777
290 Ga0105249_10034168 3300009553 Bacteria 4605
291 Ga0105249_10074343 3300009553 Bacteria 3145
292 Ga0105249_10101821 3300009553 Bacteria 2702
293 Ga0105239_10020946 3300010375 Bacteria 7213
294 Ga0105239_11431141 3300010375 Bacteria 798
295 Ga0105246_10007706 3300011119 Bacteria 6605
296 Ga0157326_1000245 3300012513 Bacteria 6347
297 Ga0157373_10155054 3300013100 Bacteria 1611
298 Ga0157373_10222602 3300013100 Unclassified 1331
299 Ga0157371_10000458 3300013102 Bacteria 50035
300 Ga0157371_10008659 3300013102 Bacteria 8083
301 Ga0157371_10013469 3300013102 Bacteria 6208
302 Ga0157371_10055053 3300013102 Bacteria 2823
303 Ga0157370_10005413 3300013104 Bacteria 14323
304 Ga0157370_10054922 3300013104 Bacteria 3796
305 Ga0157370_10124747 3300013104 Bacteria 2404
306 Ga0157369_10012733 3300013105 Bacteria 9537
307 Ga0157369_10113197 3300013105 Bacteria 2883
308 Ga0157369_10750459 3300013105 Bacteria 1004
309 Ga0157374_10121558 3300013296 Bacteria 2521
310 Ga0157374_11342174 3300013296 Bacteria 737
311 Ga0157378_10049574 3300013297 Bacteria 3735
312 Ga0157378_10143383 3300013297 Bacteria 2220
313 Ga0157378_10668599 3300013297 Bacteria 1056
314 Ga0163162_10008854 3300013306 Bacteria 9785
315 Ga0163162_10042347 3300013306 Bacteria 4557
316 Ga0163162_10042864 3300013306 Bacteria 4530
317 Ga0163162_10114319 3300013306 Bacteria 2798
318 Ga0163162_10122097 3300013306 Bacteria 2710
319 Ga0157372_10696870 3300013307 Bacteria 1182
320 Ga0157372_10880398 3300013307 Bacteria 1039
321 Ga0157372_13072220 3300013307 Bacteria 533
322 Ga0157375_10115316 3300013308 Bacteria 2789
323 Ga0163163_10000058 3300014325 Bacteria 123478
324 Ga0163163_10079077 3300014325 Bacteria 3286
325 Ga0163163_10331161 3300014325 Bacteria 1577
326 Ga0163163_10348097 3300014325 Bacteria 1537
327 Ga0163163_11156113 3300014325 Bacteria 837
328 Ga0163163_11194356 3300014325 Bacteria 823
329 Ga0157380_10000338 3300014326 Bacteria 27963
330 Ga0157380_10146890 3300014326 Bacteria 2033
331 Ga0157380_10524023 3300014326 Bacteria 1156
332 Ga0157377_10072623 3300014745 Bacteria 1992
333 Ga0157379_10009670 3300014968 Bacteria 8392
334 Ga0157379_10015929 3300014968 Bacteria 6608
335 Ga0157379_10069392 3300014968 Bacteria 3152
336 Ga0157376_11278812 3300014969 Bacteria 763
337 Ga0163161_10001269 3300017792 Bacteria 18855
338 Ga0163161_10087437 3300017792 Bacteria 2302
339 Ga0163161_10539498 3300017792 Bacteria 955
340 Ga0163161_10723031 3300017792 Bacteria 831
341 Ga0207425_1005665 3300025245 Bacteria 3525
342 Ga0209565_1000008 3300025263 Bacteria 774179
343 Ga0209565_1042448 3300025263 Bacteria 843
344 Ga0209673_1001996 3300025273 Bacteria 15785
345 Ga0209675_1001006 3300025291 Bacteria 17716
346 Ga0209675_1006218 3300025291 Bacteria 4836
347 Ga0209676_1000557 3300025292 Bacteria 56440
348 Ga0209676_1002559 3300025292 Bacteria 12585
349 Ga0209676_1015956 3300025292 Bacteria 2739
350 Ga0209025_1006073 3300025294 Bacteria 9549
351 Ga0209025_1059735 3300025294 Bacteria 1436
352 Ga0209050_1000017 3300025298 Bacteria 728928
353 Ga0209050_1013704 3300025298 Bacteria 3572
354 Ga0209256_1000009 3300025299 Bacteria 922071
355 Ga0209256_1000010 3300025299 Bacteria 912110
356 Ga0209257_1001118 3300025304 Bacteria 34674
357 Ga0209257_1001176 3300025304 Bacteria 33109
358 Ga0209257_1001491 3300025304 Bacteria 27480
359 Ga0209257_1001719 3300025304 Bacteria 24483
360 Ga0209257_1054400 3300025304 Bacteria 1114
361 Ga0207697_10001744 3300025315 Bacteria 11683
362 Ga0207697_10003187 3300025315 Bacteria 8160
363 Ga0207697_10040420 3300025315 Bacteria 1915
364 Ga0207697_10253506 3300025315 Bacteria 778
365 Ga0207656_10014271 3300025321 Bacteria 3056
366 Ga0207656_10203038 3300025321 Bacteria 958
367 Ga0207656_10397706 3300025321 Bacteria 692
368 Ga0207713_1002174 3300025735 Bacteria 14541
369 Ga0207713_1008296 3300025735 Bacteria 6000
370 Ga0207713_1012977 3300025735 Bacteria 4422
371 Ga0207682_10000990 3300025893 Bacteria 13121
372 Ga0207682_10409320 3300025893 Bacteria 641
373 Ga0207642_10204205 3300025899 Bacteria 1093
374 Ga0207642_11004320 3300025899 Bacteria 537
375 Ga0207710_10012829 3300025900 Bacteria 3529
376 Ga0207710_10100506 3300025900 Bacteria 1363
377 Ga0207710_10114879 3300025900 Bacteria 1281
378 Ga0207688_10026749 3300025901 Bacteria 3174
379 Ga0207688_10494475 3300025901 Bacteria 765
380 Ga0207680_10000480 3300025903 Bacteria 18917
381 Ga0207680_10020210 3300025903 Bacteria 3578
382 Ga0207680_10106591 3300025903 Bacteria 1810
383 Ga0207680_10109442 3300025903 Bacteria 1789
384 Ga0207647_10016767 3300025904 Bacteria 4991
385 Ga0207645_10015526 3300025907 Bacteria 5057
386 Ga0207645_10075336 3300025907 Bacteria 2160
387 Ga0207705_10000004 3300025909 Bacteria 705756
388 Ga0207705_10000131 3300025909 Bacteria 81639
389 Ga0207705_10002347 3300025909 Bacteria 14636
390 Ga0207705_10754070 3300025909 Bacteria 756
391 Ga0207654_10967562 3300025911 Bacteria 618
392 Ga0207654_11201855 3300025911 Bacteria 553
393 Ga0207695_10005830 3300025913 Bacteria 16198
394 Ga0207695_10015638 3300025913 Bacteria 8925
395 Ga0207695_10216217 3300025913 Bacteria 1825
396 Ga0207695_10278236 3300025913 Bacteria 1567
397 Ga0207695_10313200 3300025913 Bacteria 1459
398 Ga0207671_11472218 3300025914 Bacteria 526
399 Ga0207660_10517869 3300025917 Bacteria 968
400 Ga0207662_10095343 3300025918 Bacteria 1836
401 Ga0207662_10239122 3300025918 Bacteria 1188
402 Ga0207657_10000126 3300025919 Bacteria 76430
403 Ga0207657_10000181 3300025919 Bacteria 65099
404 Ga0207657_10281435 3300025919 Bacteria 1320
405 Ga0207649_10000937 3300025920 Bacteria 18258
406 Ga0207649_10117784 3300025920 Bacteria 1786
407 Ga0207649_10369724 3300025920 Bacteria 1066
408 Ga0207646_10499675 3300025922 Bacteria 1096
409 Ga0207681_10000008 3300025923 Bacteria 414329
410 Ga0207681_10000038 3300025923 Bacteria 153694
411 Ga0207681_10002968 3300025923 Bacteria 10674
412 Ga0207681_10010000 3300025923 Bacteria 5806
413 Ga0207681_10012300 3300025923 Bacteria 5278
414 Ga0207681_10024877 3300025923 Bacteria 3846
415 Ga0207681_10407023 3300025923 Bacteria 1100
416 Ga0207681_10566210 3300025923 Bacteria 936
417 Ga0207681_11001390 3300025923 Bacteria 701
418 Ga0207694_10160837 3300025924 Bacteria 1814
419 Ga0207694_10200744 3300025924 Bacteria 1622
420 Ga0207650_10006484 3300025925 Bacteria 7975
421 Ga0207650_10032491 3300025925 Bacteria 3775
422 Ga0207650_10037790 3300025925 Bacteria 3521
423 Ga0207650_10110967 3300025925 Bacteria 2123
424 Ga0207650_10203512 3300025925 Bacteria 1587
425 Ga0207650_10537563 3300025925 Bacteria 979
426 Ga0207650_11885168 3300025925 Bacteria 505
427 Ga0207687_10013795 3300025927 Bacteria 5278
428 Ga0207644_10000191 3300025931 Bacteria 43874
429 Ga0207644_10001603 3300025931 Bacteria 14603
430 Ga0207644_10004437 3300025931 Bacteria 9110
431 Ga0207644_10012689 3300025931 Bacteria 5601
432 Ga0207644_10105191 3300025931 Bacteria 2126
433 Ga0207644_10418068 3300025931 Bacteria 1098
434 Ga0207690_10000106 3300025932 Bacteria 67786
435 Ga0207690_10006739 3300025932 Bacteria 6808
436 Ga0207690_10131116 3300025932 Bacteria 1835
437 Ga0207690_10267028 3300025932 Bacteria 1328
438 Ga0207706_10000151 3300025933 Bacteria 76455
439 Ga0207706_10005896 3300025933 Bacteria 11395
440 Ga0207706_10152465 3300025933 Bacteria 2033
441 Ga0207706_10222113 3300025933 Bacteria 1654
442 Ga0207709_10030191 3300025935 Bacteria 3151
443 Ga0207709_10734474 3300025935 Bacteria 792
444 Ga0207670_10108350 3300025936 Bacteria 1997
445 Ga0207669_10006549 3300025937 Bacteria 5334
446 Ga0207704_10082467 3300025938 Bacteria 2083
447 Ga0207691_10007770 3300025940 Bacteria 10327
448 Ga0207691_10641108 3300025940 Bacteria 898
449 Ga0207691_10947811 3300025940 Bacteria 719
450 Ga0207711_10000017 3300025941 Bacteria 441730
451 Ga0207711_10001912 3300025941 Bacteria 18916
452 Ga0207711_10031022 3300025941 Bacteria 4510
453 Ga0207711_10032649 3300025941 Bacteria 4401
454 Ga0207711_10087303 3300025941 Bacteria 2737
455 Ga0207711_10770231 3300025941 Bacteria 897
456 Ga0207689_10000167 3300025942 Bacteria 57116
457 Ga0207689_10026962 3300025942 Bacteria 4810
458 Ga0207689_10038989 3300025942 Bacteria 3934
459 Ga0207689_10114392 3300025942 Bacteria 2218
460 Ga0207661_10006497 3300025944 Bacteria 8265
461 Ga0207679_10002382 3300025945 Bacteria 11568
462 Ga0207679_10243751 3300025945 Bacteria 1524
463 Ga0207679_10607754 3300025945 Bacteria 986
464 Ga0207667_10000586 3300025949 Bacteria 47384
465 Ga0207667_10002108 3300025949 Bacteria 24944
466 Ga0207667_10003563 3300025949 Bacteria 19243
467 Ga0207667_10070804 3300025949 Bacteria 3629
468 Ga0207667_10125942 3300025949 Bacteria 2638
469 Ga0207667_10138092 3300025949 Bacteria 2510
470 Ga0207651_10001801 3300025960 Bacteria 9965
471 Ga0207651_10074826 3300025960 Bacteria 2413
472 Ga0207712_10000222 3300025961 Bacteria 56073
473 Ga0207712_10001433 3300025961 Bacteria 16278
474 Ga0207712_10014035 3300025961 Bacteria 5142
475 Ga0207712_10026859 3300025961 Bacteria 3840
476 Ga0207712_10129989 3300025961 Bacteria 1917
477 Ga0207712_10375142 3300025961 Bacteria 1189
478 Ga0207668_10000487 3300025972 Bacteria 24894
479 Ga0207668_10003398 3300025972 Bacteria 9332
480 Ga0207668_10053614 3300025972 Bacteria 2795
481 Ga0207668_10071748 3300025972 Bacteria 2475
482 Ga0207640_10002555 3300025981 Bacteria 9753
483 Ga0207640_10015350 3300025981 Bacteria 4432
484 Ga0207640_10019097 3300025981 Bacteria 4043
485 Ga0207640_10025143 3300025981 Bacteria 3601
486 Ga0207640_10035980 3300025981 Bacteria 3104
487 Ga0207640_10147273 3300025981 Bacteria 1725
488 Ga0207640_11595081 3300025981 Bacteria 588
489 Ga0207658_10000133 3300025986 Bacteria 78402
490 Ga0207658_10000344 3300025986 Bacteria 46055
491 Ga0207658_10002000 3300025986 Bacteria 15211
492 Ga0207658_10002624 3300025986 Bacteria 13051
493 Ga0207658_10009484 3300025986 Bacteria 6605
494 Ga0207658_10247537 3300025986 Bacteria 1513
495 Ga0207658_10316648 3300025986 Bacteria 1349
496 Ga0207658_10482501 3300025986 Bacteria 1102
497 Ga0207658_11248043 3300025986 Bacteria 679
498 Ga0207677_10002698 3300026023 Bacteria 9360
499 Ga0207677_11478198 3300026023 Bacteria 627
500 Ga0207703_10000600 3300026035 Bacteria 36585
501 Ga0207703_10002947 3300026035 Bacteria 14448
502 Ga0207703_10004946 3300026035 Bacteria 10819
503 Ga0207703_10009186 3300026035 Bacteria 7778
504 Ga0207703_10013748 3300026035 Bacteria 6310
505 Ga0207703_10045860 3300026035 Bacteria 3517
506 Ga0207703_10393275 3300026035 Bacteria 1285
507 Ga0207703_10565543 3300026035 Bacteria 1073
508 Ga0207703_11663387 3300026035 Bacteria 614
509 Ga0207639_10000573 3300026041 Bacteria 25324
510 Ga0207639_10002893 3300026041 Bacteria 11542
511 Ga0207639_10216118 3300026041 Bacteria 1653
512 Ga0207678_10006756 3300026067 Bacteria 10174
513 Ga0207678_10010888 3300026067 Bacteria 7992
514 Ga0207678_10342903 3300026067 Bacteria 1288
515 Ga0207678_11229106 3300026067 Bacteria 663
516 Ga0207702_10001045 3300026078 Bacteria 28350
517 Ga0207702_10022777 3300026078 Bacteria 5196
518 Ga0207702_10070405 3300026078 Bacteria 3008
519 Ga0207702_10442956 3300026078 Bacteria 1259
520 Ga0207641_10000022 3300026088 Bacteria 279334
521 Ga0207641_10008748 3300026088 Bacteria 8364
522 Ga0207641_10011097 3300026088 Bacteria 7390
523 Ga0207641_10026721 3300026088 Bacteria 4765
524 Ga0207641_10080480 3300026088 Bacteria 2826
525 Ga0207641_10239071 3300026088 Bacteria 1691
526 Ga0207641_10824529 3300026088 Bacteria 918
527 Ga0207641_11156203 3300026088 Bacteria 773
528 Ga0207641_11210153 3300026088 Bacteria 755
529 Ga0207648_10001222 3300026089 Bacteria 28812
530 Ga0207676_10000056 3300026095 Bacteria 124484
531 Ga0207676_10000698 3300026095 Bacteria 26476
532 Ga0207676_10007892 3300026095 Bacteria 7571
533 Ga0207676_10016650 3300026095 Bacteria 5325
534 Ga0207676_10017345 3300026095 Bacteria 5217
535 Ga0207676_10047378 3300026095 Bacteria 3331
536 Ga0207676_10568396 3300026095 Bacteria 1085
537 Ga0207674_10002073 3300026116 Bacteria 25416
538 Ga0207674_10039134 3300026116 Bacteria 4917
539 Ga0207674_10072353 3300026116 Bacteria 3463
540 Ga0207674_10096441 3300026116 Bacteria 2942
541 Ga0207674_10117552 3300026116 Bacteria 2629
542 Ga0207674_10194949 3300026116 Bacteria 1975
543 Ga0207674_10276148 3300026116 Bacteria 1628
544 Ga0207674_10399476 3300026116 Bacteria 1328
545 Ga0207674_10415813 3300026116 Bacteria 1299
546 Ga0207674_10457039 3300026116 Bacteria 1234
547 Ga0207675_100000219 3300026118 Bacteria 53753
548 Ga0207675_100142165 3300026118 Bacteria 2280
549 Ga0207675_100204155 3300026118 Bacteria 1899
550 Ga0207675_100318808 3300026118 Bacteria 1517
551 Ga0207675_101118764 3300026118 Bacteria 807
552 Ga0207683_10135548 3300026121 Bacteria 2216
553 Ga0207698_10000019 3300026142 Bacteria 145910
554 Ga0207698_10002899 3300026142 Bacteria 10260
555 Ga0207698_10070698 3300026142 Bacteria 2766
556 Ga0207698_10142639 3300026142 Bacteria 2066
557 Ga0207698_10188675 3300026142 Bacteria 1834
558 Ga0209281_1014804 3300027111 Bacteria 1642
559 Ga0209281_1039265 3300027111 Bacteria 804
560 Ga0209982_1013472 3300027552 Bacteria 1232
561 Ga0209982_1022706 3300027552 Bacteria 969
562 Ga0209970_1010807 3300027614 Bacteria 1497
563 Ga0209971_1017836 3300027682 Bacteria 1683
564 Ga0209998_10186466 3300027717 Bacteria 540
565 Ga0209974_10004612 3300027876 Bacteria 4903
566 Ga0209974_10014620 3300027876 Bacteria 2610
567 Ga0209974_10312981 3300027876 Bacteria 603
568 Ga0268266_10000534 3300028379 Bacteria 53027
569 Ga0268266_10000950 3300028379 Bacteria 36937
570 Ga0268266_10005024 3300028379 Bacteria 12491
571 Ga0268266_10017332 3300028379 Bacteria 6147
572 Ga0268266_10227353 3300028379 Bacteria 1717
573 Ga0268266_10531242 3300028379 Bacteria 1125
574 Ga0268265_10000044 3300028380 Bacteria 182545
575 Ga0268265_10000171 3300028380 Bacteria 77721
576 Ga0268265_10009925 3300028380 Bacteria 6434
577 Ga0268265_10015150 3300028380 Bacteria 5269
578 Ga0268265_10161575 3300028380 Bacteria 1903
579 Ga0268265_10269548 3300028380 Bacteria 1518
580 Ga0268265_11703404 3300028380 Bacteria 636
581 Ga0268264_10000040 3300028381 Bacteria 373714
582 Ga0268264_10000221 3300028381 Bacteria 111397
583 Ga0268264_10002127 3300028381 Bacteria 17671
584 Ga0268264_10007794 3300028381 Bacteria 8916
585 Ga0268264_10065660 3300028381 Bacteria 3058
586 Ga0268264_10152292 3300028381 Bacteria 2075
587 Ga0268264_10274083 3300028381 Bacteria 1577
588 Ga0268264_10346882 3300028381 Bacteria 1412
589 Ga0268264_10782600 3300028381 Bacteria 952
590 Ga0265331_10065337 3300031250 Bacteria 1711
591 Ga0265327_10034617 3300031251 Bacteria 2801
592 Ga0307408_100012053 3300031548 Bacteria 5723
593 Ga0307408_100049901 3300031548 Bacteria 3007
594 Ga0307408_100190314 3300031548 Bacteria 1652
595 Ga0307516_10371135 3300031730 Bacteria 1094
596 Ga0307405_10000262 3300031731 Bacteria 19293
597 Ga0307405_10024668 3300031731 Bacteria 3440
598 Ga0307405_10048413 3300031731 Bacteria 2621
599 Ga0307405_10153163 3300031731 Bacteria 1624
600 Ga0307405_10243290 3300031731 Bacteria 1334
601 Ga0307405_10305156 3300031731 Bacteria 1209
602 Ga0307413_10007277 3300031824 Bacteria 5126
603 Ga0307410_10006176 3300031852 Bacteria 6434
604 Ga0307410_10025173 3300031852 Bacteria 3729
605 Ga0307410_10056655 3300031852 Bacteria 2666
606 Ga0307410_10193120 3300031852 Bacteria 1549
607 Ga0307406_10022270 3300031901 Bacteria 3757
608 Ga0307406_10069186 3300031901 Bacteria 2307
609 Ga0307406_10095665 3300031901 Bacteria 2010
610 Ga0307406_10698063 3300031901 Bacteria 847
611 Ga0307406_10816607 3300031901 Bacteria 788
612 Ga0307406_11221196 3300031901 Bacteria 653
613 Ga0307407_10084128 3300031903 Bacteria 1932
614 Ga0307407_10222348 3300031903 Bacteria 1277
615 Ga0307407_10730005 3300031903 Bacteria 748
616 Ga0307412_10001508 3300031911 Bacteria 12930
617 Ga0307412_10022421 3300031911 Bacteria 3870
618 Ga0307412_10076098 3300031911 Bacteria 2305
619 Ga0307412_10515572 3300031911 Bacteria 998
620 Ga0307412_10789314 3300031911 Bacteria 823
621 Ga0307409_100005979 3300031995 Bacteria 7092
622 Ga0307409_100045302 3300031995 Bacteria 3320
623 Ga0307409_101671372 3300031995 Bacteria 665
624 Ga0307409_102205409 3300031995 Bacteria 580
625 Ga0307416_100144168 3300032002 Bacteria 2171
626 Ga0307416_100157479 3300032002 Bacteria 2093
627 Ga0307416_100230719 3300032002 Bacteria 1784
628 Ga0307416_100463127 3300032002 Bacteria 1323
629 Ga0307416_102562940 3300032002 Bacteria 608
630 Ga0307414_10000705 3300032004 Bacteria 17072
631 Ga0307414_10017082 3300032004 Bacteria 4431
632 Ga0307414_10114396 3300032004 Bacteria 2061
633 Ga0307414_10119340 3300032004 Bacteria 2024
634 Ga0307414_10124929 3300032004 Bacteria 1986
635 Ga0307414_10181758 3300032004 Bacteria 1692
636 Ga0307414_10189567 3300032004 Bacteria 1662
637 Ga0307414_10206534 3300032004 Bacteria 1602
638 Ga0307414_10231185 3300032004 Bacteria 1525
639 Ga0307414_10436456 3300032004 Bacteria 1145
640 Ga0307411_10007342 3300032005 Bacteria 5604
641 Ga0307411_10059438 3300032005 Bacteria 2534
642 Ga0307411_10230647 3300032005 Bacteria 1443
643 Ga0307411_10337202 3300032005 Bacteria 1224
644 Ga0307411_10384891 3300032005 Bacteria 1155
645 Ga0307415_100031388 3300032126 Bacteria 3422
646 Ga0307415_100133080 3300032126 Bacteria 1886
647 Ga0307415_100351848 3300032126 Bacteria 1240
648 Ga0307415_100755663 3300032126 Bacteria 883
649 Ga0307510_10083885 3300033180 Bacteria 3073
650 Ga0373951_0058764 3300035091 Bacteria 959
651 Ga0373939_0074121 3300035114 Bacteria 1116
652 Ga0373960_0072439 3300035121 Bacteria 1068
653 Ga0373961_0109640 3300035241 Bacteria 903
654 Ga0373931_0127236 3300035691 Bacteria 1462
655 Ga0373935_0763281 3300035692 Bacteria 713
656 Ga0395899_0440488 3300037312 Bacteria 855
657 Ga0395900_0009860 3300037418 Bacteria 9783
658 Ga0395900_0036826 3300037418 Bacteria 5043
659 Ga0395900_0036959 3300037418 Bacteria 5034
660 Ga0395900_0147938 3300037418 Bacteria 2401
661 Ga0395898_0222076 3300037466 Bacteria 1802
662 Ga0395905_0001037 3300037471 Bacteria 35267
663 Ga0395905_0034180 3300037471 Bacteria 4773
664 Ga0395905_0088113 3300037471 Bacteria 2910
665 Ga0395905_0413513 3300037471 Bacteria 1244
666 Ga0395901_0000520 3300038443 Bacteria 44464
667 Ga0395901_0023864 3300038443 Bacteria 6273
668 Ga0395901_0190539 3300038443 Bacteria 2151
669 Ga0451793_1762985 3300041452 Bacteria 888
670 Ga0451802_0802543 3300041460 Bacteria 529
671 Ga0451807_0428949 3300041486 Bacteria 500
672 Ga0451841_1391331 3300041498 Bacteria 790
673 Ga0451843_0163617 3300041509 Bacteria 820
674 Ga0439448_0084102 3300042005 Bacteria 1071
675 Ga0451577_0219922 3300042876 Bacteria 1717
676 Ga0466966_0072754 3300044684 Bacteria 2151
677 Ga0466961_0010535 3300044693 Bacteria 5896
678 Ga0453684_0170418 3300044712 Bacteria 2566
679 Ga0466971_0023088 3300044719 Bacteria 2772
680 Ga0466957_0137866 3300044842 Bacteria 1569
681 Ga0466959_0071933 3300045049 Bacteria 2503
682 Ga0451576_0066192 3300045051 Bacteria 3762
683 Ga0495627_000090 3300046453 Bacteria 109622
684 Ga0495638_0190777 3300046460 Bacteria 1163
685 Ga0495638_0228932 3300046460 Bacteria 1035
686 Ga0495650_0000818 3300046471 Bacteria 37910
687 Ga0495605_0122678 3300046474 Bacteria 1177
688 Ga0495585_0190040 3300046492 Bacteria 1051
689 Ga0495596_0000220 3300046500 Bacteria 39671
690 Ga0495607_0010578 3300046501 Bacteria 6194
691 Ga0495607_0178556 3300046501 Bacteria 1066
692 Ga0495583_0004190 3300046506 Bacteria 10502
693 Ga0495583_0026847 3300046506 Bacteria 2849
694 Ga0495583_0075862 3300046506 Bacteria 1470
695 Ga0495583_0128376 3300046506 Bacteria 1062
696 Ga0495583_0139011 3300046506 Bacteria 1012
697 Ga0495606_0016352 3300046507 Bacteria 5662
698 Ga0495610_0000015 3300046512 Bacteria 391489
699 Ga0495610_0000136 3300046512 Bacteria 82060
700 Ga0495610_0004021 3300046512 Bacteria 11090
701 Ga0495620_0022534 3300046515 Bacteria 3031
702 Ga0495628_0785874 3300046516 Bacteria 667
703 Ga0495632_0001659 3300046519 Bacteria 18247
704 Ga0495632_0112457 3300046519 Bacteria 1277
705 Ga0495637_0014537 3300046520 Bacteria 3713
706 Ga0495637_0025547 3300046520 Bacteria 2661
707 Ga0495643_0000107 3300046522 Bacteria 138292
708 Ga0495643_0097275 3300046522 Bacteria 1513
709 Ga0495643_0201137 3300046522 Bacteria 956
710 Ga0495663_0088692 3300046525 Bacteria 1006
711 Ga0495642_0400622 3300046528 Bacteria 605
712 Ga0495654_0000348 3300046530 Bacteria 39921
713 Ga0495654_0089216 3300046530 Bacteria 1433
714 Ga0495609_0003765 3300046538 Bacteria 8554
715 Ga0495597_0131484 3300046542 Bacteria 1038
716 Ga0495633_0170734 3300046558 Bacteria 1002
717 Ga0495668_0007799 3300046616 Bacteria 6786
718 Ga0495668_0086684 3300046616 Bacteria 1717
719 Ga0495668_0260122 3300046616 Bacteria 950
720 Ga0495625_0000729 3300046660 Bacteria 46117
721 Ga0495625_0001717 3300046660 Bacteria 25448
722 Ga0495625_0005843 3300046660 Bacteria 11094
723 Ga0495625_0103863 3300046660 Bacteria 1948
724 Ga0495625_0343455 3300046660 Bacteria 945
725 Ga0495625_0410461 3300046660 Bacteria 844
726 Ga0495659_0009203 3300046664 Bacteria 3150
727 Ga0495661_0220157 3300046665 Bacteria 984
728 Ga0495669_0000323 3300046684 Bacteria 26217
729 Ga0495669_0016445 3300046684 Bacteria 3168
730 Ga0495669_0155760 3300046684 Bacteria 1083
731 Ga0495670_0014290 3300046691 Bacteria 3905
732 Ga0495670_0456521 3300046691 Bacteria 692
733 Ga0495671_0014236 3300046692 Bacteria 4286
734 Ga0495649_0264028 3300046694 Bacteria 882
735 Ga0495660_0187810 3300046810 Bacteria 995
736 Ga0495660_0342543 3300046810 Bacteria 666
737 Ga0495676_0322320 3300047321 Bacteria 1038
738 Ga0495687_000211 3300047443 Bacteria 83788
739 Ga0495681_0000048 3300047470 Bacteria 110216
740 Ga0495686_0068262 3300047472 Bacteria 2193
741 Ga0495626_0000214 3300048091 Bacteria 69009
742 Ga0496101_1037503 3300048904 Bacteria 644
743 Ga0496102_0076001 3300048905 Bacteria 3088
744 Ga0496102_0566240 3300048905 Bacteria 1059
745 Ga0496102_1204213 3300048905 Bacteria 677
746 Ga0496103_0016964 3300048906 Bacteria 4350
747 Ga0496103_0018712 3300048906 Bacteria 4156
748 Ga0496103_0063602 3300048906 Bacteria 2299
749 Ga0496103_0359958 3300048906 Bacteria 935
750 Ga0496104_0239029 3300048907 Bacteria 1728
751 Ga0496104_0293281 3300048907 Bacteria 1539
752 Ga0496105_0000870 3300048908 Bacteria 20664
753 Ga0496105_0577060 3300048908 Bacteria 875
754 Ga0496105_0710761 3300048908 Bacteria 771
755 Ga0496105_0858534 3300048908 Bacteria 686
756 Ga0496105_0998803 3300048908 Bacteria 626
757 Ga0496106_0047548 3300048909 Bacteria 3229
758 Ga0496106_0079891 3300048909 Bacteria 2511
759 Ga0496107_0020316 3300048910 Bacteria 4689
760 Ga0496107_0212219 3300048910 Bacteria 1440
761 Ga0496107_0659897 3300048910 Bacteria 771
762 Ga0496108_0070946 3300048911 Bacteria 2940
763 Ga0496108_1106633 3300048911 Bacteria 673
764 Ga0496109_0240217 3300048912 Bacteria 1705
765 Ga0496109_1168217 3300048912 Bacteria 706
766 Ga0496109_1204878 3300048912 Bacteria 694
767 Ga0496110_0063483 3300048913 Bacteria 3264
768 Ga0496110_0081472 3300048913 Bacteria 2885
769 Ga0496110_0102725 3300048913 Bacteria 2564
770 Ga0496110_0622166 3300048913 Bacteria 978
771 Ga0496111_0313364 3300048914 Bacteria 1162
772 Ga0496111_0663962 3300048914 Bacteria 760
773 Ga0496112_0568554 3300048915 Bacteria 1067
774 Ga0496113_0059478 3300048916 Bacteria 2878
775 Ga0496113_0651768 3300048916 Bacteria 842
776 Ga0496114_0000019 3300048917 Bacteria 244365
777 Ga0496114_0429606 3300048917 Bacteria 1170
778 Ga0496116_0000284 3300048919 Bacteria 86342
779 Ga0496116_0075635 3300048919 Bacteria 2112
780 Ga0496117_0010298 3300048920 Bacteria 8550
781 Ga0496117_0076028 3300048920 Bacteria 2228
782 Ga0496117_0132944 3300048920 Bacteria 1504
783 Ga0496118_0011723 3300048921 Bacteria 8520
784 Ga0496118_0015199 3300048921 Bacteria 7148
785 Ga0496118_0046055 3300048921 Bacteria 3397
786 Ga0496118_0067419 3300048921 Bacteria 2606
787 Ga0496119_0031689 3300048922 Bacteria 3538
788 Ga0496121_0000031 3300048924 Bacteria 384119
789 Ga0496121_0000196 3300048924 Bacteria 135812
790 Ga0496121_0000997 3300048924 Bacteria 50601
791 Ga0496121_0003197 3300048924 Bacteria 23595
792 Ga0496121_0007129 3300048924 Bacteria 13564
793 Ga0496121_0272027 3300048924 Bacteria 1164
794 Ga0496121_0307996 3300048924 Bacteria 1072
795 Ga0496122_0006671 3300048925 Bacteria 13150
796 Ga0496122_0027860 3300048925 Bacteria 4816
797 Ga0496122_0047866 3300048925 Bacteria 3295
798 Ga0496122_0108828 3300048925 Bacteria 1827
799 Ga0496123_0045999 3300048926 Bacteria 2965
800 Ga0496123_0055813 3300048926 Bacteria 2587
801 Ga0496123_0095952 3300048926 Bacteria 1743
802 Ga0496123_0130326 3300048926 Bacteria 1394
803 Ga0496124_0011898 3300048927 Bacteria 8661
804 Ga0496124_0017368 3300048927 Bacteria 6781
805 Ga0496124_0113738 3300048927 Bacteria 2174
806 Ga0496124_0180922 3300048927 Bacteria 1622
807 Ga0496124_0196481 3300048927 Bacteria 1538
808 Ga0496125_0014367 3300048928 Bacteria 7714
809 Ga0496125_0037208 3300048928 Bacteria 4234
810 Ga0496125_0067314 3300048928 Bacteria 2823
811 Ga0496125_0139532 3300048928 Bacteria 1688
812 Ga0496125_0229839 3300048928 Bacteria 1187
813 Ga0496126_0006838 3300048929 Bacteria 12646
814 Ga0496126_0020885 3300048929 Bacteria 6410
815 Ga0496126_0023508 3300048929 Bacteria 5972
816 Ga0496126_0131949 3300048929 Bacteria 2158
817 Ga0496126_0385121 3300048929 Bacteria 1140
818 Ga0496126_0654875 3300048929 Bacteria 821
819 Ga0496126_0926250 3300048929 Bacteria 659
820 Ga0495678_108597 3300049459 Bacteria 950
821 Ga0501031_0012668 3300049568 Bacteria 5507
822 Ga0501032_0016855 3300049569 Bacteria 5134
823 Ga0501032_0418074 3300049569 Bacteria 860
824 Ga0501033_0013889 3300049570 Bacteria 6127
825 Ga0501033_0152832 3300049570 Bacteria 1664
826 Ga0501034_0048157 3300049571 Bacteria 4302
827 Ga0501034_0052172 3300049571 Bacteria 4121
828 Ga0501034_0231460 3300049571 Bacteria 1797
829 Ga0501034_0600222 3300049571 Bacteria 1006
830 Ga0501034_1068472 3300049571 Bacteria 689
831 Ga0501036_0059692 3300049572 Bacteria 3231
832 Ga0501036_0896802 3300049572 Bacteria 728
833 Ga0501037_0024223 3300049573 Bacteria 4488
834 Ga0501037_0359574 3300049573 Bacteria 1003
835 Ga0501038_0018181 3300049574 Bacteria 6347
836 Ga0501038_0072817 3300049574 Bacteria 2911
837 Ga0501039_0063228 3300049575 Bacteria 2868
838 Ga0501039_0136516 3300049575 Bacteria 1926
839 Ga0501042_1298334 3300049578 Bacteria 531
840 Ga0501043_0153496 3300049579 Bacteria 1801
841 Ga0501043_0374062 3300049579 Bacteria 1080
842 Ga0501043_0837511 3300049579 Bacteria 663
843 Ga0501046_0180782 3300049580 Bacteria 1577
844 Ga0501047_0029560 3300049581 Bacteria 5283
845 Ga0501047_0413045 3300049581 Bacteria 1182
846 Ga0501071_0353295 3300049587 Bacteria 1119
847 Ga0501072_1131691 3300049588 Bacteria 609
848 Ga0501074_0210835 3300049590 Bacteria 1384
849 Ga0501233_000055 3300049668 Bacteria 15138
850 Ga0501249_012920 3300049679 Bacteria 1770
851 Ga0501035_0012700 3300049822 Bacteria 7783
852 Ga0501044_0001187 3300049823 Bacteria 30876
853 Ga0501044_0026980 3300049823 Bacteria 6076
854 Ga0501044_0048906 3300049823 Bacteria 4365
855 Ga0501044_0504988 3300049823 Bacteria 1110
856 Ga0501044_1423239 3300049823 Bacteria 559
857 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
858 nmdc:mga03683_4523_c1 3300050489 Bacteria 4625
859 nmdc:mga03n38_21620_c1 3300050490 Bacteria 2592
860 nmdc:mga03n38_580207_c1 3300050490 Bacteria 637
861 nmdc:mga00v17_10173_c2 3300050491 Bacteria 3815
862 nmdc:mga00v17_3456_c1 3300050491 Bacteria 8173
863 nmdc:mga00v17_513432_c1 3300050491 Bacteria 776
864 nmdc:mga00v17_7174_c1 3300050491 Bacteria 5936
865 nmdc:mga0k408_77105_c1 3300050493 Bacteria 1949
866 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
867 nmdc:mga06z11_536639_c1 3300050494 Bacteria 710
868 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
869 nmdc:mga07m45_4375_c1 3300050496 Bacteria 3604
870 nmdc:mga07m45_57468_c1 3300050496 Bacteria 2200
871 nmdc:mga07m45_63400_c1 3300050496 Bacteria 2096
872 nmdc:mga07m45_69354_c1 3300050496 Bacteria 2004
873 nmdc:mga07m45_746212_c1 3300050496 Bacteria 562
874 nmdc:mga0rr50_748349_c1 3300050513 Bacteria 834
875 nmdc:mga0sz30_27879_c1 3300050516 Bacteria 2322
876 nmdc:mga0sz30_3957_c1 3300050516 Bacteria 5342
877 nmdc:mga0sz30_4821_c1 3300050516 Bacteria 4910
878 nmdc:mga0sz30_541359_c1 3300050516 Bacteria 525
879 Ga0500643_000219 3300053087 Bacteria 53403
880 Ga0500643_002412 3300053087 Bacteria 9688
881 Ga0500643_004161 3300053087 Bacteria 6638
882 Ga0500643_006074 3300053087 Bacteria 5104
883 Ga0500583_0211082 3300053092 Bacteria 964
884 Ga0500566_0317890 3300053094 Bacteria 726
885 Ga0500592_000128 3300053116 Bacteria 16344
886 Ga0500592_019025 3300053116 Bacteria 1103
887 Ga0500592_022671 3300053116 Bacteria 1012
888 Ga0500607_000844 3300053121 Bacteria 29501
889 Ga0500607_001731 3300053121 Bacteria 18963
890 Ga0500608_000087 3300053122 Bacteria 37903
891 Ga0500608_045101 3300053122 Bacteria 2118
892 Ga0500614_211526 3300053123 Bacteria 600
893 Ga0500618_003516 3300053125 Bacteria 5339
894 Ga0500655_023924 3300053133 Bacteria 1155
895 Ga0500658_0122721 3300053134 Bacteria 1153
896 Ga0500559_0006188 3300053136 Bacteria 5417
897 Ga0500559_0012200 3300053136 Bacteria 3656
898 Ga0500559_0358744 3300053136 Bacteria 681
899 Ga0500564_000168 3300053138 Bacteria 17386
900 Ga0500568_0004543 3300053139 Bacteria 7401
901 Ga0500568_0072500 3300053139 Bacteria 1317
902 Ga0500573_0349054 3300053140 Bacteria 719
903 Ga0500577_0132685 3300053142 Bacteria 1045
904 Ga0500590_071629 3300053148 Bacteria 1721
905 Ga0500604_0034168 3300053151 Bacteria 1507
906 Ga0500616_0005527 3300053153 Bacteria 8562
907 Ga0500622_0001994 3300053156 Bacteria 15306
908 Ga0500624_000033 3300053157 Bacteria 102532
909 Ga0500627_0000049 3300053158 Bacteria 58947
910 Ga0500627_0010487 3300053158 Bacteria 3382
911 Ga0500627_0033399 3300053158 Bacteria 2174
912 Ga0500636_0005813 3300053177 Bacteria 7062
913 Ga0500637_0108625 3300053178 Bacteria 1609
914 Ga0500567_000445 3300053723 Bacteria 13930
915 Ga0500611_000770 3300053727 Bacteria 3307
916 Ga0500625_000009 3300053729 Bacteria 159296
917 Ga0500645_126726 3300053730 Bacteria 710
918 Ga0500645_127046 3300053730 Bacteria 709
919 Ga0466962_0158838 3300061719 Bacteria 1098
920 2511130336 2510917021 Bacteria 5705459
921 2585260091 2582581305 Bacteria 4895574
922 2643730853 2643221541 Bacteria 5498788
923 2643820524 2643221560 Bacteria 4801179
924 2643836339 2643221563 Bacteria 4726935
925 2644040409 2643221605 Bacteria 4772303
926 2644044494 2643221606 Bacteria 5588032
927 2644052815 2643221608 Bacteria 4724829
928 2644391581 2643221671 Bacteria 5496681
929 2819552833 2818991438 Bacteria 5793701
930 2848297396 2848297114 Bacteria 3608511
931 2852653950 2852653556 Bacteria 4050083
932 2852682655 2852680915 Bacteria 4100189
933 2879166468 2879163058 Bacteria 4223965
934 2882807029 2882806704 Bacteria 3007728
935 2896254686 2896253425 Bacteria 3418029
936 2919139694 2919138771 Bacteria 5281312
937 2990266414 2990265787 Bacteria 3943888
938 8054303044 8054302542 Bacteria 5698134
939 Ga0065704_10070364
940 SwRhRL2b_contig_1406535
941 SwRhRL2b_contig_3703961
942 ARcpr5yngRDRAFT_c002434
943 JGI24736J21556_1053072
944 JGI24752J21851_1000535
945 JGI24740J21852_10006386
946 JGI24739J22299_10000378
947 JGI24739J22299_10002487
948 JGI24739J22299_10030758
949 JGI24737J22298_10000438
950 JGI24737J22298_10001931
951 JGI24737J22298_10034699
952 JGI24738J21930_10003426
953 JGI24738J21930_10012231
954 JGI24034J26672_10062163
955 JGI24751J29686_10000388
956 Ga0055537_1002075
957 Ga0055524_1000654
958 Ga0055536_1002435
959 Ga0055536_1008890
960 Ga0055534_1026657
961 Ga0055534_1028314
962 Ga0055528_1034380
963 Ga0055530_10000522
964 Ga0055531_10004791
965 Ga0055531_10017316
966 Ga0065165_1004978
967 Ga0065165_1007901
968 Ga0065704_10076703
969 Ga0065704_10092310
970 Ga0065712_10158463
971 Ga0065712_10288054
972 Ga0065707_10081738
973 Ga0065707_10119699
974 Ga0065707_10245569
975 Ga0070658_10003538
976 Ga0070658_10004563
977 Ga0070658_10005934
978 Ga0070676_10005815
979 Ga0070683_100005945
980 Ga0070690_100643257
981 Ga0070690_101170409
982 Ga0070670_100000168
983 Ga0070670_100000340
984 Ga0070670_100034717
985 Ga0070670_100061834
986 Ga0070670_100273001
987 Ga0070677_10000460
988 Ga0070677_10457904
989 Ga0068869_100000736
990 Ga0068869_100054511
991 Ga0070666_10000380
992 Ga0070666_10060890
993 Ga0070666_10346367
994 Ga0070680_100651464
995 Ga0070682_100098702
996 Ga0068868_100006361
997 Ga0070660_100000061
998 Ga0070660_100000560
999 Ga0070660_100050689
1000 Ga0070660_100323789
1001 Ga0070689_100075351
1002 Ga0070689_100613862
1003 Ga0070687_100203935
1004 Ga0070687_101223316
1005 Ga0070661_100000075
1006 Ga0070661_100080858
1007 Ga0070661_100181140
1008 Ga0070661_100335319
1009 Ga0070661_100511561
1010 Ga0070692_10015367
1011 Ga0070692_10236840
1012 Ga0070692_10875241
1013 Ga0070668_100001470
1014 Ga0070668_100005494
1015 Ga0070668_100027478
1016 Ga0070668_100599030
1017 Ga0070669_100000013
1018 Ga0070669_100000270
1019 Ga0070669_100000565
1020 Ga0070669_100002327
1021 Ga0070669_100004540
1022 Ga0070669_100071233
1023 Ga0070669_100115681
1024 Ga0070669_100894534
1025 Ga0070671_100000116
1026 Ga0070671_100018850
1027 Ga0070671_100031625
1028 Ga0070671_100049808
1029 Ga0070671_100062925
1030 Ga0070671_100136987
1031 Ga0070671_100158643
1032 Ga0070671_100531558
1033 Ga0070674_100011953
1034 Ga0070673_100010306
1035 Ga0070673_100084376
1036 Ga0070659_100004211
1037 Ga0070659_100004345
1038 Ga0070667_100000290
1039 Ga0070667_100000968
1040 Ga0070667_100001907
1041 Ga0070667_100002091
1042 Ga0070667_100013168
1043 Ga0070667_100017180
1044 Ga0070667_100083429
1045 Ga0070667_100091190
1046 Ga0070667_100125790
1047 Ga0070667_100155986
1048 Ga0070705_100026577
1049 Ga0070705_100161075
1050 Ga0070705_100178167
1051 Ga0070663_100004025
1052 Ga0070663_100040950
1053 Ga0070663_100068831
1054 Ga0070663_100160610
1055 Ga0070663_100361851
1056 Ga0070678_100922221
1057 Ga0070678_101597531
1058 Ga0070662_100003155
1059 Ga0070662_100003479
1060 Ga0070681_10599326
1061 Ga0068867_100008041
1062 Ga0070685_10265149
1063 Ga0070707_100126344
1064 Ga0070679_101463737
1065 Ga0070684_100097876
1066 Ga0070684_101912474
1067 Ga0068853_100006609
1068 Ga0068853_100032999
1069 Ga0068853_102118200
1070 Ga0070672_100061279
1071 Ga0070672_100558772
1072 Ga0070672_101043930
1073 Ga0070686_101126069
1074 Ga0070696_100040501
1075 Ga0070693_100011908
1076 Ga0070665_100001031
1077 Ga0070665_100005836
1078 Ga0070665_100015813
1079 Ga0070665_100019518
1080 Ga0070665_100027367
1081 Ga0070665_100176304
1082 Ga0068855_100000480
1083 Ga0068855_100002720
1084 Ga0068855_100010731
1085 Ga0068855_100154599
1086 Ga0068855_100169820
1087 Ga0068855_100396531
1088 Ga0070664_100004841
1089 Ga0070664_100126949
1090 Ga0070664_100283199
1091 Ga0070664_100917863
1092 Ga0068857_100011311
1093 Ga0068857_100068787
1094 Ga0068857_100178585
1095 Ga0068857_100188390
1096 Ga0068857_100250219
1097 Ga0068857_100290962
1098 Ga0068854_100001621
1099 Ga0068854_100020124
1100 Ga0068854_100028696
1101 Ga0068854_100070209
1102 Ga0068854_100422727
1103 Ga0068856_100000538
1104 Ga0068856_100049729
1105 Ga0068856_100059828
1106 Ga0068856_100658421
1107 Ga0068852_100000117
1108 Ga0068852_100001259
1109 Ga0068852_100072095
1110 Ga0068852_101048393
1111 Ga0068859_100000390
1112 Ga0068859_100028682
1113 Ga0068859_100060129
1114 Ga0068859_100071713
1115 Ga0068859_100106828
1116 Ga0068859_100189251
1117 Ga0068864_100000063
1118 Ga0068864_100001241
1119 Ga0068864_100001790
1120 Ga0068864_100179807
1121 Ga0068864_100274952
1122 Ga0068864_100291310
1123 Ga0068861_100000026
1124 Ga0068861_100109047
1125 Ga0068861_100561436
1126 Ga0068861_100627333
1127 Ga0068851_10033091
1128 Ga0068851_10078667
1129 Ga0068851_10341629
1130 Ga0068870_10082254
1131 Ga0068870_11217787
1132 Ga0068863_100000062
1133 Ga0068863_100006362
1134 Ga0068863_100008110
1135 Ga0068863_100046312
1136 Ga0068863_100403611
1137 Ga0068858_100000713
1138 Ga0068858_100001247
1139 Ga0068858_100001777
1140 Ga0068858_100026353
1141 Ga0068858_100043444
1142 Ga0068858_100057071
1143 Ga0068858_100104177
1144 Ga0068858_100157761
1145 Ga0068858_100391700
1146 Ga0068858_101877700
1147 Ga0068860_100000386
1148 Ga0068860_100003383
1149 Ga0068860_100009605
1150 Ga0068860_100032878
1151 Ga0068860_100033307
1152 Ga0068860_100074959
1153 Ga0068860_100228223
1154 Ga0068860_100582217
1155 Ga0068860_100652764
1156 Ga0068862_100000069
1157 Ga0068862_100000560
1158 Ga0068862_100022890
1159 Ga0068862_100100800
1160 Ga0068862_100105647
1161 Ga0068862_101142259
1162 Ga0081539_10405381
1163 Ga0075363_100000864
1164 Ga0075364_10006189
1165 Ga0075364_10140699
1166 Ga0075364_10319801
1167 Ga0075362_10000003
1168 Ga0075362_10034915
1169 Ga0075367_10582484
1170 Ga0075369_10005083
1171 Ga0075369_10029336
1172 Ga0075369_10607114
1173 Ga0075366_10000006
1174 Ga0075366_10003942
1175 Ga0075366_10058083
1176 Ga0075366_10715764
1177 Ga0075366_10870028
1178 Ga0097621_100185722
1179 Ga0097621_101942584
1180 Ga0075370_10000008
1181 Ga0075370_10055793
1182 Ga0075370_10062887
1183 Ga0075370_10083223
1184 Ga0075370_10471773
1185 Ga0068871_100067451
1186 Ga0068865_100047978
1187 Ga0068865_100083717
1188 Ga0097620_100000390
1189 Ga0097620_100028682
1190 Ga0097620_100060129
1191 Ga0097620_100071712
1192 Ga0097620_100106825
1193 Ga0097620_100189261
1194 Ga0079104_1024009
1195 Ga0079104_1057170
1196 Ga0079104_1079198
1197 Ga0075435_100726874
1198 Ga0105251_10001526
1199 Ga0105251_10003021
1200 Ga0105251_10009342
1201 Ga0105251_10113933
1202 Ga0105250_10143007
1203 Ga0105250_10183843
1204 Ga0105240_10007704
1205 Ga0105240_10063792
1206 Ga0105240_10540999
1207 Ga0105245_10000782
1208 Ga0105247_10007366
1209 Ga0105247_10058521
1210 Ga0105243_10042556
1211 Ga0105243_10124096
1212 Ga0105243_10975884
1213 Ga0105241_10250298
1214 Ga0105241_12191896
1215 Ga0105248_10000443
1216 Ga0105248_10000536
1217 Ga0105248_10003369
1218 Ga0105248_10028337
1219 Ga0105248_10047856
1220 Ga0105248_10255746
1221 Ga0105248_10366421
1222 Ga0105237_11492110
1223 Ga0105238_10079835
1224 Ga0105238_10235939
1225 Ga0105249_10000160
1226 Ga0105249_10000355
1227 Ga0105249_10031761
1228 Ga0105249_10034168
1229 Ga0105249_10074343
1230 Ga0105249_10101821
1231 Ga0105239_10020946
1232 Ga0105239_11431141
1233 Ga0105246_10007706
1234 Ga0157326_1000245
1235 Ga0157373_10155054
1236 Ga0157373_10222602
1237 Ga0157371_10000458
1238 Ga0157371_10008659
1239 Ga0157371_10013469
1240 Ga0157371_10055053
1241 Ga0157370_10005413
1242 Ga0157370_10054922
1243 Ga0157370_10124747
1244 Ga0157369_10012733
1245 Ga0157369_10113197
1246 Ga0157369_10750459
1247 Ga0157374_10121558
1248 Ga0157374_11342174
1249 Ga0157378_10049574
1250 Ga0157378_10143383
1251 Ga0157378_10668599
1252 Ga0163162_10008854
1253 Ga0163162_10042347
1254 Ga0163162_10042864
1255 Ga0163162_10114319
1256 Ga0163162_10122097
1257 Ga0157372_10696870
1258 Ga0157372_10880398
1259 Ga0157372_13072220
1260 Ga0157375_10115316
1261 Ga0163163_10000058
1262 Ga0163163_10079077
1263 Ga0163163_10331161
1264 Ga0163163_10348097
1265 Ga0163163_11156113
1266 Ga0163163_11194356
1267 Ga0157380_10000338
1268 Ga0157380_10146890
1269 Ga0157380_10524023
1270 Ga0157377_10072623
1271 Ga0157379_10009670
1272 Ga0157379_10015929
1273 Ga0157379_10069392
1274 Ga0157376_11278812
1275 Ga0163161_10001269
1276 Ga0163161_10087437
1277 Ga0163161_10539498
1278 Ga0163161_10723031
1279 Ga0207425_1005665
1280 Ga0209565_1000008
1281 Ga0209565_1042448
1282 Ga0209673_1001996
1283 Ga0209675_1001006
1284 Ga0209675_1006218
1285 Ga0209676_1000557
1286 Ga0209676_1002559
1287 Ga0209676_1015956
1288 Ga0209025_1006073
1289 Ga0209025_1059735
1290 Ga0209050_1000017
1291 Ga0209050_1013704
1292 Ga0209256_1000009
1293 Ga0209256_1000010
1294 Ga0209257_1001118
1295 Ga0209257_1001176
1296 Ga0209257_1001491
1297 Ga0209257_1001719
1298 Ga0209257_1054400
1299 Ga0207697_10001744
1300 Ga0207697_10003187
1301 Ga0207697_10040420
1302 Ga0207697_10253506
1303 Ga0207656_10014271
1304 Ga0207656_10203038
1305 Ga0207656_10397706
1306 Ga0207713_1002174
1307 Ga0207713_1008296
1308 Ga0207713_1012977
1309 Ga0207682_10000990
1310 Ga0207682_10409320
1311 Ga0207642_10204205
1312 Ga0207642_11004320
1313 Ga0207710_10012829
1314 Ga0207710_10100506
1315 Ga0207710_10114879
1316 Ga0207688_10026749
1317 Ga0207688_10494475
1318 Ga0207680_10000480
1319 Ga0207680_10020210
1320 Ga0207680_10106591
1321 Ga0207680_10109442
1322 Ga0207647_10016767
1323 Ga0207645_10015526
1324 Ga0207645_10075336
1325 Ga0207705_10000004
1326 Ga0207705_10000131
1327 Ga0207705_10002347
1328 Ga0207705_10754070
1329 Ga0207654_10967562
1330 Ga0207654_11201855
1331 Ga0207695_10005830
1332 Ga0207695_10015638
1333 Ga0207695_10216217
1334 Ga0207695_10278236
1335 Ga0207695_10313200
1336 Ga0207671_11472218
1337 Ga0207660_10517869
1338 Ga0207662_10095343
1339 Ga0207662_10239122
1340 Ga0207657_10000126
1341 Ga0207657_10000181
1342 Ga0207657_10281435
1343 Ga0207649_10000937
1344 Ga0207649_10117784
1345 Ga0207649_10369724
1346 Ga0207646_10499675
1347 Ga0207681_10000008
1348 Ga0207681_10000038
1349 Ga0207681_10002968
1350 Ga0207681_10010000
1351 Ga0207681_10012300
1352 Ga0207681_10024877
1353 Ga0207681_10407023
1354 Ga0207681_10566210
1355 Ga0207681_11001390
1356 Ga0207694_10160837
1357 Ga0207694_10200744
1358 Ga0207650_10006484
1359 Ga0207650_10032491
1360 Ga0207650_10037790
1361 Ga0207650_10110967
1362 Ga0207650_10203512
1363 Ga0207650_10537563
1364 Ga0207650_11885168
1365 Ga0207687_10013795
1366 Ga0207644_10000191
1367 Ga0207644_10001603
1368 Ga0207644_10004437
1369 Ga0207644_10012689
1370 Ga0207644_10105191
1371 Ga0207644_10418068
1372 Ga0207690_10000106
1373 Ga0207690_10006739
1374 Ga0207690_10131116
1375 Ga0207690_10267028
1376 Ga0207706_10000151
1377 Ga0207706_10005896
1378 Ga0207706_10152465
1379 Ga0207706_10222113
1380 Ga0207709_10030191
1381 Ga0207709_10734474
1382 Ga0207670_10108350
1383 Ga0207669_10006549
1384 Ga0207704_10082467
1385 Ga0207691_10007770
1386 Ga0207691_10641108
1387 Ga0207691_10947811
1388 Ga0207711_10000017
1389 Ga0207711_10001912
1390 Ga0207711_10031022
1391 Ga0207711_10032649
1392 Ga0207711_10087303
1393 Ga0207711_10770231
1394 Ga0207689_10000167
1395 Ga0207689_10026962
1396 Ga0207689_10038989
1397 Ga0207689_10114392
1398 Ga0207661_10006497
1399 Ga0207679_10002382
1400 Ga0207679_10243751
1401 Ga0207679_10607754
1402 Ga0207667_10000586
1403 Ga0207667_10002108
1404 Ga0207667_10003563
1405 Ga0207667_10070804
1406 Ga0207667_10125942
1407 Ga0207667_10138092
1408 Ga0207651_10001801
1409 Ga0207651_10074826
1410 Ga0207712_10000222
1411 Ga0207712_10001433
1412 Ga0207712_10014035
1413 Ga0207712_10026859
1414 Ga0207712_10129989
1415 Ga0207712_10375142
1416 Ga0207668_10000487
1417 Ga0207668_10003398
1418 Ga0207668_10053614
1419 Ga0207668_10071748
1420 Ga0207640_10002555
1421 Ga0207640_10015350
1422 Ga0207640_10019097
1423 Ga0207640_10025143
1424 Ga0207640_10035980
1425 Ga0207640_10147273
1426 Ga0207640_11595081
1427 Ga0207658_10000133
1428 Ga0207658_10000344
1429 Ga0207658_10002000
1430 Ga0207658_10002624
1431 Ga0207658_10009484
1432 Ga0207658_10247537
1433 Ga0207658_10316648
1434 Ga0207658_10482501
1435 Ga0207658_11248043
1436 Ga0207677_10002698
1437 Ga0207677_11478198
1438 Ga0207703_10000600
1439 Ga0207703_10002947
1440 Ga0207703_10004946
1441 Ga0207703_10009186
1442 Ga0207703_10013748
1443 Ga0207703_10045860
1444 Ga0207703_10393275
1445 Ga0207703_10565543
1446 Ga0207703_11663387
1447 Ga0207639_10000573
1448 Ga0207639_10002893
1449 Ga0207639_10216118
1450 Ga0207678_10006756
1451 Ga0207678_10010888
1452 Ga0207678_10342903
1453 Ga0207678_11229106
1454 Ga0207702_10001045
1455 Ga0207702_10022777
1456 Ga0207702_10070405
1457 Ga0207702_10442956
1458 Ga0207641_10000022
1459 Ga0207641_10008748
1460 Ga0207641_10011097
1461 Ga0207641_10026721
1462 Ga0207641_10080480
1463 Ga0207641_10239071
1464 Ga0207641_10824529
1465 Ga0207641_11156203
1466 Ga0207641_11210153
1467 Ga0207648_10001222
1468 Ga0207676_10000056
1469 Ga0207676_10000698
1470 Ga0207676_10007892
1471 Ga0207676_10016650
1472 Ga0207676_10017345
1473 Ga0207676_10047378
1474 Ga0207676_10568396
1475 Ga0207674_10002073
1476 Ga0207674_10039134
1477 Ga0207674_10072353
1478 Ga0207674_10096441
1479 Ga0207674_10117552
1480 Ga0207674_10194949
1481 Ga0207674_10276148
1482 Ga0207674_10399476
1483 Ga0207674_10415813
1484 Ga0207674_10457039
1485 Ga0207675_100000219
1486 Ga0207675_100142165
1487 Ga0207675_100204155
1488 Ga0207675_100318808
1489 Ga0207675_101118764
1490 Ga0207683_10135548
1491 Ga0207698_10000019
1492 Ga0207698_10002899
1493 Ga0207698_10070698
1494 Ga0207698_10142639
1495 Ga0207698_10188675
1496 Ga0209281_1014804
1497 Ga0209281_1039265
1498 Ga0209982_1013472
1499 Ga0209982_1022706
1500 Ga0209970_1010807
1501 Ga0209971_1017836
1502 Ga0209998_10186466
1503 Ga0209974_10004612
1504 Ga0209974_10014620
1505 Ga0209974_10312981
1506 Ga0268266_10000534
1507 Ga0268266_10000950
1508 Ga0268266_10005024
1509 Ga0268266_10017332
1510 Ga0268266_10227353
1511 Ga0268266_10531242
1512 Ga0268265_10000044
1513 Ga0268265_10000171
1514 Ga0268265_10009925
1515 Ga0268265_10015150
1516 Ga0268265_10161575
1517 Ga0268265_10269548
1518 Ga0268265_11703404
1519 Ga0268264_10000040
1520 Ga0268264_10000221
1521 Ga0268264_10002127
1522 Ga0268264_10007794
1523 Ga0268264_10065660
1524 Ga0268264_10152292
1525 Ga0268264_10274083
1526 Ga0268264_10346882
1527 Ga0268264_10782600
1528 Ga0265331_10065337
1529 Ga0265327_10034617
1530 Ga0307408_100012053
1531 Ga0307408_100049901
1532 Ga0307408_100190314
1533 Ga0307516_10371135
1534 Ga0307405_10000262
1535 Ga0307405_10024668
1536 Ga0307405_10048413
1537 Ga0307405_10153163
1538 Ga0307405_10243290
1539 Ga0307405_10305156
1540 Ga0307413_10007277
1541 Ga0307410_10006176
1542 Ga0307410_10025173
1543 Ga0307410_10056655
1544 Ga0307410_10193120
1545 Ga0307406_10022270
1546 Ga0307406_10069186
1547 Ga0307406_10095665
1548 Ga0307406_10698063
1549 Ga0307406_10816607
1550 Ga0307406_11221196
1551 Ga0307407_10084128
1552 Ga0307407_10222348
1553 Ga0307407_10730005
1554 Ga0307412_10001508
1555 Ga0307412_10022421
1556 Ga0307412_10076098
1557 Ga0307412_10515572
1558 Ga0307412_10789314
1559 Ga0307409_100005979
1560 Ga0307409_100045302
1561 Ga0307409_101671372
1562 Ga0307409_102205409
1563 Ga0307416_100144168
1564 Ga0307416_100157479
1565 Ga0307416_100230719
1566 Ga0307416_100463127
1567 Ga0307416_102562940
1568 Ga0307414_10000705
1569 Ga0307414_10017082
1570 Ga0307414_10114396
1571 Ga0307414_10119340
1572 Ga0307414_10124929
1573 Ga0307414_10181758
1574 Ga0307414_10189567
1575 Ga0307414_10206534
1576 Ga0307414_10231185
1577 Ga0307414_10436456
1578 Ga0307411_10007342
1579 Ga0307411_10059438
1580 Ga0307411_10230647
1581 Ga0307411_10337202
1582 Ga0307411_10384891
1583 Ga0307415_100031388
1584 Ga0307415_100133080
1585 Ga0307415_100351848
1586 Ga0307415_100755663
1587 Ga0307510_10083885
1588 Ga0373951_0058764
1589 Ga0373939_0074121
1590 Ga0373960_0072439
1591 Ga0373961_0109640
1592 Ga0373931_0127236
1593 Ga0373935_0763281
1594 Ga0395899_0440488
1595 Ga0395900_0009860
1596 Ga0395900_0036826
1597 Ga0395900_0036959
1598 Ga0395900_0147938
1599 Ga0395898_0222076
1600 Ga0395905_0001037
1601 Ga0395905_0034180
1602 Ga0395905_0088113
1603 Ga0395905_0413513
1604 Ga0395901_0000520
1605 Ga0395901_0023864
1606 Ga0395901_0190539
1607 Ga0451793_1762985
1608 Ga0451802_0802543
1609 Ga0451807_0428949
1610 Ga0451841_1391331
1611 Ga0451843_0163617
1612 Ga0439448_0084102
1613 Ga0451577_0219922
1614 Ga0466966_0072754
1615 Ga0466961_0010535
1616 Ga0453684_0170418
1617 Ga0466971_0023088
1618 Ga0466957_0137866
1619 Ga0466959_0071933
1620 Ga0451576_0066192
1621 Ga0495627_000090
1622 Ga0495638_0190777
1623 Ga0495638_0228932
1624 Ga0495650_0000818
1625 Ga0495605_0122678
1626 Ga0495585_0190040
1627 Ga0495596_0000220
1628 Ga0495607_0010578
1629 Ga0495607_0178556
1630 Ga0495583_0004190
1631 Ga0495583_0026847
1632 Ga0495583_0075862
1633 Ga0495583_0128376
1634 Ga0495583_0139011
1635 Ga0495606_0016352
1636 Ga0495610_0000015
1637 Ga0495610_0000136
1638 Ga0495610_0004021
1639 Ga0495620_0022534
1640 Ga0495628_0785874
1641 Ga0495632_0001659
1642 Ga0495632_0112457
1643 Ga0495637_0014537
1644 Ga0495637_0025547
1645 Ga0495643_0000107
1646 Ga0495643_0097275
1647 Ga0495643_0201137
1648 Ga0495663_0088692
1649 Ga0495642_0400622
1650 Ga0495654_0000348
1651 Ga0495654_0089216
1652 Ga0495609_0003765
1653 Ga0495597_0131484
1654 Ga0495633_0170734
1655 Ga0495668_0007799
1656 Ga0495668_0086684
1657 Ga0495668_0260122
1658 Ga0495625_0000729
1659 Ga0495625_0001717
1660 Ga0495625_0005843
1661 Ga0495625_0103863
1662 Ga0495625_0343455
1663 Ga0495625_0410461
1664 Ga0495659_0009203
1665 Ga0495661_0220157
1666 Ga0495669_0000323
1667 Ga0495669_0016445
1668 Ga0495669_0155760
1669 Ga0495670_0014290
1670 Ga0495670_0456521
1671 Ga0495671_0014236
1672 Ga0495649_0264028
1673 Ga0495660_0187810
1674 Ga0495660_0342543
1675 Ga0495676_0322320
1676 Ga0495687_000211
1677 Ga0495681_0000048
1678 Ga0495686_0068262
1679 Ga0495626_0000214
1680 Ga0496101_1037503
1681 Ga0496102_0076001
1682 Ga0496102_0566240
1683 Ga0496102_1204213
1684 Ga0496103_0016964
1685 Ga0496103_0018712
1686 Ga0496103_0063602
1687 Ga0496103_0359958
1688 Ga0496104_0239029
1689 Ga0496104_0293281
1690 Ga0496105_0000870
1691 Ga0496105_0577060
1692 Ga0496105_0710761
1693 Ga0496105_0858534
1694 Ga0496105_0998803
1695 Ga0496106_0047548
1696 Ga0496106_0079891
1697 Ga0496107_0020316
1698 Ga0496107_0212219
1699 Ga0496107_0659897
1700 Ga0496108_0070946
1701 Ga0496108_1106633
1702 Ga0496109_0240217
1703 Ga0496109_1168217
1704 Ga0496109_1204878
1705 Ga0496110_0063483
1706 Ga0496110_0081472
1707 Ga0496110_0102725
1708 Ga0496110_0622166
1709 Ga0496111_0313364
1710 Ga0496111_0663962
1711 Ga0496112_0568554
1712 Ga0496113_0059478
1713 Ga0496113_0651768
1714 Ga0496114_0000019
1715 Ga0496114_0429606
1716 Ga0496116_0000284
1717 Ga0496116_0075635
1718 Ga0496117_0010298
1719 Ga0496117_0076028
1720 Ga0496117_0132944
1721 Ga0496118_0011723
1722 Ga0496118_0015199
1723 Ga0496118_0046055
1724 Ga0496118_0067419
1725 Ga0496119_0031689
1726 Ga0496121_0000031
1727 Ga0496121_0000196
1728 Ga0496121_0000997
1729 Ga0496121_0003197
1730 Ga0496121_0007129
1731 Ga0496121_0272027
1732 Ga0496121_0307996
1733 Ga0496122_0006671
1734 Ga0496122_0027860
1735 Ga0496122_0047866
1736 Ga0496122_0108828
1737 Ga0496123_0045999
1738 Ga0496123_0055813
1739 Ga0496123_0095952
1740 Ga0496123_0130326
1741 Ga0496124_0011898
1742 Ga0496124_0017368
1743 Ga0496124_0113738
1744 Ga0496124_0180922
1745 Ga0496124_0196481
1746 Ga0496125_0014367
1747 Ga0496125_0037208
1748 Ga0496125_0067314
1749 Ga0496125_0139532
1750 Ga0496125_0229839
1751 Ga0496126_0006838
1752 Ga0496126_0020885
1753 Ga0496126_0023508
1754 Ga0496126_0131949
1755 Ga0496126_0385121
1756 Ga0496126_0654875
1757 Ga0496126_0926250
1758 Ga0495678_108597
1759 Ga0501031_0012668
1760 Ga0501032_0016855
1761 Ga0501032_0418074
1762 Ga0501033_0013889
1763 Ga0501033_0152832
1764 Ga0501034_0048157
1765 Ga0501034_0052172
1766 Ga0501034_0231460
1767 Ga0501034_0600222
1768 Ga0501034_1068472
1769 Ga0501036_0059692
1770 Ga0501036_0896802
1771 Ga0501037_0024223
1772 Ga0501037_0359574
1773 Ga0501038_0018181
1774 Ga0501038_0072817
1775 Ga0501039_0063228
1776 Ga0501039_0136516
1777 Ga0501042_1298334
1778 Ga0501043_0153496
1779 Ga0501043_0374062
1780 Ga0501043_0837511
1781 Ga0501046_0180782
1782 Ga0501047_0029560
1783 Ga0501047_0413045
1784 Ga0501071_0353295
1785 Ga0501072_1131691
1786 Ga0501074_0210835
1787 Ga0501233_000055
1788 Ga0501249_012920
1789 Ga0501035_0012700
1790 Ga0501044_0001187
1791 Ga0501044_0026980
1792 Ga0501044_0048906
1793 Ga0501044_0504988
1794 Ga0501044_1423239
1795 nmdc:mga03683_13_c1
1796 nmdc:mga03683_4523_c1
1797 nmdc:mga03n38_21620_c1
1798 nmdc:mga03n38_580207_c1
1799 nmdc:mga00v17_10173_c2
1800 nmdc:mga00v17_3456_c1
1801 nmdc:mga00v17_513432_c1
1802 nmdc:mga00v17_7174_c1
1803 nmdc:mga0k408_77105_c1
1804 nmdc:mga0k408_8_c1
1805 nmdc:mga06z11_536639_c1
1806 nmdc:mga07m45_20_c1
1807 nmdc:mga07m45_4375_c1
1808 nmdc:mga07m45_57468_c1
1809 nmdc:mga07m45_63400_c1
1810 nmdc:mga07m45_69354_c1
1811 nmdc:mga07m45_746212_c1
1812 nmdc:mga0rr50_748349_c1
1813 nmdc:mga0sz30_27879_c1
1814 nmdc:mga0sz30_3957_c1
1815 nmdc:mga0sz30_4821_c1
1816 nmdc:mga0sz30_541359_c1
1817 Ga0500643_000219
1818 Ga0500643_002412
1819 Ga0500643_004161
1820 Ga0500643_006074
1821 Ga0500583_0211082
1822 Ga0500566_0317890
1823 Ga0500592_000128
1824 Ga0500592_019025
1825 Ga0500592_022671
1826 Ga0500607_000844
1827 Ga0500607_001731
1828 Ga0500608_000087
1829 Ga0500608_045101
1830 Ga0500614_211526
1831 Ga0500618_003516
1832 Ga0500655_023924
1833 Ga0500658_0122721
1834 Ga0500559_0006188
1835 Ga0500559_0012200
1836 Ga0500559_0358744
1837 Ga0500564_000168
1838 Ga0500568_0004543
1839 Ga0500568_0072500
1840 Ga0500573_0349054
1841 Ga0500577_0132685
1842 Ga0500590_071629
1843 Ga0500604_0034168
1844 Ga0500616_0005527
1845 Ga0500622_0001994
1846 Ga0500624_000033
1847 Ga0500627_0000049
1848 Ga0500627_0010487
1849 Ga0500627_0033399
1850 Ga0500636_0005813
1851 Ga0500637_0108625
1852 Ga0500567_000445
1853 Ga0500611_000770
1854 Ga0500625_000009
1855 Ga0500645_126726
1856 Ga0500645_127046
1857 Ga0466962_0158838
1858 2511130336
1859 2585260091
1860 2643730853
1861 2643820524
1862 2643836339
1863 2644040409
1864 2644044494
1865 2644052815
1866 2644391581
1867 2819552833
1868 2848297396
1869 2852653950
1870 2852682655
1871 2879166468
1872 2882807029
1873 2896254686
1874 2919139694
1875 2990266414
1876 8054303044

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

32

153

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.8979 2 140
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.8878 1 142
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.8819 1 142
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.8792 5 140
5nq6-assembly1.cif.gz_A crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution 0.8556 6 140
ID Description Score Start End Superfamily
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8972 18 141 3.90.1010.10
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8878 1 142 3.90.1010.10
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8819 1 142 3.90.1010.10
af_Q10RM2_1_106_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8744 36 141 3.90.1010.10
af_O96155_92_241_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8728 5 138 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A031JFY1-F1-model_v4 deleted 0.9841 1 141
AF-A0A258GWD5-F1-model_v4 Fe-S metabolism protein SufE 0.9793 20 141
AF-A5VAI0-F1-model_v4 deleted 0.9775 2 142
AF-A0A3B9AWW5-F1-model_v4 deleted 0.9569 4 120
AF-A0A844Y0I1-F1-model_v4 SufE family protein 0.9562 4 141

Map