F486238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 364 | 1876 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10070364|Ga0065704_100703643 |
| Length | 159 |
| Sequence | MLRPALQFLPKPLALPAPALKCGAMRSLDDIREEYEFLDGDERYRLLIELGRELDEMPDALKTDATRVRGCSASVWVYPAAKDDGTLHFLADSNAAITKGIVALVIAAVQDRPAREVAETDIAAALEPFELRKQLSSNRTQGVPNMIALIRETAARYAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 281 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 282 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 283 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 284 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 285 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 286 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 287 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 323 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 325 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 337 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 341 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 342 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 343 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 344 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 345 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 346 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 347 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 348 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 349 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 350 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 351 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 352 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 353 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 354 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 355 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 356 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 357 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 358 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 359 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 360 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 361 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 362 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 363 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 364 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 12.05 |
| Nodule | 0.53 |
| Rhizoplane | 4.16 |
| Rhizosphere | 77.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10070364 | 3300005289 | Bacteria | 29548 |
| 2 | SwRhRL2b_contig_1406535 | 2162886007 | Bacteria | 6769 |
| 3 | SwRhRL2b_contig_3703961 | 2162886007 | Bacteria | 12985 |
| 4 | ARcpr5yngRDRAFT_c002434 | 3300000043 | Bacteria | 1933 |
| 5 | JGI24736J21556_1053072 | 3300001904 | Bacteria | 625 |
| 6 | JGI24752J21851_1000535 | 3300001976 | Bacteria | 5053 |
| 7 | JGI24740J21852_10006386 | 3300001979 | Bacteria | 4887 |
| 8 | JGI24739J22299_10000378 | 3300001989 | Bacteria | 15359 |
| 9 | JGI24739J22299_10002487 | 3300001989 | Bacteria | 7113 |
| 10 | JGI24739J22299_10030758 | 3300001989 | Bacteria | 1860 |
| 11 | JGI24737J22298_10000438 | 3300001990 | Bacteria | 14246 |
| 12 | JGI24737J22298_10001931 | 3300001990 | Bacteria | 7414 |
| 13 | JGI24737J22298_10034699 | 3300001990 | Bacteria | 1564 |
| 14 | JGI24738J21930_10003426 | 3300002075 | Bacteria | 4002 |
| 15 | JGI24738J21930_10012231 | 3300002075 | Bacteria | 1875 |
| 16 | JGI24034J26672_10062163 | 3300002239 | Bacteria | 657 |
| 17 | JGI24751J29686_10000388 | 3300002459 | Bacteria | 14720 |
| 18 | Ga0055537_1002075 | 3300003773 | Bacteria | 7055 |
| 19 | Ga0055524_1000654 | 3300003775 | Bacteria | 24493 |
| 20 | Ga0055536_1002435 | 3300003781 | Bacteria | 10457 |
| 21 | Ga0055536_1008890 | 3300003781 | Bacteria | 4242 |
| 22 | Ga0055534_1026657 | 3300003784 | Bacteria | 917 |
| 23 | Ga0055534_1028314 | 3300003784 | Bacteria | 879 |
| 24 | Ga0055528_1034380 | 3300003790 | Bacteria | 1250 |
| 25 | Ga0055530_10000522 | 3300003791 | Bacteria | 33291 |
| 26 | Ga0055531_10004791 | 3300003794 | Bacteria | 8082 |
| 27 | Ga0055531_10017316 | 3300003794 | Bacteria | 3050 |
| 28 | Ga0065165_1004978 | 3300005262 | Bacteria | 7794 |
| 29 | Ga0065165_1007901 | 3300005262 | Bacteria | 5102 |
| 30 | Ga0065704_10076703 | 3300005289 | Bacteria | 5010 |
| 31 | Ga0065704_10092310 | 3300005289 | Bacteria | 2662 |
| 32 | Ga0065712_10158463 | 3300005290 | Bacteria | 1319 |
| 33 | Ga0065712_10288054 | 3300005290 | Bacteria | 883 |
| 34 | Ga0065707_10081738 | 3300005295 | Bacteria | 54410 |
| 35 | Ga0065707_10119699 | 3300005295 | Bacteria | 2153 |
| 36 | Ga0065707_10245569 | 3300005295 | Bacteria | 1141 |
| 37 | Ga0070658_10003538 | 3300005327 | Bacteria | 12823 |
| 38 | Ga0070658_10004563 | 3300005327 | Bacteria | 11255 |
| 39 | Ga0070658_10005934 | 3300005327 | Bacteria | 9911 |
| 40 | Ga0070676_10005815 | 3300005328 | Bacteria | 6575 |
| 41 | Ga0070683_100005945 | 3300005329 | Bacteria | 10211 |
| 42 | Ga0070690_100643257 | 3300005330 | Bacteria | 809 |
| 43 | Ga0070690_101170409 | 3300005330 | Bacteria | 612 |
| 44 | Ga0070670_100000168 | 3300005331 | Bacteria | 59111 |
| 45 | Ga0070670_100000340 | 3300005331 | Bacteria | 39096 |
| 46 | Ga0070670_100034717 | 3300005331 | Bacteria | 4340 |
| 47 | Ga0070670_100061834 | 3300005331 | Bacteria | 3214 |
| 48 | Ga0070670_100273001 | 3300005331 | Bacteria | 1476 |
| 49 | Ga0070677_10000460 | 3300005333 | Bacteria | 13951 |
| 50 | Ga0070677_10457904 | 3300005333 | Bacteria | 684 |
| 51 | Ga0068869_100000736 | 3300005334 | Bacteria | 18613 |
| 52 | Ga0068869_100054511 | 3300005334 | Bacteria | 2911 |
| 53 | Ga0070666_10000380 | 3300005335 | Bacteria | 27930 |
| 54 | Ga0070666_10060890 | 3300005335 | Bacteria | 2555 |
| 55 | Ga0070666_10346367 | 3300005335 | Bacteria | 1063 |
| 56 | Ga0070680_100651464 | 3300005336 | Bacteria | 905 |
| 57 | Ga0070682_100098702 | 3300005337 | Bacteria | 1924 |
| 58 | Ga0068868_100006361 | 3300005338 | Bacteria | 8354 |
| 59 | Ga0070660_100000061 | 3300005339 | Bacteria | 63766 |
| 60 | Ga0070660_100000560 | 3300005339 | Bacteria | 24966 |
| 61 | Ga0070660_100050689 | 3300005339 | Bacteria | 3194 |
| 62 | Ga0070660_100323789 | 3300005339 | Bacteria | 1267 |
| 63 | Ga0070689_100075351 | 3300005340 | Bacteria | 2642 |
| 64 | Ga0070689_100613862 | 3300005340 | Bacteria | 943 |
| 65 | Ga0070687_100203935 | 3300005343 | Bacteria | 1200 |
| 66 | Ga0070687_101223316 | 3300005343 | Bacteria | 555 |
| 67 | Ga0070661_100000075 | 3300005344 | Bacteria | 79164 |
| 68 | Ga0070661_100080858 | 3300005344 | Bacteria | 2398 |
| 69 | Ga0070661_100181140 | 3300005344 | Bacteria | 1603 |
| 70 | Ga0070661_100335319 | 3300005344 | Unclassified | 1184 |
| 71 | Ga0070661_100511561 | 3300005344 | Bacteria | 962 |
| 72 | Ga0070692_10015367 | 3300005345 | Bacteria | 3621 |
| 73 | Ga0070692_10236840 | 3300005345 | Bacteria | 1086 |
| 74 | Ga0070692_10875241 | 3300005345 | Bacteria | 619 |
| 75 | Ga0070668_100001470 | 3300005347 | Bacteria | 17008 |
| 76 | Ga0070668_100005494 | 3300005347 | Bacteria | 9398 |
| 77 | Ga0070668_100027478 | 3300005347 | Bacteria | 4320 |
| 78 | Ga0070668_100599030 | 3300005347 | Bacteria | 964 |
| 79 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 80 | Ga0070669_100000270 | 3300005353 | Bacteria | 42327 |
| 81 | Ga0070669_100000565 | 3300005353 | Bacteria | 27565 |
| 82 | Ga0070669_100002327 | 3300005353 | Bacteria | 13743 |
| 83 | Ga0070669_100004540 | 3300005353 | Bacteria | 10022 |
| 84 | Ga0070669_100071233 | 3300005353 | Bacteria | 2571 |
| 85 | Ga0070669_100115681 | 3300005353 | Bacteria | 2040 |
| 86 | Ga0070669_100894534 | 3300005353 | Bacteria | 758 |
| 87 | Ga0070671_100000116 | 3300005355 | Bacteria | 51559 |
| 88 | Ga0070671_100018850 | 3300005355 | Bacteria | 5609 |
| 89 | Ga0070671_100031625 | 3300005355 | Bacteria | 4373 |
| 90 | Ga0070671_100049808 | 3300005355 | Bacteria | 3485 |
| 91 | Ga0070671_100062925 | 3300005355 | Bacteria | 3089 |
| 92 | Ga0070671_100136987 | 3300005355 | Bacteria | 2064 |
| 93 | Ga0070671_100158643 | 3300005355 | Bacteria | 1912 |
| 94 | Ga0070671_100531558 | 3300005355 | Bacteria | 1013 |
| 95 | Ga0070674_100011953 | 3300005356 | Bacteria | 5310 |
| 96 | Ga0070673_100010306 | 3300005364 | Bacteria | 6321 |
| 97 | Ga0070673_100084376 | 3300005364 | Bacteria | 2583 |
| 98 | Ga0070659_100004211 | 3300005366 | Bacteria | 10269 |
| 99 | Ga0070659_100004345 | 3300005366 | Bacteria | 10118 |
| 100 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 101 | Ga0070667_100000968 | 3300005367 | Bacteria | 26399 |
| 102 | Ga0070667_100001907 | 3300005367 | Bacteria | 18505 |
| 103 | Ga0070667_100002091 | 3300005367 | Bacteria | 17620 |
| 104 | Ga0070667_100013168 | 3300005367 | Bacteria | 6837 |
| 105 | Ga0070667_100017180 | 3300005367 | Bacteria | 5993 |
| 106 | Ga0070667_100083429 | 3300005367 | Bacteria | 2737 |
| 107 | Ga0070667_100091190 | 3300005367 | Bacteria | 2620 |
| 108 | Ga0070667_100125790 | 3300005367 | Bacteria | 2234 |
| 109 | Ga0070667_100155986 | 3300005367 | Bacteria | 2008 |
| 110 | Ga0070705_100026577 | 3300005440 | Bacteria | 3151 |
| 111 | Ga0070705_100161075 | 3300005440 | Bacteria | 1500 |
| 112 | Ga0070705_100178167 | 3300005440 | Bacteria | 1437 |
| 113 | Ga0070663_100004025 | 3300005455 | Bacteria | 8576 |
| 114 | Ga0070663_100040950 | 3300005455 | Bacteria | 3246 |
| 115 | Ga0070663_100068831 | 3300005455 | Bacteria | 2570 |
| 116 | Ga0070663_100160610 | 3300005455 | Bacteria | 1729 |
| 117 | Ga0070663_100361851 | 3300005455 | Bacteria | 1177 |
| 118 | Ga0070678_100922221 | 3300005456 | Bacteria | 799 |
| 119 | Ga0070678_101597531 | 3300005456 | Bacteria | 612 |
| 120 | Ga0070662_100003155 | 3300005457 | Bacteria | 10241 |
| 121 | Ga0070662_100003479 | 3300005457 | Bacteria | 9817 |
| 122 | Ga0070681_10599326 | 3300005458 | Bacteria | 1016 |
| 123 | Ga0068867_100008041 | 3300005459 | Bacteria | 7453 |
| 124 | Ga0070685_10265149 | 3300005466 | Bacteria | 1144 |
| 125 | Ga0070707_100126344 | 3300005468 | Bacteria | 2485 |
| 126 | Ga0070679_101463737 | 3300005530 | Bacteria | 630 |
| 127 | Ga0070684_100097876 | 3300005535 | Bacteria | 2617 |
| 128 | Ga0070684_101912474 | 3300005535 | Bacteria | 560 |
| 129 | Ga0068853_100006609 | 3300005539 | Bacteria | 9230 |
| 130 | Ga0068853_100032999 | 3300005539 | Bacteria | 4389 |
| 131 | Ga0068853_102118200 | 3300005539 | Bacteria | 545 |
| 132 | Ga0070672_100061279 | 3300005543 | Bacteria | 2965 |
| 133 | Ga0070672_100558772 | 3300005543 | Bacteria | 994 |
| 134 | Ga0070672_101043930 | 3300005543 | Bacteria | 725 |
| 135 | Ga0070686_101126069 | 3300005544 | Bacteria | 649 |
| 136 | Ga0070696_100040501 | 3300005546 | Bacteria | 3217 |
| 137 | Ga0070693_100011908 | 3300005547 | Bacteria | 4389 |
| 138 | Ga0070665_100001031 | 3300005548 | Bacteria | 34955 |
| 139 | Ga0070665_100005836 | 3300005548 | Bacteria | 12629 |
| 140 | Ga0070665_100015813 | 3300005548 | Bacteria | 7578 |
| 141 | Ga0070665_100019518 | 3300005548 | Bacteria | 6806 |
| 142 | Ga0070665_100027367 | 3300005548 | Bacteria | 5744 |
| 143 | Ga0070665_100176304 | 3300005548 | Bacteria | 2139 |
| 144 | Ga0068855_100000480 | 3300005563 | Bacteria | 49187 |
| 145 | Ga0068855_100002720 | 3300005563 | Bacteria | 21788 |
| 146 | Ga0068855_100010731 | 3300005563 | Bacteria | 11054 |
| 147 | Ga0068855_100154599 | 3300005563 | Bacteria | 2607 |
| 148 | Ga0068855_100169820 | 3300005563 | Bacteria | 2471 |
| 149 | Ga0068855_100396531 | 3300005563 | Bacteria | 1513 |
| 150 | Ga0070664_100004841 | 3300005564 | Bacteria | 10784 |
| 151 | Ga0070664_100126949 | 3300005564 | Bacteria | 2238 |
| 152 | Ga0070664_100283199 | 3300005564 | Bacteria | 1495 |
| 153 | Ga0070664_100917863 | 3300005564 | Bacteria | 821 |
| 154 | Ga0068857_100011311 | 3300005577 | Bacteria | 7764 |
| 155 | Ga0068857_100068787 | 3300005577 | Bacteria | 3152 |
| 156 | Ga0068857_100178585 | 3300005577 | Bacteria | 1932 |
| 157 | Ga0068857_100188390 | 3300005577 | Bacteria | 1879 |
| 158 | Ga0068857_100250219 | 3300005577 | Bacteria | 1624 |
| 159 | Ga0068857_100290962 | 3300005577 | Bacteria | 1504 |
| 160 | Ga0068854_100001621 | 3300005578 | Bacteria | 13690 |
| 161 | Ga0068854_100020124 | 3300005578 | Bacteria | 4509 |
| 162 | Ga0068854_100028696 | 3300005578 | Bacteria | 3847 |
| 163 | Ga0068854_100070209 | 3300005578 | Bacteria | 2560 |
| 164 | Ga0068854_100422727 | 3300005578 | Bacteria | 1107 |
| 165 | Ga0068856_100000538 | 3300005614 | Bacteria | 41802 |
| 166 | Ga0068856_100049729 | 3300005614 | Bacteria | 4132 |
| 167 | Ga0068856_100059828 | 3300005614 | Bacteria | 3763 |
| 168 | Ga0068856_100658421 | 3300005614 | Bacteria | 1068 |
| 169 | Ga0068852_100000117 | 3300005616 | Bacteria | 53907 |
| 170 | Ga0068852_100001259 | 3300005616 | Bacteria | 16883 |
| 171 | Ga0068852_100072095 | 3300005616 | Bacteria | 3035 |
| 172 | Ga0068852_101048393 | 3300005616 | Bacteria | 835 |
| 173 | Ga0068859_100000390 | 3300005617 | Bacteria | 43803 |
| 174 | Ga0068859_100028682 | 3300005617 | Bacteria | 5581 |
| 175 | Ga0068859_100060129 | 3300005617 | Bacteria | 3829 |
| 176 | Ga0068859_100071713 | 3300005617 | Bacteria | 3500 |
| 177 | Ga0068859_100106828 | 3300005617 | Bacteria | 2858 |
| 178 | Ga0068859_100189251 | 3300005617 | Bacteria | 2142 |
| 179 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 180 | Ga0068864_100001241 | 3300005618 | Bacteria | 21225 |
| 181 | Ga0068864_100001790 | 3300005618 | Bacteria | 17627 |
| 182 | Ga0068864_100179807 | 3300005618 | Bacteria | 1933 |
| 183 | Ga0068864_100274952 | 3300005618 | Bacteria | 1570 |
| 184 | Ga0068864_100291310 | 3300005618 | Bacteria | 1526 |
| 185 | Ga0068861_100000026 | 3300005719 | Bacteria | 69553 |
| 186 | Ga0068861_100109047 | 3300005719 | Bacteria | 2215 |
| 187 | Ga0068861_100561436 | 3300005719 | Bacteria | 1042 |
| 188 | Ga0068861_100627333 | 3300005719 | Bacteria | 990 |
| 189 | Ga0068851_10033091 | 3300005834 | Bacteria | 2575 |
| 190 | Ga0068851_10078667 | 3300005834 | Bacteria | 1718 |
| 191 | Ga0068851_10341629 | 3300005834 | Bacteria | 869 |
| 192 | Ga0068870_10082254 | 3300005840 | Bacteria | 1783 |
| 193 | Ga0068870_11217787 | 3300005840 | Bacteria | 546 |
| 194 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 195 | Ga0068863_100006362 | 3300005841 | Bacteria | 11582 |
| 196 | Ga0068863_100008110 | 3300005841 | Bacteria | 10251 |
| 197 | Ga0068863_100046312 | 3300005841 | Bacteria | 4127 |
| 198 | Ga0068863_100403611 | 3300005841 | Bacteria | 1337 |
| 199 | Ga0068858_100000713 | 3300005842 | Bacteria | 34726 |
| 200 | Ga0068858_100001247 | 3300005842 | Bacteria | 26301 |
| 201 | Ga0068858_100001777 | 3300005842 | Bacteria | 21988 |
| 202 | Ga0068858_100026353 | 3300005842 | Bacteria | 5403 |
| 203 | Ga0068858_100043444 | 3300005842 | Bacteria | 4167 |
| 204 | Ga0068858_100057071 | 3300005842 | Bacteria | 3608 |
| 205 | Ga0068858_100104177 | 3300005842 | Bacteria | 2647 |
| 206 | Ga0068858_100157761 | 3300005842 | Bacteria | 2135 |
| 207 | Ga0068858_100391700 | 3300005842 | Bacteria | 1334 |
| 208 | Ga0068858_101877700 | 3300005842 | Bacteria | 592 |
| 209 | Ga0068860_100000386 | 3300005843 | Bacteria | 57855 |
| 210 | Ga0068860_100003383 | 3300005843 | Bacteria | 16406 |
| 211 | Ga0068860_100009605 | 3300005843 | Bacteria | 9613 |
| 212 | Ga0068860_100032878 | 3300005843 | Bacteria | 4982 |
| 213 | Ga0068860_100033307 | 3300005843 | Bacteria | 4945 |
| 214 | Ga0068860_100074959 | 3300005843 | Bacteria | 3218 |
| 215 | Ga0068860_100228223 | 3300005843 | Bacteria | 1809 |
| 216 | Ga0068860_100582217 | 3300005843 | Bacteria | 1123 |
| 217 | Ga0068860_100652764 | 3300005843 | Bacteria | 1060 |
| 218 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 219 | Ga0068862_100000560 | 3300005844 | Bacteria | 38687 |
| 220 | Ga0068862_100022890 | 3300005844 | Bacteria | 5231 |
| 221 | Ga0068862_100100800 | 3300005844 | Bacteria | 2525 |
| 222 | Ga0068862_100105647 | 3300005844 | Bacteria | 2468 |
| 223 | Ga0068862_101142259 | 3300005844 | Bacteria | 775 |
| 224 | Ga0081539_10405381 | 3300005985 | Bacteria | 567 |
| 225 | Ga0075363_100000864 | 3300006048 | Bacteria | 10611 |
| 226 | Ga0075364_10006189 | 3300006051 | Bacteria | 7013 |
| 227 | Ga0075364_10140699 | 3300006051 | Bacteria | 1623 |
| 228 | Ga0075364_10319801 | 3300006051 | Bacteria | 1057 |
| 229 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 230 | Ga0075362_10034915 | 3300006177 | Bacteria | 2194 |
| 231 | Ga0075367_10582484 | 3300006178 | Bacteria | 711 |
| 232 | Ga0075369_10005083 | 3300006186 | Bacteria | 4906 |
| 233 | Ga0075369_10029336 | 3300006186 | Bacteria | 2310 |
| 234 | Ga0075369_10607114 | 3300006186 | Bacteria | 524 |
| 235 | Ga0075366_10000006 | 3300006195 | Bacteria | 106522 |
| 236 | Ga0075366_10003942 | 3300006195 | Bacteria | 7917 |
| 237 | Ga0075366_10058083 | 3300006195 | Bacteria | 2298 |
| 238 | Ga0075366_10715764 | 3300006195 | Bacteria | 622 |
| 239 | Ga0075366_10870028 | 3300006195 | Bacteria | 561 |
| 240 | Ga0097621_100185722 | 3300006237 | Bacteria | 1798 |
| 241 | Ga0097621_101942584 | 3300006237 | Bacteria | 562 |
| 242 | Ga0075370_10000008 | 3300006353 | Bacteria | 97966 |
| 243 | Ga0075370_10055793 | 3300006353 | Bacteria | 2244 |
| 244 | Ga0075370_10062887 | 3300006353 | Bacteria | 2115 |
| 245 | Ga0075370_10083223 | 3300006353 | Bacteria | 1841 |
| 246 | Ga0075370_10471773 | 3300006353 | Bacteria | 756 |
| 247 | Ga0068871_100067451 | 3300006358 | Bacteria | 2935 |
| 248 | Ga0068865_100047978 | 3300006881 | Bacteria | 2938 |
| 249 | Ga0068865_100083717 | 3300006881 | Bacteria | 2296 |
| 250 | Ga0097620_100000390 | 3300006931 | Bacteria | 43803 |
| 251 | Ga0097620_100028682 | 3300006931 | Bacteria | 5581 |
| 252 | Ga0097620_100060129 | 3300006931 | Bacteria | 3829 |
| 253 | Ga0097620_100071712 | 3300006931 | Bacteria | 3500 |
| 254 | Ga0097620_100106825 | 3300006931 | Bacteria | 2858 |
| 255 | Ga0097620_100189261 | 3300006931 | Bacteria | 2142 |
| 256 | Ga0079104_1024009 | 3300006946 | Bacteria | 1612 |
| 257 | Ga0079104_1057170 | 3300006946 | Bacteria | 851 |
| 258 | Ga0079104_1079198 | 3300006946 | Bacteria | 678 |
| 259 | Ga0075435_100726874 | 3300007076 | Bacteria | 863 |
| 260 | Ga0105251_10001526 | 3300009011 | Bacteria | 19872 |
| 261 | Ga0105251_10003021 | 3300009011 | Bacteria | 12550 |
| 262 | Ga0105251_10009342 | 3300009011 | Bacteria | 5798 |
| 263 | Ga0105251_10113933 | 3300009011 | Bacteria | 1230 |
| 264 | Ga0105250_10143007 | 3300009092 | Bacteria | 992 |
| 265 | Ga0105250_10183843 | 3300009092 | Bacteria | 878 |
| 266 | Ga0105240_10007704 | 3300009093 | Bacteria | 15580 |
| 267 | Ga0105240_10063792 | 3300009093 | Bacteria | 4581 |
| 268 | Ga0105240_10540999 | 3300009093 | Bacteria | 1290 |
| 269 | Ga0105245_10000782 | 3300009098 | Bacteria | 28837 |
| 270 | Ga0105247_10007366 | 3300009101 | Bacteria | 6760 |
| 271 | Ga0105247_10058521 | 3300009101 | Bacteria | 2384 |
| 272 | Ga0105243_10042556 | 3300009148 | Bacteria | 3556 |
| 273 | Ga0105243_10124096 | 3300009148 | Bacteria | 2182 |
| 274 | Ga0105243_10975884 | 3300009148 | Bacteria | 848 |
| 275 | Ga0105241_10250298 | 3300009174 | Bacteria | 1502 |
| 276 | Ga0105241_12191896 | 3300009174 | Bacteria | 548 |
| 277 | Ga0105248_10000443 | 3300009177 | Bacteria | 47083 |
| 278 | Ga0105248_10000536 | 3300009177 | Bacteria | 43208 |
| 279 | Ga0105248_10003369 | 3300009177 | Bacteria | 17753 |
| 280 | Ga0105248_10028337 | 3300009177 | Bacteria | 6240 |
| 281 | Ga0105248_10047856 | 3300009177 | Bacteria | 4796 |
| 282 | Ga0105248_10255746 | 3300009177 | Bacteria | 1972 |
| 283 | Ga0105248_10366421 | 3300009177 | Bacteria | 1622 |
| 284 | Ga0105237_11492110 | 3300009545 | Bacteria | 683 |
| 285 | Ga0105238_10079835 | 3300009551 | Bacteria | 3261 |
| 286 | Ga0105238_10235939 | 3300009551 | Bacteria | 1806 |
| 287 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 288 | Ga0105249_10000355 | 3300009553 | Bacteria | 45955 |
| 289 | Ga0105249_10031761 | 3300009553 | Bacteria | 4777 |
| 290 | Ga0105249_10034168 | 3300009553 | Bacteria | 4605 |
| 291 | Ga0105249_10074343 | 3300009553 | Bacteria | 3145 |
| 292 | Ga0105249_10101821 | 3300009553 | Bacteria | 2702 |
| 293 | Ga0105239_10020946 | 3300010375 | Bacteria | 7213 |
| 294 | Ga0105239_11431141 | 3300010375 | Bacteria | 798 |
| 295 | Ga0105246_10007706 | 3300011119 | Bacteria | 6605 |
| 296 | Ga0157326_1000245 | 3300012513 | Bacteria | 6347 |
| 297 | Ga0157373_10155054 | 3300013100 | Bacteria | 1611 |
| 298 | Ga0157373_10222602 | 3300013100 | Unclassified | 1331 |
| 299 | Ga0157371_10000458 | 3300013102 | Bacteria | 50035 |
| 300 | Ga0157371_10008659 | 3300013102 | Bacteria | 8083 |
| 301 | Ga0157371_10013469 | 3300013102 | Bacteria | 6208 |
| 302 | Ga0157371_10055053 | 3300013102 | Bacteria | 2823 |
| 303 | Ga0157370_10005413 | 3300013104 | Bacteria | 14323 |
| 304 | Ga0157370_10054922 | 3300013104 | Bacteria | 3796 |
| 305 | Ga0157370_10124747 | 3300013104 | Bacteria | 2404 |
| 306 | Ga0157369_10012733 | 3300013105 | Bacteria | 9537 |
| 307 | Ga0157369_10113197 | 3300013105 | Bacteria | 2883 |
| 308 | Ga0157369_10750459 | 3300013105 | Bacteria | 1004 |
| 309 | Ga0157374_10121558 | 3300013296 | Bacteria | 2521 |
| 310 | Ga0157374_11342174 | 3300013296 | Bacteria | 737 |
| 311 | Ga0157378_10049574 | 3300013297 | Bacteria | 3735 |
| 312 | Ga0157378_10143383 | 3300013297 | Bacteria | 2220 |
| 313 | Ga0157378_10668599 | 3300013297 | Bacteria | 1056 |
| 314 | Ga0163162_10008854 | 3300013306 | Bacteria | 9785 |
| 315 | Ga0163162_10042347 | 3300013306 | Bacteria | 4557 |
| 316 | Ga0163162_10042864 | 3300013306 | Bacteria | 4530 |
| 317 | Ga0163162_10114319 | 3300013306 | Bacteria | 2798 |
| 318 | Ga0163162_10122097 | 3300013306 | Bacteria | 2710 |
| 319 | Ga0157372_10696870 | 3300013307 | Bacteria | 1182 |
| 320 | Ga0157372_10880398 | 3300013307 | Bacteria | 1039 |
| 321 | Ga0157372_13072220 | 3300013307 | Bacteria | 533 |
| 322 | Ga0157375_10115316 | 3300013308 | Bacteria | 2789 |
| 323 | Ga0163163_10000058 | 3300014325 | Bacteria | 123478 |
| 324 | Ga0163163_10079077 | 3300014325 | Bacteria | 3286 |
| 325 | Ga0163163_10331161 | 3300014325 | Bacteria | 1577 |
| 326 | Ga0163163_10348097 | 3300014325 | Bacteria | 1537 |
| 327 | Ga0163163_11156113 | 3300014325 | Bacteria | 837 |
| 328 | Ga0163163_11194356 | 3300014325 | Bacteria | 823 |
| 329 | Ga0157380_10000338 | 3300014326 | Bacteria | 27963 |
| 330 | Ga0157380_10146890 | 3300014326 | Bacteria | 2033 |
| 331 | Ga0157380_10524023 | 3300014326 | Bacteria | 1156 |
| 332 | Ga0157377_10072623 | 3300014745 | Bacteria | 1992 |
| 333 | Ga0157379_10009670 | 3300014968 | Bacteria | 8392 |
| 334 | Ga0157379_10015929 | 3300014968 | Bacteria | 6608 |
| 335 | Ga0157379_10069392 | 3300014968 | Bacteria | 3152 |
| 336 | Ga0157376_11278812 | 3300014969 | Bacteria | 763 |
| 337 | Ga0163161_10001269 | 3300017792 | Bacteria | 18855 |
| 338 | Ga0163161_10087437 | 3300017792 | Bacteria | 2302 |
| 339 | Ga0163161_10539498 | 3300017792 | Bacteria | 955 |
| 340 | Ga0163161_10723031 | 3300017792 | Bacteria | 831 |
| 341 | Ga0207425_1005665 | 3300025245 | Bacteria | 3525 |
| 342 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 343 | Ga0209565_1042448 | 3300025263 | Bacteria | 843 |
| 344 | Ga0209673_1001996 | 3300025273 | Bacteria | 15785 |
| 345 | Ga0209675_1001006 | 3300025291 | Bacteria | 17716 |
| 346 | Ga0209675_1006218 | 3300025291 | Bacteria | 4836 |
| 347 | Ga0209676_1000557 | 3300025292 | Bacteria | 56440 |
| 348 | Ga0209676_1002559 | 3300025292 | Bacteria | 12585 |
| 349 | Ga0209676_1015956 | 3300025292 | Bacteria | 2739 |
| 350 | Ga0209025_1006073 | 3300025294 | Bacteria | 9549 |
| 351 | Ga0209025_1059735 | 3300025294 | Bacteria | 1436 |
| 352 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 353 | Ga0209050_1013704 | 3300025298 | Bacteria | 3572 |
| 354 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 355 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 356 | Ga0209257_1001118 | 3300025304 | Bacteria | 34674 |
| 357 | Ga0209257_1001176 | 3300025304 | Bacteria | 33109 |
| 358 | Ga0209257_1001491 | 3300025304 | Bacteria | 27480 |
| 359 | Ga0209257_1001719 | 3300025304 | Bacteria | 24483 |
| 360 | Ga0209257_1054400 | 3300025304 | Bacteria | 1114 |
| 361 | Ga0207697_10001744 | 3300025315 | Bacteria | 11683 |
| 362 | Ga0207697_10003187 | 3300025315 | Bacteria | 8160 |
| 363 | Ga0207697_10040420 | 3300025315 | Bacteria | 1915 |
| 364 | Ga0207697_10253506 | 3300025315 | Bacteria | 778 |
| 365 | Ga0207656_10014271 | 3300025321 | Bacteria | 3056 |
| 366 | Ga0207656_10203038 | 3300025321 | Bacteria | 958 |
| 367 | Ga0207656_10397706 | 3300025321 | Bacteria | 692 |
| 368 | Ga0207713_1002174 | 3300025735 | Bacteria | 14541 |
| 369 | Ga0207713_1008296 | 3300025735 | Bacteria | 6000 |
| 370 | Ga0207713_1012977 | 3300025735 | Bacteria | 4422 |
| 371 | Ga0207682_10000990 | 3300025893 | Bacteria | 13121 |
| 372 | Ga0207682_10409320 | 3300025893 | Bacteria | 641 |
| 373 | Ga0207642_10204205 | 3300025899 | Bacteria | 1093 |
| 374 | Ga0207642_11004320 | 3300025899 | Bacteria | 537 |
| 375 | Ga0207710_10012829 | 3300025900 | Bacteria | 3529 |
| 376 | Ga0207710_10100506 | 3300025900 | Bacteria | 1363 |
| 377 | Ga0207710_10114879 | 3300025900 | Bacteria | 1281 |
| 378 | Ga0207688_10026749 | 3300025901 | Bacteria | 3174 |
| 379 | Ga0207688_10494475 | 3300025901 | Bacteria | 765 |
| 380 | Ga0207680_10000480 | 3300025903 | Bacteria | 18917 |
| 381 | Ga0207680_10020210 | 3300025903 | Bacteria | 3578 |
| 382 | Ga0207680_10106591 | 3300025903 | Bacteria | 1810 |
| 383 | Ga0207680_10109442 | 3300025903 | Bacteria | 1789 |
| 384 | Ga0207647_10016767 | 3300025904 | Bacteria | 4991 |
| 385 | Ga0207645_10015526 | 3300025907 | Bacteria | 5057 |
| 386 | Ga0207645_10075336 | 3300025907 | Bacteria | 2160 |
| 387 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 388 | Ga0207705_10000131 | 3300025909 | Bacteria | 81639 |
| 389 | Ga0207705_10002347 | 3300025909 | Bacteria | 14636 |
| 390 | Ga0207705_10754070 | 3300025909 | Bacteria | 756 |
| 391 | Ga0207654_10967562 | 3300025911 | Bacteria | 618 |
| 392 | Ga0207654_11201855 | 3300025911 | Bacteria | 553 |
| 393 | Ga0207695_10005830 | 3300025913 | Bacteria | 16198 |
| 394 | Ga0207695_10015638 | 3300025913 | Bacteria | 8925 |
| 395 | Ga0207695_10216217 | 3300025913 | Bacteria | 1825 |
| 396 | Ga0207695_10278236 | 3300025913 | Bacteria | 1567 |
| 397 | Ga0207695_10313200 | 3300025913 | Bacteria | 1459 |
| 398 | Ga0207671_11472218 | 3300025914 | Bacteria | 526 |
| 399 | Ga0207660_10517869 | 3300025917 | Bacteria | 968 |
| 400 | Ga0207662_10095343 | 3300025918 | Bacteria | 1836 |
| 401 | Ga0207662_10239122 | 3300025918 | Bacteria | 1188 |
| 402 | Ga0207657_10000126 | 3300025919 | Bacteria | 76430 |
| 403 | Ga0207657_10000181 | 3300025919 | Bacteria | 65099 |
| 404 | Ga0207657_10281435 | 3300025919 | Bacteria | 1320 |
| 405 | Ga0207649_10000937 | 3300025920 | Bacteria | 18258 |
| 406 | Ga0207649_10117784 | 3300025920 | Bacteria | 1786 |
| 407 | Ga0207649_10369724 | 3300025920 | Bacteria | 1066 |
| 408 | Ga0207646_10499675 | 3300025922 | Bacteria | 1096 |
| 409 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 410 | Ga0207681_10000038 | 3300025923 | Bacteria | 153694 |
| 411 | Ga0207681_10002968 | 3300025923 | Bacteria | 10674 |
| 412 | Ga0207681_10010000 | 3300025923 | Bacteria | 5806 |
| 413 | Ga0207681_10012300 | 3300025923 | Bacteria | 5278 |
| 414 | Ga0207681_10024877 | 3300025923 | Bacteria | 3846 |
| 415 | Ga0207681_10407023 | 3300025923 | Bacteria | 1100 |
| 416 | Ga0207681_10566210 | 3300025923 | Bacteria | 936 |
| 417 | Ga0207681_11001390 | 3300025923 | Bacteria | 701 |
| 418 | Ga0207694_10160837 | 3300025924 | Bacteria | 1814 |
| 419 | Ga0207694_10200744 | 3300025924 | Bacteria | 1622 |
| 420 | Ga0207650_10006484 | 3300025925 | Bacteria | 7975 |
| 421 | Ga0207650_10032491 | 3300025925 | Bacteria | 3775 |
| 422 | Ga0207650_10037790 | 3300025925 | Bacteria | 3521 |
| 423 | Ga0207650_10110967 | 3300025925 | Bacteria | 2123 |
| 424 | Ga0207650_10203512 | 3300025925 | Bacteria | 1587 |
| 425 | Ga0207650_10537563 | 3300025925 | Bacteria | 979 |
| 426 | Ga0207650_11885168 | 3300025925 | Bacteria | 505 |
| 427 | Ga0207687_10013795 | 3300025927 | Bacteria | 5278 |
| 428 | Ga0207644_10000191 | 3300025931 | Bacteria | 43874 |
| 429 | Ga0207644_10001603 | 3300025931 | Bacteria | 14603 |
| 430 | Ga0207644_10004437 | 3300025931 | Bacteria | 9110 |
| 431 | Ga0207644_10012689 | 3300025931 | Bacteria | 5601 |
| 432 | Ga0207644_10105191 | 3300025931 | Bacteria | 2126 |
| 433 | Ga0207644_10418068 | 3300025931 | Bacteria | 1098 |
| 434 | Ga0207690_10000106 | 3300025932 | Bacteria | 67786 |
| 435 | Ga0207690_10006739 | 3300025932 | Bacteria | 6808 |
| 436 | Ga0207690_10131116 | 3300025932 | Bacteria | 1835 |
| 437 | Ga0207690_10267028 | 3300025932 | Bacteria | 1328 |
| 438 | Ga0207706_10000151 | 3300025933 | Bacteria | 76455 |
| 439 | Ga0207706_10005896 | 3300025933 | Bacteria | 11395 |
| 440 | Ga0207706_10152465 | 3300025933 | Bacteria | 2033 |
| 441 | Ga0207706_10222113 | 3300025933 | Bacteria | 1654 |
| 442 | Ga0207709_10030191 | 3300025935 | Bacteria | 3151 |
| 443 | Ga0207709_10734474 | 3300025935 | Bacteria | 792 |
| 444 | Ga0207670_10108350 | 3300025936 | Bacteria | 1997 |
| 445 | Ga0207669_10006549 | 3300025937 | Bacteria | 5334 |
| 446 | Ga0207704_10082467 | 3300025938 | Bacteria | 2083 |
| 447 | Ga0207691_10007770 | 3300025940 | Bacteria | 10327 |
| 448 | Ga0207691_10641108 | 3300025940 | Bacteria | 898 |
| 449 | Ga0207691_10947811 | 3300025940 | Bacteria | 719 |
| 450 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 451 | Ga0207711_10001912 | 3300025941 | Bacteria | 18916 |
| 452 | Ga0207711_10031022 | 3300025941 | Bacteria | 4510 |
| 453 | Ga0207711_10032649 | 3300025941 | Bacteria | 4401 |
| 454 | Ga0207711_10087303 | 3300025941 | Bacteria | 2737 |
| 455 | Ga0207711_10770231 | 3300025941 | Bacteria | 897 |
| 456 | Ga0207689_10000167 | 3300025942 | Bacteria | 57116 |
| 457 | Ga0207689_10026962 | 3300025942 | Bacteria | 4810 |
| 458 | Ga0207689_10038989 | 3300025942 | Bacteria | 3934 |
| 459 | Ga0207689_10114392 | 3300025942 | Bacteria | 2218 |
| 460 | Ga0207661_10006497 | 3300025944 | Bacteria | 8265 |
| 461 | Ga0207679_10002382 | 3300025945 | Bacteria | 11568 |
| 462 | Ga0207679_10243751 | 3300025945 | Bacteria | 1524 |
| 463 | Ga0207679_10607754 | 3300025945 | Bacteria | 986 |
| 464 | Ga0207667_10000586 | 3300025949 | Bacteria | 47384 |
| 465 | Ga0207667_10002108 | 3300025949 | Bacteria | 24944 |
| 466 | Ga0207667_10003563 | 3300025949 | Bacteria | 19243 |
| 467 | Ga0207667_10070804 | 3300025949 | Bacteria | 3629 |
| 468 | Ga0207667_10125942 | 3300025949 | Bacteria | 2638 |
| 469 | Ga0207667_10138092 | 3300025949 | Bacteria | 2510 |
| 470 | Ga0207651_10001801 | 3300025960 | Bacteria | 9965 |
| 471 | Ga0207651_10074826 | 3300025960 | Bacteria | 2413 |
| 472 | Ga0207712_10000222 | 3300025961 | Bacteria | 56073 |
| 473 | Ga0207712_10001433 | 3300025961 | Bacteria | 16278 |
| 474 | Ga0207712_10014035 | 3300025961 | Bacteria | 5142 |
| 475 | Ga0207712_10026859 | 3300025961 | Bacteria | 3840 |
| 476 | Ga0207712_10129989 | 3300025961 | Bacteria | 1917 |
| 477 | Ga0207712_10375142 | 3300025961 | Bacteria | 1189 |
| 478 | Ga0207668_10000487 | 3300025972 | Bacteria | 24894 |
| 479 | Ga0207668_10003398 | 3300025972 | Bacteria | 9332 |
| 480 | Ga0207668_10053614 | 3300025972 | Bacteria | 2795 |
| 481 | Ga0207668_10071748 | 3300025972 | Bacteria | 2475 |
| 482 | Ga0207640_10002555 | 3300025981 | Bacteria | 9753 |
| 483 | Ga0207640_10015350 | 3300025981 | Bacteria | 4432 |
| 484 | Ga0207640_10019097 | 3300025981 | Bacteria | 4043 |
| 485 | Ga0207640_10025143 | 3300025981 | Bacteria | 3601 |
| 486 | Ga0207640_10035980 | 3300025981 | Bacteria | 3104 |
| 487 | Ga0207640_10147273 | 3300025981 | Bacteria | 1725 |
| 488 | Ga0207640_11595081 | 3300025981 | Bacteria | 588 |
| 489 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 490 | Ga0207658_10000344 | 3300025986 | Bacteria | 46055 |
| 491 | Ga0207658_10002000 | 3300025986 | Bacteria | 15211 |
| 492 | Ga0207658_10002624 | 3300025986 | Bacteria | 13051 |
| 493 | Ga0207658_10009484 | 3300025986 | Bacteria | 6605 |
| 494 | Ga0207658_10247537 | 3300025986 | Bacteria | 1513 |
| 495 | Ga0207658_10316648 | 3300025986 | Bacteria | 1349 |
| 496 | Ga0207658_10482501 | 3300025986 | Bacteria | 1102 |
| 497 | Ga0207658_11248043 | 3300025986 | Bacteria | 679 |
| 498 | Ga0207677_10002698 | 3300026023 | Bacteria | 9360 |
| 499 | Ga0207677_11478198 | 3300026023 | Bacteria | 627 |
| 500 | Ga0207703_10000600 | 3300026035 | Bacteria | 36585 |
| 501 | Ga0207703_10002947 | 3300026035 | Bacteria | 14448 |
| 502 | Ga0207703_10004946 | 3300026035 | Bacteria | 10819 |
| 503 | Ga0207703_10009186 | 3300026035 | Bacteria | 7778 |
| 504 | Ga0207703_10013748 | 3300026035 | Bacteria | 6310 |
| 505 | Ga0207703_10045860 | 3300026035 | Bacteria | 3517 |
| 506 | Ga0207703_10393275 | 3300026035 | Bacteria | 1285 |
| 507 | Ga0207703_10565543 | 3300026035 | Bacteria | 1073 |
| 508 | Ga0207703_11663387 | 3300026035 | Bacteria | 614 |
| 509 | Ga0207639_10000573 | 3300026041 | Bacteria | 25324 |
| 510 | Ga0207639_10002893 | 3300026041 | Bacteria | 11542 |
| 511 | Ga0207639_10216118 | 3300026041 | Bacteria | 1653 |
| 512 | Ga0207678_10006756 | 3300026067 | Bacteria | 10174 |
| 513 | Ga0207678_10010888 | 3300026067 | Bacteria | 7992 |
| 514 | Ga0207678_10342903 | 3300026067 | Bacteria | 1288 |
| 515 | Ga0207678_11229106 | 3300026067 | Bacteria | 663 |
| 516 | Ga0207702_10001045 | 3300026078 | Bacteria | 28350 |
| 517 | Ga0207702_10022777 | 3300026078 | Bacteria | 5196 |
| 518 | Ga0207702_10070405 | 3300026078 | Bacteria | 3008 |
| 519 | Ga0207702_10442956 | 3300026078 | Bacteria | 1259 |
| 520 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 521 | Ga0207641_10008748 | 3300026088 | Bacteria | 8364 |
| 522 | Ga0207641_10011097 | 3300026088 | Bacteria | 7390 |
| 523 | Ga0207641_10026721 | 3300026088 | Bacteria | 4765 |
| 524 | Ga0207641_10080480 | 3300026088 | Bacteria | 2826 |
| 525 | Ga0207641_10239071 | 3300026088 | Bacteria | 1691 |
| 526 | Ga0207641_10824529 | 3300026088 | Bacteria | 918 |
| 527 | Ga0207641_11156203 | 3300026088 | Bacteria | 773 |
| 528 | Ga0207641_11210153 | 3300026088 | Bacteria | 755 |
| 529 | Ga0207648_10001222 | 3300026089 | Bacteria | 28812 |
| 530 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 531 | Ga0207676_10000698 | 3300026095 | Bacteria | 26476 |
| 532 | Ga0207676_10007892 | 3300026095 | Bacteria | 7571 |
| 533 | Ga0207676_10016650 | 3300026095 | Bacteria | 5325 |
| 534 | Ga0207676_10017345 | 3300026095 | Bacteria | 5217 |
| 535 | Ga0207676_10047378 | 3300026095 | Bacteria | 3331 |
| 536 | Ga0207676_10568396 | 3300026095 | Bacteria | 1085 |
| 537 | Ga0207674_10002073 | 3300026116 | Bacteria | 25416 |
| 538 | Ga0207674_10039134 | 3300026116 | Bacteria | 4917 |
| 539 | Ga0207674_10072353 | 3300026116 | Bacteria | 3463 |
| 540 | Ga0207674_10096441 | 3300026116 | Bacteria | 2942 |
| 541 | Ga0207674_10117552 | 3300026116 | Bacteria | 2629 |
| 542 | Ga0207674_10194949 | 3300026116 | Bacteria | 1975 |
| 543 | Ga0207674_10276148 | 3300026116 | Bacteria | 1628 |
| 544 | Ga0207674_10399476 | 3300026116 | Bacteria | 1328 |
| 545 | Ga0207674_10415813 | 3300026116 | Bacteria | 1299 |
| 546 | Ga0207674_10457039 | 3300026116 | Bacteria | 1234 |
| 547 | Ga0207675_100000219 | 3300026118 | Bacteria | 53753 |
| 548 | Ga0207675_100142165 | 3300026118 | Bacteria | 2280 |
| 549 | Ga0207675_100204155 | 3300026118 | Bacteria | 1899 |
| 550 | Ga0207675_100318808 | 3300026118 | Bacteria | 1517 |
| 551 | Ga0207675_101118764 | 3300026118 | Bacteria | 807 |
| 552 | Ga0207683_10135548 | 3300026121 | Bacteria | 2216 |
| 553 | Ga0207698_10000019 | 3300026142 | Bacteria | 145910 |
| 554 | Ga0207698_10002899 | 3300026142 | Bacteria | 10260 |
| 555 | Ga0207698_10070698 | 3300026142 | Bacteria | 2766 |
| 556 | Ga0207698_10142639 | 3300026142 | Bacteria | 2066 |
| 557 | Ga0207698_10188675 | 3300026142 | Bacteria | 1834 |
| 558 | Ga0209281_1014804 | 3300027111 | Bacteria | 1642 |
| 559 | Ga0209281_1039265 | 3300027111 | Bacteria | 804 |
| 560 | Ga0209982_1013472 | 3300027552 | Bacteria | 1232 |
| 561 | Ga0209982_1022706 | 3300027552 | Bacteria | 969 |
| 562 | Ga0209970_1010807 | 3300027614 | Bacteria | 1497 |
| 563 | Ga0209971_1017836 | 3300027682 | Bacteria | 1683 |
| 564 | Ga0209998_10186466 | 3300027717 | Bacteria | 540 |
| 565 | Ga0209974_10004612 | 3300027876 | Bacteria | 4903 |
| 566 | Ga0209974_10014620 | 3300027876 | Bacteria | 2610 |
| 567 | Ga0209974_10312981 | 3300027876 | Bacteria | 603 |
| 568 | Ga0268266_10000534 | 3300028379 | Bacteria | 53027 |
| 569 | Ga0268266_10000950 | 3300028379 | Bacteria | 36937 |
| 570 | Ga0268266_10005024 | 3300028379 | Bacteria | 12491 |
| 571 | Ga0268266_10017332 | 3300028379 | Bacteria | 6147 |
| 572 | Ga0268266_10227353 | 3300028379 | Bacteria | 1717 |
| 573 | Ga0268266_10531242 | 3300028379 | Bacteria | 1125 |
| 574 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 575 | Ga0268265_10000171 | 3300028380 | Bacteria | 77721 |
| 576 | Ga0268265_10009925 | 3300028380 | Bacteria | 6434 |
| 577 | Ga0268265_10015150 | 3300028380 | Bacteria | 5269 |
| 578 | Ga0268265_10161575 | 3300028380 | Bacteria | 1903 |
| 579 | Ga0268265_10269548 | 3300028380 | Bacteria | 1518 |
| 580 | Ga0268265_11703404 | 3300028380 | Bacteria | 636 |
| 581 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 582 | Ga0268264_10000221 | 3300028381 | Bacteria | 111397 |
| 583 | Ga0268264_10002127 | 3300028381 | Bacteria | 17671 |
| 584 | Ga0268264_10007794 | 3300028381 | Bacteria | 8916 |
| 585 | Ga0268264_10065660 | 3300028381 | Bacteria | 3058 |
| 586 | Ga0268264_10152292 | 3300028381 | Bacteria | 2075 |
| 587 | Ga0268264_10274083 | 3300028381 | Bacteria | 1577 |
| 588 | Ga0268264_10346882 | 3300028381 | Bacteria | 1412 |
| 589 | Ga0268264_10782600 | 3300028381 | Bacteria | 952 |
| 590 | Ga0265331_10065337 | 3300031250 | Bacteria | 1711 |
| 591 | Ga0265327_10034617 | 3300031251 | Bacteria | 2801 |
| 592 | Ga0307408_100012053 | 3300031548 | Bacteria | 5723 |
| 593 | Ga0307408_100049901 | 3300031548 | Bacteria | 3007 |
| 594 | Ga0307408_100190314 | 3300031548 | Bacteria | 1652 |
| 595 | Ga0307516_10371135 | 3300031730 | Bacteria | 1094 |
| 596 | Ga0307405_10000262 | 3300031731 | Bacteria | 19293 |
| 597 | Ga0307405_10024668 | 3300031731 | Bacteria | 3440 |
| 598 | Ga0307405_10048413 | 3300031731 | Bacteria | 2621 |
| 599 | Ga0307405_10153163 | 3300031731 | Bacteria | 1624 |
| 600 | Ga0307405_10243290 | 3300031731 | Bacteria | 1334 |
| 601 | Ga0307405_10305156 | 3300031731 | Bacteria | 1209 |
| 602 | Ga0307413_10007277 | 3300031824 | Bacteria | 5126 |
| 603 | Ga0307410_10006176 | 3300031852 | Bacteria | 6434 |
| 604 | Ga0307410_10025173 | 3300031852 | Bacteria | 3729 |
| 605 | Ga0307410_10056655 | 3300031852 | Bacteria | 2666 |
| 606 | Ga0307410_10193120 | 3300031852 | Bacteria | 1549 |
| 607 | Ga0307406_10022270 | 3300031901 | Bacteria | 3757 |
| 608 | Ga0307406_10069186 | 3300031901 | Bacteria | 2307 |
| 609 | Ga0307406_10095665 | 3300031901 | Bacteria | 2010 |
| 610 | Ga0307406_10698063 | 3300031901 | Bacteria | 847 |
| 611 | Ga0307406_10816607 | 3300031901 | Bacteria | 788 |
| 612 | Ga0307406_11221196 | 3300031901 | Bacteria | 653 |
| 613 | Ga0307407_10084128 | 3300031903 | Bacteria | 1932 |
| 614 | Ga0307407_10222348 | 3300031903 | Bacteria | 1277 |
| 615 | Ga0307407_10730005 | 3300031903 | Bacteria | 748 |
| 616 | Ga0307412_10001508 | 3300031911 | Bacteria | 12930 |
| 617 | Ga0307412_10022421 | 3300031911 | Bacteria | 3870 |
| 618 | Ga0307412_10076098 | 3300031911 | Bacteria | 2305 |
| 619 | Ga0307412_10515572 | 3300031911 | Bacteria | 998 |
| 620 | Ga0307412_10789314 | 3300031911 | Bacteria | 823 |
| 621 | Ga0307409_100005979 | 3300031995 | Bacteria | 7092 |
| 622 | Ga0307409_100045302 | 3300031995 | Bacteria | 3320 |
| 623 | Ga0307409_101671372 | 3300031995 | Bacteria | 665 |
| 624 | Ga0307409_102205409 | 3300031995 | Bacteria | 580 |
| 625 | Ga0307416_100144168 | 3300032002 | Bacteria | 2171 |
| 626 | Ga0307416_100157479 | 3300032002 | Bacteria | 2093 |
| 627 | Ga0307416_100230719 | 3300032002 | Bacteria | 1784 |
| 628 | Ga0307416_100463127 | 3300032002 | Bacteria | 1323 |
| 629 | Ga0307416_102562940 | 3300032002 | Bacteria | 608 |
| 630 | Ga0307414_10000705 | 3300032004 | Bacteria | 17072 |
| 631 | Ga0307414_10017082 | 3300032004 | Bacteria | 4431 |
| 632 | Ga0307414_10114396 | 3300032004 | Bacteria | 2061 |
| 633 | Ga0307414_10119340 | 3300032004 | Bacteria | 2024 |
| 634 | Ga0307414_10124929 | 3300032004 | Bacteria | 1986 |
| 635 | Ga0307414_10181758 | 3300032004 | Bacteria | 1692 |
| 636 | Ga0307414_10189567 | 3300032004 | Bacteria | 1662 |
| 637 | Ga0307414_10206534 | 3300032004 | Bacteria | 1602 |
| 638 | Ga0307414_10231185 | 3300032004 | Bacteria | 1525 |
| 639 | Ga0307414_10436456 | 3300032004 | Bacteria | 1145 |
| 640 | Ga0307411_10007342 | 3300032005 | Bacteria | 5604 |
| 641 | Ga0307411_10059438 | 3300032005 | Bacteria | 2534 |
| 642 | Ga0307411_10230647 | 3300032005 | Bacteria | 1443 |
| 643 | Ga0307411_10337202 | 3300032005 | Bacteria | 1224 |
| 644 | Ga0307411_10384891 | 3300032005 | Bacteria | 1155 |
| 645 | Ga0307415_100031388 | 3300032126 | Bacteria | 3422 |
| 646 | Ga0307415_100133080 | 3300032126 | Bacteria | 1886 |
| 647 | Ga0307415_100351848 | 3300032126 | Bacteria | 1240 |
| 648 | Ga0307415_100755663 | 3300032126 | Bacteria | 883 |
| 649 | Ga0307510_10083885 | 3300033180 | Bacteria | 3073 |
| 650 | Ga0373951_0058764 | 3300035091 | Bacteria | 959 |
| 651 | Ga0373939_0074121 | 3300035114 | Bacteria | 1116 |
| 652 | Ga0373960_0072439 | 3300035121 | Bacteria | 1068 |
| 653 | Ga0373961_0109640 | 3300035241 | Bacteria | 903 |
| 654 | Ga0373931_0127236 | 3300035691 | Bacteria | 1462 |
| 655 | Ga0373935_0763281 | 3300035692 | Bacteria | 713 |
| 656 | Ga0395899_0440488 | 3300037312 | Bacteria | 855 |
| 657 | Ga0395900_0009860 | 3300037418 | Bacteria | 9783 |
| 658 | Ga0395900_0036826 | 3300037418 | Bacteria | 5043 |
| 659 | Ga0395900_0036959 | 3300037418 | Bacteria | 5034 |
| 660 | Ga0395900_0147938 | 3300037418 | Bacteria | 2401 |
| 661 | Ga0395898_0222076 | 3300037466 | Bacteria | 1802 |
| 662 | Ga0395905_0001037 | 3300037471 | Bacteria | 35267 |
| 663 | Ga0395905_0034180 | 3300037471 | Bacteria | 4773 |
| 664 | Ga0395905_0088113 | 3300037471 | Bacteria | 2910 |
| 665 | Ga0395905_0413513 | 3300037471 | Bacteria | 1244 |
| 666 | Ga0395901_0000520 | 3300038443 | Bacteria | 44464 |
| 667 | Ga0395901_0023864 | 3300038443 | Bacteria | 6273 |
| 668 | Ga0395901_0190539 | 3300038443 | Bacteria | 2151 |
| 669 | Ga0451793_1762985 | 3300041452 | Bacteria | 888 |
| 670 | Ga0451802_0802543 | 3300041460 | Bacteria | 529 |
| 671 | Ga0451807_0428949 | 3300041486 | Bacteria | 500 |
| 672 | Ga0451841_1391331 | 3300041498 | Bacteria | 790 |
| 673 | Ga0451843_0163617 | 3300041509 | Bacteria | 820 |
| 674 | Ga0439448_0084102 | 3300042005 | Bacteria | 1071 |
| 675 | Ga0451577_0219922 | 3300042876 | Bacteria | 1717 |
| 676 | Ga0466966_0072754 | 3300044684 | Bacteria | 2151 |
| 677 | Ga0466961_0010535 | 3300044693 | Bacteria | 5896 |
| 678 | Ga0453684_0170418 | 3300044712 | Bacteria | 2566 |
| 679 | Ga0466971_0023088 | 3300044719 | Bacteria | 2772 |
| 680 | Ga0466957_0137866 | 3300044842 | Bacteria | 1569 |
| 681 | Ga0466959_0071933 | 3300045049 | Bacteria | 2503 |
| 682 | Ga0451576_0066192 | 3300045051 | Bacteria | 3762 |
| 683 | Ga0495627_000090 | 3300046453 | Bacteria | 109622 |
| 684 | Ga0495638_0190777 | 3300046460 | Bacteria | 1163 |
| 685 | Ga0495638_0228932 | 3300046460 | Bacteria | 1035 |
| 686 | Ga0495650_0000818 | 3300046471 | Bacteria | 37910 |
| 687 | Ga0495605_0122678 | 3300046474 | Bacteria | 1177 |
| 688 | Ga0495585_0190040 | 3300046492 | Bacteria | 1051 |
| 689 | Ga0495596_0000220 | 3300046500 | Bacteria | 39671 |
| 690 | Ga0495607_0010578 | 3300046501 | Bacteria | 6194 |
| 691 | Ga0495607_0178556 | 3300046501 | Bacteria | 1066 |
| 692 | Ga0495583_0004190 | 3300046506 | Bacteria | 10502 |
| 693 | Ga0495583_0026847 | 3300046506 | Bacteria | 2849 |
| 694 | Ga0495583_0075862 | 3300046506 | Bacteria | 1470 |
| 695 | Ga0495583_0128376 | 3300046506 | Bacteria | 1062 |
| 696 | Ga0495583_0139011 | 3300046506 | Bacteria | 1012 |
| 697 | Ga0495606_0016352 | 3300046507 | Bacteria | 5662 |
| 698 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 699 | Ga0495610_0000136 | 3300046512 | Bacteria | 82060 |
| 700 | Ga0495610_0004021 | 3300046512 | Bacteria | 11090 |
| 701 | Ga0495620_0022534 | 3300046515 | Bacteria | 3031 |
| 702 | Ga0495628_0785874 | 3300046516 | Bacteria | 667 |
| 703 | Ga0495632_0001659 | 3300046519 | Bacteria | 18247 |
| 704 | Ga0495632_0112457 | 3300046519 | Bacteria | 1277 |
| 705 | Ga0495637_0014537 | 3300046520 | Bacteria | 3713 |
| 706 | Ga0495637_0025547 | 3300046520 | Bacteria | 2661 |
| 707 | Ga0495643_0000107 | 3300046522 | Bacteria | 138292 |
| 708 | Ga0495643_0097275 | 3300046522 | Bacteria | 1513 |
| 709 | Ga0495643_0201137 | 3300046522 | Bacteria | 956 |
| 710 | Ga0495663_0088692 | 3300046525 | Bacteria | 1006 |
| 711 | Ga0495642_0400622 | 3300046528 | Bacteria | 605 |
| 712 | Ga0495654_0000348 | 3300046530 | Bacteria | 39921 |
| 713 | Ga0495654_0089216 | 3300046530 | Bacteria | 1433 |
| 714 | Ga0495609_0003765 | 3300046538 | Bacteria | 8554 |
| 715 | Ga0495597_0131484 | 3300046542 | Bacteria | 1038 |
| 716 | Ga0495633_0170734 | 3300046558 | Bacteria | 1002 |
| 717 | Ga0495668_0007799 | 3300046616 | Bacteria | 6786 |
| 718 | Ga0495668_0086684 | 3300046616 | Bacteria | 1717 |
| 719 | Ga0495668_0260122 | 3300046616 | Bacteria | 950 |
| 720 | Ga0495625_0000729 | 3300046660 | Bacteria | 46117 |
| 721 | Ga0495625_0001717 | 3300046660 | Bacteria | 25448 |
| 722 | Ga0495625_0005843 | 3300046660 | Bacteria | 11094 |
| 723 | Ga0495625_0103863 | 3300046660 | Bacteria | 1948 |
| 724 | Ga0495625_0343455 | 3300046660 | Bacteria | 945 |
| 725 | Ga0495625_0410461 | 3300046660 | Bacteria | 844 |
| 726 | Ga0495659_0009203 | 3300046664 | Bacteria | 3150 |
| 727 | Ga0495661_0220157 | 3300046665 | Bacteria | 984 |
| 728 | Ga0495669_0000323 | 3300046684 | Bacteria | 26217 |
| 729 | Ga0495669_0016445 | 3300046684 | Bacteria | 3168 |
| 730 | Ga0495669_0155760 | 3300046684 | Bacteria | 1083 |
| 731 | Ga0495670_0014290 | 3300046691 | Bacteria | 3905 |
| 732 | Ga0495670_0456521 | 3300046691 | Bacteria | 692 |
| 733 | Ga0495671_0014236 | 3300046692 | Bacteria | 4286 |
| 734 | Ga0495649_0264028 | 3300046694 | Bacteria | 882 |
| 735 | Ga0495660_0187810 | 3300046810 | Bacteria | 995 |
| 736 | Ga0495660_0342543 | 3300046810 | Bacteria | 666 |
| 737 | Ga0495676_0322320 | 3300047321 | Bacteria | 1038 |
| 738 | Ga0495687_000211 | 3300047443 | Bacteria | 83788 |
| 739 | Ga0495681_0000048 | 3300047470 | Bacteria | 110216 |
| 740 | Ga0495686_0068262 | 3300047472 | Bacteria | 2193 |
| 741 | Ga0495626_0000214 | 3300048091 | Bacteria | 69009 |
| 742 | Ga0496101_1037503 | 3300048904 | Bacteria | 644 |
| 743 | Ga0496102_0076001 | 3300048905 | Bacteria | 3088 |
| 744 | Ga0496102_0566240 | 3300048905 | Bacteria | 1059 |
| 745 | Ga0496102_1204213 | 3300048905 | Bacteria | 677 |
| 746 | Ga0496103_0016964 | 3300048906 | Bacteria | 4350 |
| 747 | Ga0496103_0018712 | 3300048906 | Bacteria | 4156 |
| 748 | Ga0496103_0063602 | 3300048906 | Bacteria | 2299 |
| 749 | Ga0496103_0359958 | 3300048906 | Bacteria | 935 |
| 750 | Ga0496104_0239029 | 3300048907 | Bacteria | 1728 |
| 751 | Ga0496104_0293281 | 3300048907 | Bacteria | 1539 |
| 752 | Ga0496105_0000870 | 3300048908 | Bacteria | 20664 |
| 753 | Ga0496105_0577060 | 3300048908 | Bacteria | 875 |
| 754 | Ga0496105_0710761 | 3300048908 | Bacteria | 771 |
| 755 | Ga0496105_0858534 | 3300048908 | Bacteria | 686 |
| 756 | Ga0496105_0998803 | 3300048908 | Bacteria | 626 |
| 757 | Ga0496106_0047548 | 3300048909 | Bacteria | 3229 |
| 758 | Ga0496106_0079891 | 3300048909 | Bacteria | 2511 |
| 759 | Ga0496107_0020316 | 3300048910 | Bacteria | 4689 |
| 760 | Ga0496107_0212219 | 3300048910 | Bacteria | 1440 |
| 761 | Ga0496107_0659897 | 3300048910 | Bacteria | 771 |
| 762 | Ga0496108_0070946 | 3300048911 | Bacteria | 2940 |
| 763 | Ga0496108_1106633 | 3300048911 | Bacteria | 673 |
| 764 | Ga0496109_0240217 | 3300048912 | Bacteria | 1705 |
| 765 | Ga0496109_1168217 | 3300048912 | Bacteria | 706 |
| 766 | Ga0496109_1204878 | 3300048912 | Bacteria | 694 |
| 767 | Ga0496110_0063483 | 3300048913 | Bacteria | 3264 |
| 768 | Ga0496110_0081472 | 3300048913 | Bacteria | 2885 |
| 769 | Ga0496110_0102725 | 3300048913 | Bacteria | 2564 |
| 770 | Ga0496110_0622166 | 3300048913 | Bacteria | 978 |
| 771 | Ga0496111_0313364 | 3300048914 | Bacteria | 1162 |
| 772 | Ga0496111_0663962 | 3300048914 | Bacteria | 760 |
| 773 | Ga0496112_0568554 | 3300048915 | Bacteria | 1067 |
| 774 | Ga0496113_0059478 | 3300048916 | Bacteria | 2878 |
| 775 | Ga0496113_0651768 | 3300048916 | Bacteria | 842 |
| 776 | Ga0496114_0000019 | 3300048917 | Bacteria | 244365 |
| 777 | Ga0496114_0429606 | 3300048917 | Bacteria | 1170 |
| 778 | Ga0496116_0000284 | 3300048919 | Bacteria | 86342 |
| 779 | Ga0496116_0075635 | 3300048919 | Bacteria | 2112 |
| 780 | Ga0496117_0010298 | 3300048920 | Bacteria | 8550 |
| 781 | Ga0496117_0076028 | 3300048920 | Bacteria | 2228 |
| 782 | Ga0496117_0132944 | 3300048920 | Bacteria | 1504 |
| 783 | Ga0496118_0011723 | 3300048921 | Bacteria | 8520 |
| 784 | Ga0496118_0015199 | 3300048921 | Bacteria | 7148 |
| 785 | Ga0496118_0046055 | 3300048921 | Bacteria | 3397 |
| 786 | Ga0496118_0067419 | 3300048921 | Bacteria | 2606 |
| 787 | Ga0496119_0031689 | 3300048922 | Bacteria | 3538 |
| 788 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 789 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 790 | Ga0496121_0000997 | 3300048924 | Bacteria | 50601 |
| 791 | Ga0496121_0003197 | 3300048924 | Bacteria | 23595 |
| 792 | Ga0496121_0007129 | 3300048924 | Bacteria | 13564 |
| 793 | Ga0496121_0272027 | 3300048924 | Bacteria | 1164 |
| 794 | Ga0496121_0307996 | 3300048924 | Bacteria | 1072 |
| 795 | Ga0496122_0006671 | 3300048925 | Bacteria | 13150 |
| 796 | Ga0496122_0027860 | 3300048925 | Bacteria | 4816 |
| 797 | Ga0496122_0047866 | 3300048925 | Bacteria | 3295 |
| 798 | Ga0496122_0108828 | 3300048925 | Bacteria | 1827 |
| 799 | Ga0496123_0045999 | 3300048926 | Bacteria | 2965 |
| 800 | Ga0496123_0055813 | 3300048926 | Bacteria | 2587 |
| 801 | Ga0496123_0095952 | 3300048926 | Bacteria | 1743 |
| 802 | Ga0496123_0130326 | 3300048926 | Bacteria | 1394 |
| 803 | Ga0496124_0011898 | 3300048927 | Bacteria | 8661 |
| 804 | Ga0496124_0017368 | 3300048927 | Bacteria | 6781 |
| 805 | Ga0496124_0113738 | 3300048927 | Bacteria | 2174 |
| 806 | Ga0496124_0180922 | 3300048927 | Bacteria | 1622 |
| 807 | Ga0496124_0196481 | 3300048927 | Bacteria | 1538 |
| 808 | Ga0496125_0014367 | 3300048928 | Bacteria | 7714 |
| 809 | Ga0496125_0037208 | 3300048928 | Bacteria | 4234 |
| 810 | Ga0496125_0067314 | 3300048928 | Bacteria | 2823 |
| 811 | Ga0496125_0139532 | 3300048928 | Bacteria | 1688 |
| 812 | Ga0496125_0229839 | 3300048928 | Bacteria | 1187 |
| 813 | Ga0496126_0006838 | 3300048929 | Bacteria | 12646 |
| 814 | Ga0496126_0020885 | 3300048929 | Bacteria | 6410 |
| 815 | Ga0496126_0023508 | 3300048929 | Bacteria | 5972 |
| 816 | Ga0496126_0131949 | 3300048929 | Bacteria | 2158 |
| 817 | Ga0496126_0385121 | 3300048929 | Bacteria | 1140 |
| 818 | Ga0496126_0654875 | 3300048929 | Bacteria | 821 |
| 819 | Ga0496126_0926250 | 3300048929 | Bacteria | 659 |
| 820 | Ga0495678_108597 | 3300049459 | Bacteria | 950 |
| 821 | Ga0501031_0012668 | 3300049568 | Bacteria | 5507 |
| 822 | Ga0501032_0016855 | 3300049569 | Bacteria | 5134 |
| 823 | Ga0501032_0418074 | 3300049569 | Bacteria | 860 |
| 824 | Ga0501033_0013889 | 3300049570 | Bacteria | 6127 |
| 825 | Ga0501033_0152832 | 3300049570 | Bacteria | 1664 |
| 826 | Ga0501034_0048157 | 3300049571 | Bacteria | 4302 |
| 827 | Ga0501034_0052172 | 3300049571 | Bacteria | 4121 |
| 828 | Ga0501034_0231460 | 3300049571 | Bacteria | 1797 |
| 829 | Ga0501034_0600222 | 3300049571 | Bacteria | 1006 |
| 830 | Ga0501034_1068472 | 3300049571 | Bacteria | 689 |
| 831 | Ga0501036_0059692 | 3300049572 | Bacteria | 3231 |
| 832 | Ga0501036_0896802 | 3300049572 | Bacteria | 728 |
| 833 | Ga0501037_0024223 | 3300049573 | Bacteria | 4488 |
| 834 | Ga0501037_0359574 | 3300049573 | Bacteria | 1003 |
| 835 | Ga0501038_0018181 | 3300049574 | Bacteria | 6347 |
| 836 | Ga0501038_0072817 | 3300049574 | Bacteria | 2911 |
| 837 | Ga0501039_0063228 | 3300049575 | Bacteria | 2868 |
| 838 | Ga0501039_0136516 | 3300049575 | Bacteria | 1926 |
| 839 | Ga0501042_1298334 | 3300049578 | Bacteria | 531 |
| 840 | Ga0501043_0153496 | 3300049579 | Bacteria | 1801 |
| 841 | Ga0501043_0374062 | 3300049579 | Bacteria | 1080 |
| 842 | Ga0501043_0837511 | 3300049579 | Bacteria | 663 |
| 843 | Ga0501046_0180782 | 3300049580 | Bacteria | 1577 |
| 844 | Ga0501047_0029560 | 3300049581 | Bacteria | 5283 |
| 845 | Ga0501047_0413045 | 3300049581 | Bacteria | 1182 |
| 846 | Ga0501071_0353295 | 3300049587 | Bacteria | 1119 |
| 847 | Ga0501072_1131691 | 3300049588 | Bacteria | 609 |
| 848 | Ga0501074_0210835 | 3300049590 | Bacteria | 1384 |
| 849 | Ga0501233_000055 | 3300049668 | Bacteria | 15138 |
| 850 | Ga0501249_012920 | 3300049679 | Bacteria | 1770 |
| 851 | Ga0501035_0012700 | 3300049822 | Bacteria | 7783 |
| 852 | Ga0501044_0001187 | 3300049823 | Bacteria | 30876 |
| 853 | Ga0501044_0026980 | 3300049823 | Bacteria | 6076 |
| 854 | Ga0501044_0048906 | 3300049823 | Bacteria | 4365 |
| 855 | Ga0501044_0504988 | 3300049823 | Bacteria | 1110 |
| 856 | Ga0501044_1423239 | 3300049823 | Bacteria | 559 |
| 857 | nmdc:mga03683_13_c1 | 3300050489 | Bacteria | 110533 |
| 858 | nmdc:mga03683_4523_c1 | 3300050489 | Bacteria | 4625 |
| 859 | nmdc:mga03n38_21620_c1 | 3300050490 | Bacteria | 2592 |
| 860 | nmdc:mga03n38_580207_c1 | 3300050490 | Bacteria | 637 |
| 861 | nmdc:mga00v17_10173_c2 | 3300050491 | Bacteria | 3815 |
| 862 | nmdc:mga00v17_3456_c1 | 3300050491 | Bacteria | 8173 |
| 863 | nmdc:mga00v17_513432_c1 | 3300050491 | Bacteria | 776 |
| 864 | nmdc:mga00v17_7174_c1 | 3300050491 | Bacteria | 5936 |
| 865 | nmdc:mga0k408_77105_c1 | 3300050493 | Bacteria | 1949 |
| 866 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 867 | nmdc:mga06z11_536639_c1 | 3300050494 | Bacteria | 710 |
| 868 | nmdc:mga07m45_20_c1 | 3300050496 | Bacteria | 126269 |
| 869 | nmdc:mga07m45_4375_c1 | 3300050496 | Bacteria | 3604 |
| 870 | nmdc:mga07m45_57468_c1 | 3300050496 | Bacteria | 2200 |
| 871 | nmdc:mga07m45_63400_c1 | 3300050496 | Bacteria | 2096 |
| 872 | nmdc:mga07m45_69354_c1 | 3300050496 | Bacteria | 2004 |
| 873 | nmdc:mga07m45_746212_c1 | 3300050496 | Bacteria | 562 |
| 874 | nmdc:mga0rr50_748349_c1 | 3300050513 | Bacteria | 834 |
| 875 | nmdc:mga0sz30_27879_c1 | 3300050516 | Bacteria | 2322 |
| 876 | nmdc:mga0sz30_3957_c1 | 3300050516 | Bacteria | 5342 |
| 877 | nmdc:mga0sz30_4821_c1 | 3300050516 | Bacteria | 4910 |
| 878 | nmdc:mga0sz30_541359_c1 | 3300050516 | Bacteria | 525 |
| 879 | Ga0500643_000219 | 3300053087 | Bacteria | 53403 |
| 880 | Ga0500643_002412 | 3300053087 | Bacteria | 9688 |
| 881 | Ga0500643_004161 | 3300053087 | Bacteria | 6638 |
| 882 | Ga0500643_006074 | 3300053087 | Bacteria | 5104 |
| 883 | Ga0500583_0211082 | 3300053092 | Bacteria | 964 |
| 884 | Ga0500566_0317890 | 3300053094 | Bacteria | 726 |
| 885 | Ga0500592_000128 | 3300053116 | Bacteria | 16344 |
| 886 | Ga0500592_019025 | 3300053116 | Bacteria | 1103 |
| 887 | Ga0500592_022671 | 3300053116 | Bacteria | 1012 |
| 888 | Ga0500607_000844 | 3300053121 | Bacteria | 29501 |
| 889 | Ga0500607_001731 | 3300053121 | Bacteria | 18963 |
| 890 | Ga0500608_000087 | 3300053122 | Bacteria | 37903 |
| 891 | Ga0500608_045101 | 3300053122 | Bacteria | 2118 |
| 892 | Ga0500614_211526 | 3300053123 | Bacteria | 600 |
| 893 | Ga0500618_003516 | 3300053125 | Bacteria | 5339 |
| 894 | Ga0500655_023924 | 3300053133 | Bacteria | 1155 |
| 895 | Ga0500658_0122721 | 3300053134 | Bacteria | 1153 |
| 896 | Ga0500559_0006188 | 3300053136 | Bacteria | 5417 |
| 897 | Ga0500559_0012200 | 3300053136 | Bacteria | 3656 |
| 898 | Ga0500559_0358744 | 3300053136 | Bacteria | 681 |
| 899 | Ga0500564_000168 | 3300053138 | Bacteria | 17386 |
| 900 | Ga0500568_0004543 | 3300053139 | Bacteria | 7401 |
| 901 | Ga0500568_0072500 | 3300053139 | Bacteria | 1317 |
| 902 | Ga0500573_0349054 | 3300053140 | Bacteria | 719 |
| 903 | Ga0500577_0132685 | 3300053142 | Bacteria | 1045 |
| 904 | Ga0500590_071629 | 3300053148 | Bacteria | 1721 |
| 905 | Ga0500604_0034168 | 3300053151 | Bacteria | 1507 |
| 906 | Ga0500616_0005527 | 3300053153 | Bacteria | 8562 |
| 907 | Ga0500622_0001994 | 3300053156 | Bacteria | 15306 |
| 908 | Ga0500624_000033 | 3300053157 | Bacteria | 102532 |
| 909 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 910 | Ga0500627_0010487 | 3300053158 | Bacteria | 3382 |
| 911 | Ga0500627_0033399 | 3300053158 | Bacteria | 2174 |
| 912 | Ga0500636_0005813 | 3300053177 | Bacteria | 7062 |
| 913 | Ga0500637_0108625 | 3300053178 | Bacteria | 1609 |
| 914 | Ga0500567_000445 | 3300053723 | Bacteria | 13930 |
| 915 | Ga0500611_000770 | 3300053727 | Bacteria | 3307 |
| 916 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 917 | Ga0500645_126726 | 3300053730 | Bacteria | 710 |
| 918 | Ga0500645_127046 | 3300053730 | Bacteria | 709 |
| 919 | Ga0466962_0158838 | 3300061719 | Bacteria | 1098 |
| 920 | 2511130336 | 2510917021 | Bacteria | 5705459 |
| 921 | 2585260091 | 2582581305 | Bacteria | 4895574 |
| 922 | 2643730853 | 2643221541 | Bacteria | 5498788 |
| 923 | 2643820524 | 2643221560 | Bacteria | 4801179 |
| 924 | 2643836339 | 2643221563 | Bacteria | 4726935 |
| 925 | 2644040409 | 2643221605 | Bacteria | 4772303 |
| 926 | 2644044494 | 2643221606 | Bacteria | 5588032 |
| 927 | 2644052815 | 2643221608 | Bacteria | 4724829 |
| 928 | 2644391581 | 2643221671 | Bacteria | 5496681 |
| 929 | 2819552833 | 2818991438 | Bacteria | 5793701 |
| 930 | 2848297396 | 2848297114 | Bacteria | 3608511 |
| 931 | 2852653950 | 2852653556 | Bacteria | 4050083 |
| 932 | 2852682655 | 2852680915 | Bacteria | 4100189 |
| 933 | 2879166468 | 2879163058 | Bacteria | 4223965 |
| 934 | 2882807029 | 2882806704 | Bacteria | 3007728 |
| 935 | 2896254686 | 2896253425 | Bacteria | 3418029 |
| 936 | 2919139694 | 2919138771 | Bacteria | 5281312 |
| 937 | 2990266414 | 2990265787 | Bacteria | 3943888 |
| 938 | 8054303044 | 8054302542 | Bacteria | 5698134 |
| 939 | Ga0065704_10070364 | |||
| 940 | SwRhRL2b_contig_1406535 | |||
| 941 | SwRhRL2b_contig_3703961 | |||
| 942 | ARcpr5yngRDRAFT_c002434 | |||
| 943 | JGI24736J21556_1053072 | |||
| 944 | JGI24752J21851_1000535 | |||
| 945 | JGI24740J21852_10006386 | |||
| 946 | JGI24739J22299_10000378 | |||
| 947 | JGI24739J22299_10002487 | |||
| 948 | JGI24739J22299_10030758 | |||
| 949 | JGI24737J22298_10000438 | |||
| 950 | JGI24737J22298_10001931 | |||
| 951 | JGI24737J22298_10034699 | |||
| 952 | JGI24738J21930_10003426 | |||
| 953 | JGI24738J21930_10012231 | |||
| 954 | JGI24034J26672_10062163 | |||
| 955 | JGI24751J29686_10000388 | |||
| 956 | Ga0055537_1002075 | |||
| 957 | Ga0055524_1000654 | |||
| 958 | Ga0055536_1002435 | |||
| 959 | Ga0055536_1008890 | |||
| 960 | Ga0055534_1026657 | |||
| 961 | Ga0055534_1028314 | |||
| 962 | Ga0055528_1034380 | |||
| 963 | Ga0055530_10000522 | |||
| 964 | Ga0055531_10004791 | |||
| 965 | Ga0055531_10017316 | |||
| 966 | Ga0065165_1004978 | |||
| 967 | Ga0065165_1007901 | |||
| 968 | Ga0065704_10076703 | |||
| 969 | Ga0065704_10092310 | |||
| 970 | Ga0065712_10158463 | |||
| 971 | Ga0065712_10288054 | |||
| 972 | Ga0065707_10081738 | |||
| 973 | Ga0065707_10119699 | |||
| 974 | Ga0065707_10245569 | |||
| 975 | Ga0070658_10003538 | |||
| 976 | Ga0070658_10004563 | |||
| 977 | Ga0070658_10005934 | |||
| 978 | Ga0070676_10005815 | |||
| 979 | Ga0070683_100005945 | |||
| 980 | Ga0070690_100643257 | |||
| 981 | Ga0070690_101170409 | |||
| 982 | Ga0070670_100000168 | |||
| 983 | Ga0070670_100000340 | |||
| 984 | Ga0070670_100034717 | |||
| 985 | Ga0070670_100061834 | |||
| 986 | Ga0070670_100273001 | |||
| 987 | Ga0070677_10000460 | |||
| 988 | Ga0070677_10457904 | |||
| 989 | Ga0068869_100000736 | |||
| 990 | Ga0068869_100054511 | |||
| 991 | Ga0070666_10000380 | |||
| 992 | Ga0070666_10060890 | |||
| 993 | Ga0070666_10346367 | |||
| 994 | Ga0070680_100651464 | |||
| 995 | Ga0070682_100098702 | |||
| 996 | Ga0068868_100006361 | |||
| 997 | Ga0070660_100000061 | |||
| 998 | Ga0070660_100000560 | |||
| 999 | Ga0070660_100050689 | |||
| 1000 | Ga0070660_100323789 | |||
| 1001 | Ga0070689_100075351 | |||
| 1002 | Ga0070689_100613862 | |||
| 1003 | Ga0070687_100203935 | |||
| 1004 | Ga0070687_101223316 | |||
| 1005 | Ga0070661_100000075 | |||
| 1006 | Ga0070661_100080858 | |||
| 1007 | Ga0070661_100181140 | |||
| 1008 | Ga0070661_100335319 | |||
| 1009 | Ga0070661_100511561 | |||
| 1010 | Ga0070692_10015367 | |||
| 1011 | Ga0070692_10236840 | |||
| 1012 | Ga0070692_10875241 | |||
| 1013 | Ga0070668_100001470 | |||
| 1014 | Ga0070668_100005494 | |||
| 1015 | Ga0070668_100027478 | |||
| 1016 | Ga0070668_100599030 | |||
| 1017 | Ga0070669_100000013 | |||
| 1018 | Ga0070669_100000270 | |||
| 1019 | Ga0070669_100000565 | |||
| 1020 | Ga0070669_100002327 | |||
| 1021 | Ga0070669_100004540 | |||
| 1022 | Ga0070669_100071233 | |||
| 1023 | Ga0070669_100115681 | |||
| 1024 | Ga0070669_100894534 | |||
| 1025 | Ga0070671_100000116 | |||
| 1026 | Ga0070671_100018850 | |||
| 1027 | Ga0070671_100031625 | |||
| 1028 | Ga0070671_100049808 | |||
| 1029 | Ga0070671_100062925 | |||
| 1030 | Ga0070671_100136987 | |||
| 1031 | Ga0070671_100158643 | |||
| 1032 | Ga0070671_100531558 | |||
| 1033 | Ga0070674_100011953 | |||
| 1034 | Ga0070673_100010306 | |||
| 1035 | Ga0070673_100084376 | |||
| 1036 | Ga0070659_100004211 | |||
| 1037 | Ga0070659_100004345 | |||
| 1038 | Ga0070667_100000290 | |||
| 1039 | Ga0070667_100000968 | |||
| 1040 | Ga0070667_100001907 | |||
| 1041 | Ga0070667_100002091 | |||
| 1042 | Ga0070667_100013168 | |||
| 1043 | Ga0070667_100017180 | |||
| 1044 | Ga0070667_100083429 | |||
| 1045 | Ga0070667_100091190 | |||
| 1046 | Ga0070667_100125790 | |||
| 1047 | Ga0070667_100155986 | |||
| 1048 | Ga0070705_100026577 | |||
| 1049 | Ga0070705_100161075 | |||
| 1050 | Ga0070705_100178167 | |||
| 1051 | Ga0070663_100004025 | |||
| 1052 | Ga0070663_100040950 | |||
| 1053 | Ga0070663_100068831 | |||
| 1054 | Ga0070663_100160610 | |||
| 1055 | Ga0070663_100361851 | |||
| 1056 | Ga0070678_100922221 | |||
| 1057 | Ga0070678_101597531 | |||
| 1058 | Ga0070662_100003155 | |||
| 1059 | Ga0070662_100003479 | |||
| 1060 | Ga0070681_10599326 | |||
| 1061 | Ga0068867_100008041 | |||
| 1062 | Ga0070685_10265149 | |||
| 1063 | Ga0070707_100126344 | |||
| 1064 | Ga0070679_101463737 | |||
| 1065 | Ga0070684_100097876 | |||
| 1066 | Ga0070684_101912474 | |||
| 1067 | Ga0068853_100006609 | |||
| 1068 | Ga0068853_100032999 | |||
| 1069 | Ga0068853_102118200 | |||
| 1070 | Ga0070672_100061279 | |||
| 1071 | Ga0070672_100558772 | |||
| 1072 | Ga0070672_101043930 | |||
| 1073 | Ga0070686_101126069 | |||
| 1074 | Ga0070696_100040501 | |||
| 1075 | Ga0070693_100011908 | |||
| 1076 | Ga0070665_100001031 | |||
| 1077 | Ga0070665_100005836 | |||
| 1078 | Ga0070665_100015813 | |||
| 1079 | Ga0070665_100019518 | |||
| 1080 | Ga0070665_100027367 | |||
| 1081 | Ga0070665_100176304 | |||
| 1082 | Ga0068855_100000480 | |||
| 1083 | Ga0068855_100002720 | |||
| 1084 | Ga0068855_100010731 | |||
| 1085 | Ga0068855_100154599 | |||
| 1086 | Ga0068855_100169820 | |||
| 1087 | Ga0068855_100396531 | |||
| 1088 | Ga0070664_100004841 | |||
| 1089 | Ga0070664_100126949 | |||
| 1090 | Ga0070664_100283199 | |||
| 1091 | Ga0070664_100917863 | |||
| 1092 | Ga0068857_100011311 | |||
| 1093 | Ga0068857_100068787 | |||
| 1094 | Ga0068857_100178585 | |||
| 1095 | Ga0068857_100188390 | |||
| 1096 | Ga0068857_100250219 | |||
| 1097 | Ga0068857_100290962 | |||
| 1098 | Ga0068854_100001621 | |||
| 1099 | Ga0068854_100020124 | |||
| 1100 | Ga0068854_100028696 | |||
| 1101 | Ga0068854_100070209 | |||
| 1102 | Ga0068854_100422727 | |||
| 1103 | Ga0068856_100000538 | |||
| 1104 | Ga0068856_100049729 | |||
| 1105 | Ga0068856_100059828 | |||
| 1106 | Ga0068856_100658421 | |||
| 1107 | Ga0068852_100000117 | |||
| 1108 | Ga0068852_100001259 | |||
| 1109 | Ga0068852_100072095 | |||
| 1110 | Ga0068852_101048393 | |||
| 1111 | Ga0068859_100000390 | |||
| 1112 | Ga0068859_100028682 | |||
| 1113 | Ga0068859_100060129 | |||
| 1114 | Ga0068859_100071713 | |||
| 1115 | Ga0068859_100106828 | |||
| 1116 | Ga0068859_100189251 | |||
| 1117 | Ga0068864_100000063 | |||
| 1118 | Ga0068864_100001241 | |||
| 1119 | Ga0068864_100001790 | |||
| 1120 | Ga0068864_100179807 | |||
| 1121 | Ga0068864_100274952 | |||
| 1122 | Ga0068864_100291310 | |||
| 1123 | Ga0068861_100000026 | |||
| 1124 | Ga0068861_100109047 | |||
| 1125 | Ga0068861_100561436 | |||
| 1126 | Ga0068861_100627333 | |||
| 1127 | Ga0068851_10033091 | |||
| 1128 | Ga0068851_10078667 | |||
| 1129 | Ga0068851_10341629 | |||
| 1130 | Ga0068870_10082254 | |||
| 1131 | Ga0068870_11217787 | |||
| 1132 | Ga0068863_100000062 | |||
| 1133 | Ga0068863_100006362 | |||
| 1134 | Ga0068863_100008110 | |||
| 1135 | Ga0068863_100046312 | |||
| 1136 | Ga0068863_100403611 | |||
| 1137 | Ga0068858_100000713 | |||
| 1138 | Ga0068858_100001247 | |||
| 1139 | Ga0068858_100001777 | |||
| 1140 | Ga0068858_100026353 | |||
| 1141 | Ga0068858_100043444 | |||
| 1142 | Ga0068858_100057071 | |||
| 1143 | Ga0068858_100104177 | |||
| 1144 | Ga0068858_100157761 | |||
| 1145 | Ga0068858_100391700 | |||
| 1146 | Ga0068858_101877700 | |||
| 1147 | Ga0068860_100000386 | |||
| 1148 | Ga0068860_100003383 | |||
| 1149 | Ga0068860_100009605 | |||
| 1150 | Ga0068860_100032878 | |||
| 1151 | Ga0068860_100033307 | |||
| 1152 | Ga0068860_100074959 | |||
| 1153 | Ga0068860_100228223 | |||
| 1154 | Ga0068860_100582217 | |||
| 1155 | Ga0068860_100652764 | |||
| 1156 | Ga0068862_100000069 | |||
| 1157 | Ga0068862_100000560 | |||
| 1158 | Ga0068862_100022890 | |||
| 1159 | Ga0068862_100100800 | |||
| 1160 | Ga0068862_100105647 | |||
| 1161 | Ga0068862_101142259 | |||
| 1162 | Ga0081539_10405381 | |||
| 1163 | Ga0075363_100000864 | |||
| 1164 | Ga0075364_10006189 | |||
| 1165 | Ga0075364_10140699 | |||
| 1166 | Ga0075364_10319801 | |||
| 1167 | Ga0075362_10000003 | |||
| 1168 | Ga0075362_10034915 | |||
| 1169 | Ga0075367_10582484 | |||
| 1170 | Ga0075369_10005083 | |||
| 1171 | Ga0075369_10029336 | |||
| 1172 | Ga0075369_10607114 | |||
| 1173 | Ga0075366_10000006 | |||
| 1174 | Ga0075366_10003942 | |||
| 1175 | Ga0075366_10058083 | |||
| 1176 | Ga0075366_10715764 | |||
| 1177 | Ga0075366_10870028 | |||
| 1178 | Ga0097621_100185722 | |||
| 1179 | Ga0097621_101942584 | |||
| 1180 | Ga0075370_10000008 | |||
| 1181 | Ga0075370_10055793 | |||
| 1182 | Ga0075370_10062887 | |||
| 1183 | Ga0075370_10083223 | |||
| 1184 | Ga0075370_10471773 | |||
| 1185 | Ga0068871_100067451 | |||
| 1186 | Ga0068865_100047978 | |||
| 1187 | Ga0068865_100083717 | |||
| 1188 | Ga0097620_100000390 | |||
| 1189 | Ga0097620_100028682 | |||
| 1190 | Ga0097620_100060129 | |||
| 1191 | Ga0097620_100071712 | |||
| 1192 | Ga0097620_100106825 | |||
| 1193 | Ga0097620_100189261 | |||
| 1194 | Ga0079104_1024009 | |||
| 1195 | Ga0079104_1057170 | |||
| 1196 | Ga0079104_1079198 | |||
| 1197 | Ga0075435_100726874 | |||
| 1198 | Ga0105251_10001526 | |||
| 1199 | Ga0105251_10003021 | |||
| 1200 | Ga0105251_10009342 | |||
| 1201 | Ga0105251_10113933 | |||
| 1202 | Ga0105250_10143007 | |||
| 1203 | Ga0105250_10183843 | |||
| 1204 | Ga0105240_10007704 | |||
| 1205 | Ga0105240_10063792 | |||
| 1206 | Ga0105240_10540999 | |||
| 1207 | Ga0105245_10000782 | |||
| 1208 | Ga0105247_10007366 | |||
| 1209 | Ga0105247_10058521 | |||
| 1210 | Ga0105243_10042556 | |||
| 1211 | Ga0105243_10124096 | |||
| 1212 | Ga0105243_10975884 | |||
| 1213 | Ga0105241_10250298 | |||
| 1214 | Ga0105241_12191896 | |||
| 1215 | Ga0105248_10000443 | |||
| 1216 | Ga0105248_10000536 | |||
| 1217 | Ga0105248_10003369 | |||
| 1218 | Ga0105248_10028337 | |||
| 1219 | Ga0105248_10047856 | |||
| 1220 | Ga0105248_10255746 | |||
| 1221 | Ga0105248_10366421 | |||
| 1222 | Ga0105237_11492110 | |||
| 1223 | Ga0105238_10079835 | |||
| 1224 | Ga0105238_10235939 | |||
| 1225 | Ga0105249_10000160 | |||
| 1226 | Ga0105249_10000355 | |||
| 1227 | Ga0105249_10031761 | |||
| 1228 | Ga0105249_10034168 | |||
| 1229 | Ga0105249_10074343 | |||
| 1230 | Ga0105249_10101821 | |||
| 1231 | Ga0105239_10020946 | |||
| 1232 | Ga0105239_11431141 | |||
| 1233 | Ga0105246_10007706 | |||
| 1234 | Ga0157326_1000245 | |||
| 1235 | Ga0157373_10155054 | |||
| 1236 | Ga0157373_10222602 | |||
| 1237 | Ga0157371_10000458 | |||
| 1238 | Ga0157371_10008659 | |||
| 1239 | Ga0157371_10013469 | |||
| 1240 | Ga0157371_10055053 | |||
| 1241 | Ga0157370_10005413 | |||
| 1242 | Ga0157370_10054922 | |||
| 1243 | Ga0157370_10124747 | |||
| 1244 | Ga0157369_10012733 | |||
| 1245 | Ga0157369_10113197 | |||
| 1246 | Ga0157369_10750459 | |||
| 1247 | Ga0157374_10121558 | |||
| 1248 | Ga0157374_11342174 | |||
| 1249 | Ga0157378_10049574 | |||
| 1250 | Ga0157378_10143383 | |||
| 1251 | Ga0157378_10668599 | |||
| 1252 | Ga0163162_10008854 | |||
| 1253 | Ga0163162_10042347 | |||
| 1254 | Ga0163162_10042864 | |||
| 1255 | Ga0163162_10114319 | |||
| 1256 | Ga0163162_10122097 | |||
| 1257 | Ga0157372_10696870 | |||
| 1258 | Ga0157372_10880398 | |||
| 1259 | Ga0157372_13072220 | |||
| 1260 | Ga0157375_10115316 | |||
| 1261 | Ga0163163_10000058 | |||
| 1262 | Ga0163163_10079077 | |||
| 1263 | Ga0163163_10331161 | |||
| 1264 | Ga0163163_10348097 | |||
| 1265 | Ga0163163_11156113 | |||
| 1266 | Ga0163163_11194356 | |||
| 1267 | Ga0157380_10000338 | |||
| 1268 | Ga0157380_10146890 | |||
| 1269 | Ga0157380_10524023 | |||
| 1270 | Ga0157377_10072623 | |||
| 1271 | Ga0157379_10009670 | |||
| 1272 | Ga0157379_10015929 | |||
| 1273 | Ga0157379_10069392 | |||
| 1274 | Ga0157376_11278812 | |||
| 1275 | Ga0163161_10001269 | |||
| 1276 | Ga0163161_10087437 | |||
| 1277 | Ga0163161_10539498 | |||
| 1278 | Ga0163161_10723031 | |||
| 1279 | Ga0207425_1005665 | |||
| 1280 | Ga0209565_1000008 | |||
| 1281 | Ga0209565_1042448 | |||
| 1282 | Ga0209673_1001996 | |||
| 1283 | Ga0209675_1001006 | |||
| 1284 | Ga0209675_1006218 | |||
| 1285 | Ga0209676_1000557 | |||
| 1286 | Ga0209676_1002559 | |||
| 1287 | Ga0209676_1015956 | |||
| 1288 | Ga0209025_1006073 | |||
| 1289 | Ga0209025_1059735 | |||
| 1290 | Ga0209050_1000017 | |||
| 1291 | Ga0209050_1013704 | |||
| 1292 | Ga0209256_1000009 | |||
| 1293 | Ga0209256_1000010 | |||
| 1294 | Ga0209257_1001118 | |||
| 1295 | Ga0209257_1001176 | |||
| 1296 | Ga0209257_1001491 | |||
| 1297 | Ga0209257_1001719 | |||
| 1298 | Ga0209257_1054400 | |||
| 1299 | Ga0207697_10001744 | |||
| 1300 | Ga0207697_10003187 | |||
| 1301 | Ga0207697_10040420 | |||
| 1302 | Ga0207697_10253506 | |||
| 1303 | Ga0207656_10014271 | |||
| 1304 | Ga0207656_10203038 | |||
| 1305 | Ga0207656_10397706 | |||
| 1306 | Ga0207713_1002174 | |||
| 1307 | Ga0207713_1008296 | |||
| 1308 | Ga0207713_1012977 | |||
| 1309 | Ga0207682_10000990 | |||
| 1310 | Ga0207682_10409320 | |||
| 1311 | Ga0207642_10204205 | |||
| 1312 | Ga0207642_11004320 | |||
| 1313 | Ga0207710_10012829 | |||
| 1314 | Ga0207710_10100506 | |||
| 1315 | Ga0207710_10114879 | |||
| 1316 | Ga0207688_10026749 | |||
| 1317 | Ga0207688_10494475 | |||
| 1318 | Ga0207680_10000480 | |||
| 1319 | Ga0207680_10020210 | |||
| 1320 | Ga0207680_10106591 | |||
| 1321 | Ga0207680_10109442 | |||
| 1322 | Ga0207647_10016767 | |||
| 1323 | Ga0207645_10015526 | |||
| 1324 | Ga0207645_10075336 | |||
| 1325 | Ga0207705_10000004 | |||
| 1326 | Ga0207705_10000131 | |||
| 1327 | Ga0207705_10002347 | |||
| 1328 | Ga0207705_10754070 | |||
| 1329 | Ga0207654_10967562 | |||
| 1330 | Ga0207654_11201855 | |||
| 1331 | Ga0207695_10005830 | |||
| 1332 | Ga0207695_10015638 | |||
| 1333 | Ga0207695_10216217 | |||
| 1334 | Ga0207695_10278236 | |||
| 1335 | Ga0207695_10313200 | |||
| 1336 | Ga0207671_11472218 | |||
| 1337 | Ga0207660_10517869 | |||
| 1338 | Ga0207662_10095343 | |||
| 1339 | Ga0207662_10239122 | |||
| 1340 | Ga0207657_10000126 | |||
| 1341 | Ga0207657_10000181 | |||
| 1342 | Ga0207657_10281435 | |||
| 1343 | Ga0207649_10000937 | |||
| 1344 | Ga0207649_10117784 | |||
| 1345 | Ga0207649_10369724 | |||
| 1346 | Ga0207646_10499675 | |||
| 1347 | Ga0207681_10000008 | |||
| 1348 | Ga0207681_10000038 | |||
| 1349 | Ga0207681_10002968 | |||
| 1350 | Ga0207681_10010000 | |||
| 1351 | Ga0207681_10012300 | |||
| 1352 | Ga0207681_10024877 | |||
| 1353 | Ga0207681_10407023 | |||
| 1354 | Ga0207681_10566210 | |||
| 1355 | Ga0207681_11001390 | |||
| 1356 | Ga0207694_10160837 | |||
| 1357 | Ga0207694_10200744 | |||
| 1358 | Ga0207650_10006484 | |||
| 1359 | Ga0207650_10032491 | |||
| 1360 | Ga0207650_10037790 | |||
| 1361 | Ga0207650_10110967 | |||
| 1362 | Ga0207650_10203512 | |||
| 1363 | Ga0207650_10537563 | |||
| 1364 | Ga0207650_11885168 | |||
| 1365 | Ga0207687_10013795 | |||
| 1366 | Ga0207644_10000191 | |||
| 1367 | Ga0207644_10001603 | |||
| 1368 | Ga0207644_10004437 | |||
| 1369 | Ga0207644_10012689 | |||
| 1370 | Ga0207644_10105191 | |||
| 1371 | Ga0207644_10418068 | |||
| 1372 | Ga0207690_10000106 | |||
| 1373 | Ga0207690_10006739 | |||
| 1374 | Ga0207690_10131116 | |||
| 1375 | Ga0207690_10267028 | |||
| 1376 | Ga0207706_10000151 | |||
| 1377 | Ga0207706_10005896 | |||
| 1378 | Ga0207706_10152465 | |||
| 1379 | Ga0207706_10222113 | |||
| 1380 | Ga0207709_10030191 | |||
| 1381 | Ga0207709_10734474 | |||
| 1382 | Ga0207670_10108350 | |||
| 1383 | Ga0207669_10006549 | |||
| 1384 | Ga0207704_10082467 | |||
| 1385 | Ga0207691_10007770 | |||
| 1386 | Ga0207691_10641108 | |||
| 1387 | Ga0207691_10947811 | |||
| 1388 | Ga0207711_10000017 | |||
| 1389 | Ga0207711_10001912 | |||
| 1390 | Ga0207711_10031022 | |||
| 1391 | Ga0207711_10032649 | |||
| 1392 | Ga0207711_10087303 | |||
| 1393 | Ga0207711_10770231 | |||
| 1394 | Ga0207689_10000167 | |||
| 1395 | Ga0207689_10026962 | |||
| 1396 | Ga0207689_10038989 | |||
| 1397 | Ga0207689_10114392 | |||
| 1398 | Ga0207661_10006497 | |||
| 1399 | Ga0207679_10002382 | |||
| 1400 | Ga0207679_10243751 | |||
| 1401 | Ga0207679_10607754 | |||
| 1402 | Ga0207667_10000586 | |||
| 1403 | Ga0207667_10002108 | |||
| 1404 | Ga0207667_10003563 | |||
| 1405 | Ga0207667_10070804 | |||
| 1406 | Ga0207667_10125942 | |||
| 1407 | Ga0207667_10138092 | |||
| 1408 | Ga0207651_10001801 | |||
| 1409 | Ga0207651_10074826 | |||
| 1410 | Ga0207712_10000222 | |||
| 1411 | Ga0207712_10001433 | |||
| 1412 | Ga0207712_10014035 | |||
| 1413 | Ga0207712_10026859 | |||
| 1414 | Ga0207712_10129989 | |||
| 1415 | Ga0207712_10375142 | |||
| 1416 | Ga0207668_10000487 | |||
| 1417 | Ga0207668_10003398 | |||
| 1418 | Ga0207668_10053614 | |||
| 1419 | Ga0207668_10071748 | |||
| 1420 | Ga0207640_10002555 | |||
| 1421 | Ga0207640_10015350 | |||
| 1422 | Ga0207640_10019097 | |||
| 1423 | Ga0207640_10025143 | |||
| 1424 | Ga0207640_10035980 | |||
| 1425 | Ga0207640_10147273 | |||
| 1426 | Ga0207640_11595081 | |||
| 1427 | Ga0207658_10000133 | |||
| 1428 | Ga0207658_10000344 | |||
| 1429 | Ga0207658_10002000 | |||
| 1430 | Ga0207658_10002624 | |||
| 1431 | Ga0207658_10009484 | |||
| 1432 | Ga0207658_10247537 | |||
| 1433 | Ga0207658_10316648 | |||
| 1434 | Ga0207658_10482501 | |||
| 1435 | Ga0207658_11248043 | |||
| 1436 | Ga0207677_10002698 | |||
| 1437 | Ga0207677_11478198 | |||
| 1438 | Ga0207703_10000600 | |||
| 1439 | Ga0207703_10002947 | |||
| 1440 | Ga0207703_10004946 | |||
| 1441 | Ga0207703_10009186 | |||
| 1442 | Ga0207703_10013748 | |||
| 1443 | Ga0207703_10045860 | |||
| 1444 | Ga0207703_10393275 | |||
| 1445 | Ga0207703_10565543 | |||
| 1446 | Ga0207703_11663387 | |||
| 1447 | Ga0207639_10000573 | |||
| 1448 | Ga0207639_10002893 | |||
| 1449 | Ga0207639_10216118 | |||
| 1450 | Ga0207678_10006756 | |||
| 1451 | Ga0207678_10010888 | |||
| 1452 | Ga0207678_10342903 | |||
| 1453 | Ga0207678_11229106 | |||
| 1454 | Ga0207702_10001045 | |||
| 1455 | Ga0207702_10022777 | |||
| 1456 | Ga0207702_10070405 | |||
| 1457 | Ga0207702_10442956 | |||
| 1458 | Ga0207641_10000022 | |||
| 1459 | Ga0207641_10008748 | |||
| 1460 | Ga0207641_10011097 | |||
| 1461 | Ga0207641_10026721 | |||
| 1462 | Ga0207641_10080480 | |||
| 1463 | Ga0207641_10239071 | |||
| 1464 | Ga0207641_10824529 | |||
| 1465 | Ga0207641_11156203 | |||
| 1466 | Ga0207641_11210153 | |||
| 1467 | Ga0207648_10001222 | |||
| 1468 | Ga0207676_10000056 | |||
| 1469 | Ga0207676_10000698 | |||
| 1470 | Ga0207676_10007892 | |||
| 1471 | Ga0207676_10016650 | |||
| 1472 | Ga0207676_10017345 | |||
| 1473 | Ga0207676_10047378 | |||
| 1474 | Ga0207676_10568396 | |||
| 1475 | Ga0207674_10002073 | |||
| 1476 | Ga0207674_10039134 | |||
| 1477 | Ga0207674_10072353 | |||
| 1478 | Ga0207674_10096441 | |||
| 1479 | Ga0207674_10117552 | |||
| 1480 | Ga0207674_10194949 | |||
| 1481 | Ga0207674_10276148 | |||
| 1482 | Ga0207674_10399476 | |||
| 1483 | Ga0207674_10415813 | |||
| 1484 | Ga0207674_10457039 | |||
| 1485 | Ga0207675_100000219 | |||
| 1486 | Ga0207675_100142165 | |||
| 1487 | Ga0207675_100204155 | |||
| 1488 | Ga0207675_100318808 | |||
| 1489 | Ga0207675_101118764 | |||
| 1490 | Ga0207683_10135548 | |||
| 1491 | Ga0207698_10000019 | |||
| 1492 | Ga0207698_10002899 | |||
| 1493 | Ga0207698_10070698 | |||
| 1494 | Ga0207698_10142639 | |||
| 1495 | Ga0207698_10188675 | |||
| 1496 | Ga0209281_1014804 | |||
| 1497 | Ga0209281_1039265 | |||
| 1498 | Ga0209982_1013472 | |||
| 1499 | Ga0209982_1022706 | |||
| 1500 | Ga0209970_1010807 | |||
| 1501 | Ga0209971_1017836 | |||
| 1502 | Ga0209998_10186466 | |||
| 1503 | Ga0209974_10004612 | |||
| 1504 | Ga0209974_10014620 | |||
| 1505 | Ga0209974_10312981 | |||
| 1506 | Ga0268266_10000534 | |||
| 1507 | Ga0268266_10000950 | |||
| 1508 | Ga0268266_10005024 | |||
| 1509 | Ga0268266_10017332 | |||
| 1510 | Ga0268266_10227353 | |||
| 1511 | Ga0268266_10531242 | |||
| 1512 | Ga0268265_10000044 | |||
| 1513 | Ga0268265_10000171 | |||
| 1514 | Ga0268265_10009925 | |||
| 1515 | Ga0268265_10015150 | |||
| 1516 | Ga0268265_10161575 | |||
| 1517 | Ga0268265_10269548 | |||
| 1518 | Ga0268265_11703404 | |||
| 1519 | Ga0268264_10000040 | |||
| 1520 | Ga0268264_10000221 | |||
| 1521 | Ga0268264_10002127 | |||
| 1522 | Ga0268264_10007794 | |||
| 1523 | Ga0268264_10065660 | |||
| 1524 | Ga0268264_10152292 | |||
| 1525 | Ga0268264_10274083 | |||
| 1526 | Ga0268264_10346882 | |||
| 1527 | Ga0268264_10782600 | |||
| 1528 | Ga0265331_10065337 | |||
| 1529 | Ga0265327_10034617 | |||
| 1530 | Ga0307408_100012053 | |||
| 1531 | Ga0307408_100049901 | |||
| 1532 | Ga0307408_100190314 | |||
| 1533 | Ga0307516_10371135 | |||
| 1534 | Ga0307405_10000262 | |||
| 1535 | Ga0307405_10024668 | |||
| 1536 | Ga0307405_10048413 | |||
| 1537 | Ga0307405_10153163 | |||
| 1538 | Ga0307405_10243290 | |||
| 1539 | Ga0307405_10305156 | |||
| 1540 | Ga0307413_10007277 | |||
| 1541 | Ga0307410_10006176 | |||
| 1542 | Ga0307410_10025173 | |||
| 1543 | Ga0307410_10056655 | |||
| 1544 | Ga0307410_10193120 | |||
| 1545 | Ga0307406_10022270 | |||
| 1546 | Ga0307406_10069186 | |||
| 1547 | Ga0307406_10095665 | |||
| 1548 | Ga0307406_10698063 | |||
| 1549 | Ga0307406_10816607 | |||
| 1550 | Ga0307406_11221196 | |||
| 1551 | Ga0307407_10084128 | |||
| 1552 | Ga0307407_10222348 | |||
| 1553 | Ga0307407_10730005 | |||
| 1554 | Ga0307412_10001508 | |||
| 1555 | Ga0307412_10022421 | |||
| 1556 | Ga0307412_10076098 | |||
| 1557 | Ga0307412_10515572 | |||
| 1558 | Ga0307412_10789314 | |||
| 1559 | Ga0307409_100005979 | |||
| 1560 | Ga0307409_100045302 | |||
| 1561 | Ga0307409_101671372 | |||
| 1562 | Ga0307409_102205409 | |||
| 1563 | Ga0307416_100144168 | |||
| 1564 | Ga0307416_100157479 | |||
| 1565 | Ga0307416_100230719 | |||
| 1566 | Ga0307416_100463127 | |||
| 1567 | Ga0307416_102562940 | |||
| 1568 | Ga0307414_10000705 | |||
| 1569 | Ga0307414_10017082 | |||
| 1570 | Ga0307414_10114396 | |||
| 1571 | Ga0307414_10119340 | |||
| 1572 | Ga0307414_10124929 | |||
| 1573 | Ga0307414_10181758 | |||
| 1574 | Ga0307414_10189567 | |||
| 1575 | Ga0307414_10206534 | |||
| 1576 | Ga0307414_10231185 | |||
| 1577 | Ga0307414_10436456 | |||
| 1578 | Ga0307411_10007342 | |||
| 1579 | Ga0307411_10059438 | |||
| 1580 | Ga0307411_10230647 | |||
| 1581 | Ga0307411_10337202 | |||
| 1582 | Ga0307411_10384891 | |||
| 1583 | Ga0307415_100031388 | |||
| 1584 | Ga0307415_100133080 | |||
| 1585 | Ga0307415_100351848 | |||
| 1586 | Ga0307415_100755663 | |||
| 1587 | Ga0307510_10083885 | |||
| 1588 | Ga0373951_0058764 | |||
| 1589 | Ga0373939_0074121 | |||
| 1590 | Ga0373960_0072439 | |||
| 1591 | Ga0373961_0109640 | |||
| 1592 | Ga0373931_0127236 | |||
| 1593 | Ga0373935_0763281 | |||
| 1594 | Ga0395899_0440488 | |||
| 1595 | Ga0395900_0009860 | |||
| 1596 | Ga0395900_0036826 | |||
| 1597 | Ga0395900_0036959 | |||
| 1598 | Ga0395900_0147938 | |||
| 1599 | Ga0395898_0222076 | |||
| 1600 | Ga0395905_0001037 | |||
| 1601 | Ga0395905_0034180 | |||
| 1602 | Ga0395905_0088113 | |||
| 1603 | Ga0395905_0413513 | |||
| 1604 | Ga0395901_0000520 | |||
| 1605 | Ga0395901_0023864 | |||
| 1606 | Ga0395901_0190539 | |||
| 1607 | Ga0451793_1762985 | |||
| 1608 | Ga0451802_0802543 | |||
| 1609 | Ga0451807_0428949 | |||
| 1610 | Ga0451841_1391331 | |||
| 1611 | Ga0451843_0163617 | |||
| 1612 | Ga0439448_0084102 | |||
| 1613 | Ga0451577_0219922 | |||
| 1614 | Ga0466966_0072754 | |||
| 1615 | Ga0466961_0010535 | |||
| 1616 | Ga0453684_0170418 | |||
| 1617 | Ga0466971_0023088 | |||
| 1618 | Ga0466957_0137866 | |||
| 1619 | Ga0466959_0071933 | |||
| 1620 | Ga0451576_0066192 | |||
| 1621 | Ga0495627_000090 | |||
| 1622 | Ga0495638_0190777 | |||
| 1623 | Ga0495638_0228932 | |||
| 1624 | Ga0495650_0000818 | |||
| 1625 | Ga0495605_0122678 | |||
| 1626 | Ga0495585_0190040 | |||
| 1627 | Ga0495596_0000220 | |||
| 1628 | Ga0495607_0010578 | |||
| 1629 | Ga0495607_0178556 | |||
| 1630 | Ga0495583_0004190 | |||
| 1631 | Ga0495583_0026847 | |||
| 1632 | Ga0495583_0075862 | |||
| 1633 | Ga0495583_0128376 | |||
| 1634 | Ga0495583_0139011 | |||
| 1635 | Ga0495606_0016352 | |||
| 1636 | Ga0495610_0000015 | |||
| 1637 | Ga0495610_0000136 | |||
| 1638 | Ga0495610_0004021 | |||
| 1639 | Ga0495620_0022534 | |||
| 1640 | Ga0495628_0785874 | |||
| 1641 | Ga0495632_0001659 | |||
| 1642 | Ga0495632_0112457 | |||
| 1643 | Ga0495637_0014537 | |||
| 1644 | Ga0495637_0025547 | |||
| 1645 | Ga0495643_0000107 | |||
| 1646 | Ga0495643_0097275 | |||
| 1647 | Ga0495643_0201137 | |||
| 1648 | Ga0495663_0088692 | |||
| 1649 | Ga0495642_0400622 | |||
| 1650 | Ga0495654_0000348 | |||
| 1651 | Ga0495654_0089216 | |||
| 1652 | Ga0495609_0003765 | |||
| 1653 | Ga0495597_0131484 | |||
| 1654 | Ga0495633_0170734 | |||
| 1655 | Ga0495668_0007799 | |||
| 1656 | Ga0495668_0086684 | |||
| 1657 | Ga0495668_0260122 | |||
| 1658 | Ga0495625_0000729 | |||
| 1659 | Ga0495625_0001717 | |||
| 1660 | Ga0495625_0005843 | |||
| 1661 | Ga0495625_0103863 | |||
| 1662 | Ga0495625_0343455 | |||
| 1663 | Ga0495625_0410461 | |||
| 1664 | Ga0495659_0009203 | |||
| 1665 | Ga0495661_0220157 | |||
| 1666 | Ga0495669_0000323 | |||
| 1667 | Ga0495669_0016445 | |||
| 1668 | Ga0495669_0155760 | |||
| 1669 | Ga0495670_0014290 | |||
| 1670 | Ga0495670_0456521 | |||
| 1671 | Ga0495671_0014236 | |||
| 1672 | Ga0495649_0264028 | |||
| 1673 | Ga0495660_0187810 | |||
| 1674 | Ga0495660_0342543 | |||
| 1675 | Ga0495676_0322320 | |||
| 1676 | Ga0495687_000211 | |||
| 1677 | Ga0495681_0000048 | |||
| 1678 | Ga0495686_0068262 | |||
| 1679 | Ga0495626_0000214 | |||
| 1680 | Ga0496101_1037503 | |||
| 1681 | Ga0496102_0076001 | |||
| 1682 | Ga0496102_0566240 | |||
| 1683 | Ga0496102_1204213 | |||
| 1684 | Ga0496103_0016964 | |||
| 1685 | Ga0496103_0018712 | |||
| 1686 | Ga0496103_0063602 | |||
| 1687 | Ga0496103_0359958 | |||
| 1688 | Ga0496104_0239029 | |||
| 1689 | Ga0496104_0293281 | |||
| 1690 | Ga0496105_0000870 | |||
| 1691 | Ga0496105_0577060 | |||
| 1692 | Ga0496105_0710761 | |||
| 1693 | Ga0496105_0858534 | |||
| 1694 | Ga0496105_0998803 | |||
| 1695 | Ga0496106_0047548 | |||
| 1696 | Ga0496106_0079891 | |||
| 1697 | Ga0496107_0020316 | |||
| 1698 | Ga0496107_0212219 | |||
| 1699 | Ga0496107_0659897 | |||
| 1700 | Ga0496108_0070946 | |||
| 1701 | Ga0496108_1106633 | |||
| 1702 | Ga0496109_0240217 | |||
| 1703 | Ga0496109_1168217 | |||
| 1704 | Ga0496109_1204878 | |||
| 1705 | Ga0496110_0063483 | |||
| 1706 | Ga0496110_0081472 | |||
| 1707 | Ga0496110_0102725 | |||
| 1708 | Ga0496110_0622166 | |||
| 1709 | Ga0496111_0313364 | |||
| 1710 | Ga0496111_0663962 | |||
| 1711 | Ga0496112_0568554 | |||
| 1712 | Ga0496113_0059478 | |||
| 1713 | Ga0496113_0651768 | |||
| 1714 | Ga0496114_0000019 | |||
| 1715 | Ga0496114_0429606 | |||
| 1716 | Ga0496116_0000284 | |||
| 1717 | Ga0496116_0075635 | |||
| 1718 | Ga0496117_0010298 | |||
| 1719 | Ga0496117_0076028 | |||
| 1720 | Ga0496117_0132944 | |||
| 1721 | Ga0496118_0011723 | |||
| 1722 | Ga0496118_0015199 | |||
| 1723 | Ga0496118_0046055 | |||
| 1724 | Ga0496118_0067419 | |||
| 1725 | Ga0496119_0031689 | |||
| 1726 | Ga0496121_0000031 | |||
| 1727 | Ga0496121_0000196 | |||
| 1728 | Ga0496121_0000997 | |||
| 1729 | Ga0496121_0003197 | |||
| 1730 | Ga0496121_0007129 | |||
| 1731 | Ga0496121_0272027 | |||
| 1732 | Ga0496121_0307996 | |||
| 1733 | Ga0496122_0006671 | |||
| 1734 | Ga0496122_0027860 | |||
| 1735 | Ga0496122_0047866 | |||
| 1736 | Ga0496122_0108828 | |||
| 1737 | Ga0496123_0045999 | |||
| 1738 | Ga0496123_0055813 | |||
| 1739 | Ga0496123_0095952 | |||
| 1740 | Ga0496123_0130326 | |||
| 1741 | Ga0496124_0011898 | |||
| 1742 | Ga0496124_0017368 | |||
| 1743 | Ga0496124_0113738 | |||
| 1744 | Ga0496124_0180922 | |||
| 1745 | Ga0496124_0196481 | |||
| 1746 | Ga0496125_0014367 | |||
| 1747 | Ga0496125_0037208 | |||
| 1748 | Ga0496125_0067314 | |||
| 1749 | Ga0496125_0139532 | |||
| 1750 | Ga0496125_0229839 | |||
| 1751 | Ga0496126_0006838 | |||
| 1752 | Ga0496126_0020885 | |||
| 1753 | Ga0496126_0023508 | |||
| 1754 | Ga0496126_0131949 | |||
| 1755 | Ga0496126_0385121 | |||
| 1756 | Ga0496126_0654875 | |||
| 1757 | Ga0496126_0926250 | |||
| 1758 | Ga0495678_108597 | |||
| 1759 | Ga0501031_0012668 | |||
| 1760 | Ga0501032_0016855 | |||
| 1761 | Ga0501032_0418074 | |||
| 1762 | Ga0501033_0013889 | |||
| 1763 | Ga0501033_0152832 | |||
| 1764 | Ga0501034_0048157 | |||
| 1765 | Ga0501034_0052172 | |||
| 1766 | Ga0501034_0231460 | |||
| 1767 | Ga0501034_0600222 | |||
| 1768 | Ga0501034_1068472 | |||
| 1769 | Ga0501036_0059692 | |||
| 1770 | Ga0501036_0896802 | |||
| 1771 | Ga0501037_0024223 | |||
| 1772 | Ga0501037_0359574 | |||
| 1773 | Ga0501038_0018181 | |||
| 1774 | Ga0501038_0072817 | |||
| 1775 | Ga0501039_0063228 | |||
| 1776 | Ga0501039_0136516 | |||
| 1777 | Ga0501042_1298334 | |||
| 1778 | Ga0501043_0153496 | |||
| 1779 | Ga0501043_0374062 | |||
| 1780 | Ga0501043_0837511 | |||
| 1781 | Ga0501046_0180782 | |||
| 1782 | Ga0501047_0029560 | |||
| 1783 | Ga0501047_0413045 | |||
| 1784 | Ga0501071_0353295 | |||
| 1785 | Ga0501072_1131691 | |||
| 1786 | Ga0501074_0210835 | |||
| 1787 | Ga0501233_000055 | |||
| 1788 | Ga0501249_012920 | |||
| 1789 | Ga0501035_0012700 | |||
| 1790 | Ga0501044_0001187 | |||
| 1791 | Ga0501044_0026980 | |||
| 1792 | Ga0501044_0048906 | |||
| 1793 | Ga0501044_0504988 | |||
| 1794 | Ga0501044_1423239 | |||
| 1795 | nmdc:mga03683_13_c1 | |||
| 1796 | nmdc:mga03683_4523_c1 | |||
| 1797 | nmdc:mga03n38_21620_c1 | |||
| 1798 | nmdc:mga03n38_580207_c1 | |||
| 1799 | nmdc:mga00v17_10173_c2 | |||
| 1800 | nmdc:mga00v17_3456_c1 | |||
| 1801 | nmdc:mga00v17_513432_c1 | |||
| 1802 | nmdc:mga00v17_7174_c1 | |||
| 1803 | nmdc:mga0k408_77105_c1 | |||
| 1804 | nmdc:mga0k408_8_c1 | |||
| 1805 | nmdc:mga06z11_536639_c1 | |||
| 1806 | nmdc:mga07m45_20_c1 | |||
| 1807 | nmdc:mga07m45_4375_c1 | |||
| 1808 | nmdc:mga07m45_57468_c1 | |||
| 1809 | nmdc:mga07m45_63400_c1 | |||
| 1810 | nmdc:mga07m45_69354_c1 | |||
| 1811 | nmdc:mga07m45_746212_c1 | |||
| 1812 | nmdc:mga0rr50_748349_c1 | |||
| 1813 | nmdc:mga0sz30_27879_c1 | |||
| 1814 | nmdc:mga0sz30_3957_c1 | |||
| 1815 | nmdc:mga0sz30_4821_c1 | |||
| 1816 | nmdc:mga0sz30_541359_c1 | |||
| 1817 | Ga0500643_000219 | |||
| 1818 | Ga0500643_002412 | |||
| 1819 | Ga0500643_004161 | |||
| 1820 | Ga0500643_006074 | |||
| 1821 | Ga0500583_0211082 | |||
| 1822 | Ga0500566_0317890 | |||
| 1823 | Ga0500592_000128 | |||
| 1824 | Ga0500592_019025 | |||
| 1825 | Ga0500592_022671 | |||
| 1826 | Ga0500607_000844 | |||
| 1827 | Ga0500607_001731 | |||
| 1828 | Ga0500608_000087 | |||
| 1829 | Ga0500608_045101 | |||
| 1830 | Ga0500614_211526 | |||
| 1831 | Ga0500618_003516 | |||
| 1832 | Ga0500655_023924 | |||
| 1833 | Ga0500658_0122721 | |||
| 1834 | Ga0500559_0006188 | |||
| 1835 | Ga0500559_0012200 | |||
| 1836 | Ga0500559_0358744 | |||
| 1837 | Ga0500564_000168 | |||
| 1838 | Ga0500568_0004543 | |||
| 1839 | Ga0500568_0072500 | |||
| 1840 | Ga0500573_0349054 | |||
| 1841 | Ga0500577_0132685 | |||
| 1842 | Ga0500590_071629 | |||
| 1843 | Ga0500604_0034168 | |||
| 1844 | Ga0500616_0005527 | |||
| 1845 | Ga0500622_0001994 | |||
| 1846 | Ga0500624_000033 | |||
| 1847 | Ga0500627_0000049 | |||
| 1848 | Ga0500627_0010487 | |||
| 1849 | Ga0500627_0033399 | |||
| 1850 | Ga0500636_0005813 | |||
| 1851 | Ga0500637_0108625 | |||
| 1852 | Ga0500567_000445 | |||
| 1853 | Ga0500611_000770 | |||
| 1854 | Ga0500625_000009 | |||
| 1855 | Ga0500645_126726 | |||
| 1856 | Ga0500645_127046 | |||
| 1857 | Ga0466962_0158838 | |||
| 1858 | 2511130336 | |||
| 1859 | 2585260091 | |||
| 1860 | 2643730853 | |||
| 1861 | 2643820524 | |||
| 1862 | 2643836339 | |||
| 1863 | 2644040409 | |||
| 1864 | 2644044494 | |||
| 1865 | 2644052815 | |||
| 1866 | 2644391581 | |||
| 1867 | 2819552833 | |||
| 1868 | 2848297396 | |||
| 1869 | 2852653950 | |||
| 1870 | 2852682655 | |||
| 1871 | 2879166468 | |||
| 1872 | 2882807029 | |||
| 1873 | 2896254686 | |||
| 1874 | 2919139694 | |||
| 1875 | 2990266414 | |||
| 1876 | 8054303044 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mzg-assembly1.cif.gz_B | x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 | 0.8979 | 2 | 140 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.8878 | 1 | 142 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.8819 | 1 | 142 |
| 5eep-assembly1.cif.gz_A | crystal structure of e. coli csde | 0.8792 | 5 | 140 |
| 5nq6-assembly1.cif.gz_A | crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution | 0.8556 | 6 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0FV61_26_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8972 | 18 | 141 | 3.90.1010.10 |
| 3g0mA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8878 | 1 | 142 | 3.90.1010.10 |
| 3g0mA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8819 | 1 | 142 | 3.90.1010.10 |
| af_Q10RM2_1_106_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8744 | 36 | 141 | 3.90.1010.10 |
| af_O96155_92_241_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8728 | 5 | 138 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A031JFY1-F1-model_v4 | deleted | 0.9841 | 1 | 141 |
|
| AF-A0A258GWD5-F1-model_v4 | Fe-S metabolism protein SufE | 0.9793 | 20 | 141 |
|
| AF-A5VAI0-F1-model_v4 | deleted | 0.9775 | 2 | 142 |
|
| AF-A0A3B9AWW5-F1-model_v4 | deleted | 0.9569 | 4 | 120 |
|
| AF-A0A844Y0I1-F1-model_v4 | SufE family protein | 0.9562 | 4 | 141 |
|