F486246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 466 | 1876 | 559 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10031465|Ga0105237_100314653 |
| Length | 622 |
| Sequence | MGEAASITTLRALSGLGKVARRFSFFVIRFNYMVRTSPTIQGAGTAPPGLTTGDKMVIRKNSCLAALAAIALFQVTACGGSDDDATLPQLPAATGATLTSCTDLVTRLSFPNTSIASSATVAAGTLTVAGTPIAAHCLVKGSMYSRVSTVDGNSYAIGFEMRLPNTWNGRFFYQANGGIDGSVATATGAVNGGPGLTNALNMGFAVLSSDAGHAGSLGPFFGIDPQARLDYGYQAVGKLTPMAKAAIQTAYGKGPDRSYIGGCSNGGRHTMVAAARYADQYDGFLVGNPGFRLPLAAIANIAAFQGYNTVASTPGDPSTGFTAAERTLVSNAVLAKCDALDGSADGLVQDTGACQAAFNLDRDVPTCSGARDGTCLSAAQKTVIGKRFAGVTTGSGTKIYSSWPFDAGIGGGNTAFWNFTAPPVLDSGAVGVIWQVPPENPATFNGPTFALTGDLDSMLAKVQATNATYTESALSFMTPPNPSSLGTLKNRGAKVMVYHGTSDPIFSSDDTTAWYESLRGANGGDASNFARFFRVPGMTHCAAGPSTDQFDMLTPLVAWVEQGQAPASVTASARGTGNAAGVNADVPASWSATRTRPLCPYPQVARYKGTGSVDSADSFSCQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 185 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 186 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 187 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 213 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 214 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 215 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 222 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 223 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 228 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 229 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 234 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 235 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 236 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 237 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 380 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 385 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 398 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 399 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 400 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 401 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 402 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 403 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 404 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 405 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 406 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 407 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 408 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 409 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 410 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 411 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 412 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 413 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 414 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 415 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 416 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 417 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 418 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 419 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 420 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 421 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 422 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 423 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 424 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 425 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 426 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 427 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 428 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 429 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 430 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 431 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 432 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 433 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 434 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 435 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 436 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 437 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 438 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 439 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 440 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 441 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 442 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 443 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 444 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 445 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 446 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 447 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 448 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 449 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 450 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 451 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 452 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 453 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 454 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 455 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 456 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 457 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 458 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 459 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 460 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 461 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 462 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 463 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 464 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 465 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 466 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92 |
| Metatranscriptomes | 0.11 |
| Isolates | 7.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.45 |
| Nodule | 1.49 |
| Rhizoplane | 2.56 |
| Rhizosphere | 59.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105237_10031465 | 3300009545 | Bacteria | 5380 |
| 2 | JGI24741J21665_1000483 | 3300001915 | Bacteria | 12193 |
| 3 | JGI24740J21852_10000011 | 3300001979 | Bacteria | 68823 |
| 4 | JGI24740J21852_10000057 | 3300001979 | Bacteria | 35487 |
| 5 | JGI25156J39149_1000766 | 3300002705 | Bacteria | 16671 |
| 6 | JGI25156J39149_1001052 | 3300002705 | Bacteria | 12760 |
| 7 | JGI25154J39366_1001383 | 3300002738 | Bacteria | 8786 |
| 8 | JGI25150J39212_1001922 | 3300002774 | Bacteria | 5457 |
| 9 | JGI25159J45721_1002978 | 3300002987 | Bacteria | 6157 |
| 10 | JGI25151J46595_10000539 | 3300003187 | Bacteria | 35055 |
| 11 | JGI25151J46595_10009324 | 3300003187 | Bacteria | 4654 |
| 12 | JGI25165J46597_1002776 | 3300003214 | Bacteria | 5089 |
| 13 | JGI25153J46596_10005865 | 3300003215 | Bacteria | 6359 |
| 14 | rootL2_10017019 | 3300003322 | Bacteria | 2341 |
| 15 | rootL2_10056402 | 3300003322 | Bacteria | 8479 |
| 16 | rootH1_10060501 | 3300003323 | Bacteria | 3352 |
| 17 | JGI25160J50197_1003596 | 3300003354 | Bacteria | 6881 |
| 18 | JGI25160J50197_1003664 | 3300003354 | Bacteria | 6806 |
| 19 | JGI25161J50226_1001263 | 3300003374 | Bacteria | 8121 |
| 20 | JGI25161J50226_1001680 | 3300003374 | Bacteria | 6347 |
| 21 | Ga0006562J51391_1103569 | 3300003578 | Bacteria | 2600 |
| 22 | Ga0055539_1000168 | 3300003752 | Bacteria | 58108 |
| 23 | Ga0055533_1000914 | 3300003756 | Bacteria | 8840 |
| 24 | Ga0055533_1001105 | 3300003756 | Bacteria | 7721 |
| 25 | Ga0055533_1003457 | 3300003756 | Bacteria | 3167 |
| 26 | Ga0055532_1000033 | 3300003758 | Bacteria | 214652 |
| 27 | Ga0055525_1000069 | 3300003759 | Bacteria | 186286 |
| 28 | Ga0055525_1000438 | 3300003759 | Bacteria | 24329 |
| 29 | Ga0055527_1002323 | 3300003760 | Bacteria | 3281 |
| 30 | Ga0055535_1000024 | 3300003761 | Bacteria | 214652 |
| 31 | Ga0055535_1000422 | 3300003761 | Bacteria | 39771 |
| 32 | Ga0055535_1000625 | 3300003761 | Bacteria | 28582 |
| 33 | Ga0055542_1000074 | 3300003762 | Bacteria | 141185 |
| 34 | Ga0055542_1000087 | 3300003762 | Bacteria | 123666 |
| 35 | Ga0055542_1000945 | 3300003762 | Bacteria | 19117 |
| 36 | Ga0055529_1000044 | 3300003763 | Bacteria | 214652 |
| 37 | Ga0055526_1000028 | 3300003771 | Bacteria | 150301 |
| 38 | Ga0055526_1003120 | 3300003771 | Bacteria | 10739 |
| 39 | Ga0055526_1006453 | 3300003771 | Bacteria | 6359 |
| 40 | Ga0055526_1006607 | 3300003771 | Bacteria | 6244 |
| 41 | Ga0055537_1000064 | 3300003773 | Bacteria | 77134 |
| 42 | Ga0055537_1002664 | 3300003773 | Bacteria | 5831 |
| 43 | Ga0055524_1002010 | 3300003775 | Bacteria | 10862 |
| 44 | Ga0055524_1007424 | 3300003775 | Bacteria | 4654 |
| 45 | Ga0055536_1002562 | 3300003781 | Bacteria | 10140 |
| 46 | Ga0055536_1002590 | 3300003781 | Bacteria | 10076 |
| 47 | Ga0055536_1005253 | 3300003781 | Bacteria | 6383 |
| 48 | Ga0055534_1000094 | 3300003784 | Bacteria | 70029 |
| 49 | Ga0055534_1002480 | 3300003784 | Bacteria | 6359 |
| 50 | Ga0055528_1000142 | 3300003790 | Bacteria | 58220 |
| 51 | Ga0055528_1000250 | 3300003790 | Bacteria | 45479 |
| 52 | Ga0055528_1005571 | 3300003790 | Bacteria | 5831 |
| 53 | Ga0055530_10000492 | 3300003791 | Bacteria | 34175 |
| 54 | Ga0055530_10004165 | 3300003791 | Bacteria | 7639 |
| 55 | Ga0055540_1001880 | 3300003792 | Bacteria | 11783 |
| 56 | Ga0055540_1002209 | 3300003792 | Bacteria | 10565 |
| 57 | Ga0055540_1002683 | 3300003792 | Bacteria | 9173 |
| 58 | Ga0055540_1004595 | 3300003792 | Bacteria | 6135 |
| 59 | Ga0055540_1004949 | 3300003792 | Bacteria | 5804 |
| 60 | Ga0055540_1018559 | 3300003792 | Bacteria | 1903 |
| 61 | Ga0055531_10000738 | 3300003794 | Bacteria | 27594 |
| 62 | Ga0055531_10003879 | 3300003794 | Bacteria | 9360 |
| 63 | Ga0055531_10003975 | 3300003794 | Bacteria | 9173 |
| 64 | Ga0055531_10007175 | 3300003794 | Bacteria | 6135 |
| 65 | Ga0055531_10016465 | 3300003794 | Bacteria | 3187 |
| 66 | Ga0055541_1000910 | 3300003841 | Bacteria | 7060 |
| 67 | Ga0055541_1006948 | 3300003841 | Bacteria | 1890 |
| 68 | Ga0055543_1001897 | 3300004625 | Bacteria | 7554 |
| 69 | Ga0055543_1003550 | 3300004625 | Bacteria | 4529 |
| 70 | Ga0065165_1004159 | 3300005262 | Bacteria | 9265 |
| 71 | Ga0070658_10004140 | 3300005327 | Bacteria | 11878 |
| 72 | Ga0070658_10045957 | 3300005327 | Bacteria | 3533 |
| 73 | Ga0070676_10000646 | 3300005328 | Bacteria | 16965 |
| 74 | Ga0070676_10031428 | 3300005328 | Bacteria | 3033 |
| 75 | Ga0070683_100048160 | 3300005329 | Bacteria | 3940 |
| 76 | Ga0070670_100005736 | 3300005331 | Bacteria | 10485 |
| 77 | Ga0070670_100055022 | 3300005331 | Bacteria | 3416 |
| 78 | Ga0070670_100096969 | 3300005331 | Bacteria | 2536 |
| 79 | Ga0068869_100000695 | 3300005334 | Bacteria | 19035 |
| 80 | Ga0070682_100001807 | 3300005337 | Bacteria | 11949 |
| 81 | Ga0068868_100021364 | 3300005338 | Bacteria | 4874 |
| 82 | Ga0068868_100046105 | 3300005338 | Bacteria | 3412 |
| 83 | Ga0070689_100003286 | 3300005340 | Bacteria | 10736 |
| 84 | Ga0070661_100000027 | 3300005344 | Bacteria | 117972 |
| 85 | Ga0070661_100037837 | 3300005344 | Bacteria | 3510 |
| 86 | Ga0070661_100040997 | 3300005344 | Bacteria | 3378 |
| 87 | Ga0070669_100015690 | 3300005353 | Bacteria | 5403 |
| 88 | Ga0070675_100107152 | 3300005354 | Bacteria | 2360 |
| 89 | Ga0070671_100150864 | 3300005355 | Bacteria | 1962 |
| 90 | Ga0070673_100019369 | 3300005364 | Bacteria | 4884 |
| 91 | Ga0070659_100001366 | 3300005366 | Bacteria | 17550 |
| 92 | Ga0070659_100023144 | 3300005366 | Bacteria | 4750 |
| 93 | Ga0070667_100012849 | 3300005367 | Bacteria | 6919 |
| 94 | Ga0070667_100028651 | 3300005367 | Bacteria | 4638 |
| 95 | Ga0070663_100000004 | 3300005455 | Bacteria | 254839 |
| 96 | Ga0070678_100027281 | 3300005456 | Bacteria | 3877 |
| 97 | Ga0070662_100007206 | 3300005457 | Bacteria | 7203 |
| 98 | Ga0070662_100078902 | 3300005457 | Bacteria | 2447 |
| 99 | Ga0068867_100001970 | 3300005459 | Bacteria | 14319 |
| 100 | Ga0070706_100000883 | 3300005467 | Bacteria | 32838 |
| 101 | Ga0070698_100193917 | 3300005471 | Bacteria | 1969 |
| 102 | Ga0068853_100012984 | 3300005539 | Bacteria | 6790 |
| 103 | Ga0068853_100056079 | 3300005539 | Bacteria | 3397 |
| 104 | Ga0070672_100000608 | 3300005543 | Bacteria | 21058 |
| 105 | Ga0070686_100006973 | 3300005544 | Bacteria | 6296 |
| 106 | Ga0070665_100082825 | 3300005548 | Bacteria | 3213 |
| 107 | Ga0070665_100113824 | 3300005548 | Bacteria | 2708 |
| 108 | Ga0068855_100214467 | 3300005563 | Bacteria | 2162 |
| 109 | Ga0070664_100000041 | 3300005564 | Bacteria | 78215 |
| 110 | Ga0070664_100058732 | 3300005564 | Bacteria | 3272 |
| 111 | Ga0070664_100066970 | 3300005564 | Bacteria | 3068 |
| 112 | Ga0068857_100102702 | 3300005577 | Bacteria | 2566 |
| 113 | Ga0068854_100000269 | 3300005578 | Bacteria | 35431 |
| 114 | Ga0068854_100017329 | 3300005578 | Bacteria | 4819 |
| 115 | Ga0068856_100000004 | 3300005614 | Bacteria | 233761 |
| 116 | Ga0068856_100074398 | 3300005614 | Bacteria | 3363 |
| 117 | Ga0068852_100002516 | 3300005616 | Bacteria | 12622 |
| 118 | Ga0068852_100010490 | 3300005616 | Bacteria | 6927 |
| 119 | Ga0068852_100092761 | 3300005616 | Bacteria | 2705 |
| 120 | Ga0068852_100109475 | 3300005616 | Bacteria | 2509 |
| 121 | Ga0068859_100028125 | 3300005617 | Bacteria | 5636 |
| 122 | Ga0068864_100001546 | 3300005618 | Bacteria | 18969 |
| 123 | Ga0068864_100011901 | 3300005618 | Bacteria | 7184 |
| 124 | Ga0068864_100134455 | 3300005618 | Bacteria | 2225 |
| 125 | Ga0068861_100006522 | 3300005719 | Bacteria | 7959 |
| 126 | Ga0068861_100006534 | 3300005719 | Bacteria | 7954 |
| 127 | Ga0068861_100152687 | 3300005719 | Bacteria | 1896 |
| 128 | Ga0068851_10006026 | 3300005834 | Bacteria | 5525 |
| 129 | Ga0068870_10004833 | 3300005840 | Bacteria | 5827 |
| 130 | Ga0068860_100081289 | 3300005843 | Bacteria | 3081 |
| 131 | Ga0068862_100014215 | 3300005844 | Bacteria | 6602 |
| 132 | Ga0075365_10000480 | 3300006038 | Bacteria | 15124 |
| 133 | Ga0075365_10004292 | 3300006038 | Bacteria | 7522 |
| 134 | Ga0075365_10004816 | 3300006038 | Bacteria | 7200 |
| 135 | Ga0075365_10007708 | 3300006038 | Bacteria | 6057 |
| 136 | Ga0075363_100041976 | 3300006048 | Bacteria | 2415 |
| 137 | Ga0075364_10009931 | 3300006051 | Bacteria | 5725 |
| 138 | Ga0075362_10010286 | 3300006177 | Bacteria | 3648 |
| 139 | Ga0075362_10022148 | 3300006177 | Bacteria | 2674 |
| 140 | Ga0075367_10005227 | 3300006178 | Bacteria | 6416 |
| 141 | Ga0075369_10007347 | 3300006186 | Bacteria | 4192 |
| 142 | Ga0075366_10000542 | 3300006195 | Bacteria | 17576 |
| 143 | Ga0075366_10008352 | 3300006195 | Bacteria | 5752 |
| 144 | Ga0075366_10021377 | 3300006195 | Bacteria | 3761 |
| 145 | Ga0075366_10043784 | 3300006195 | Bacteria | 2652 |
| 146 | Ga0075370_10000416 | 3300006353 | Bacteria | 15732 |
| 147 | Ga0075370_10001822 | 3300006353 | Bacteria | 9530 |
| 148 | Ga0075370_10004927 | 3300006353 | Bacteria | 6559 |
| 149 | Ga0075370_10010524 | 3300006353 | Bacteria | 4839 |
| 150 | Ga0075370_10011785 | 3300006353 | Bacteria | 4602 |
| 151 | Ga0075370_10024269 | 3300006353 | Bacteria | 3348 |
| 152 | Ga0075370_10025838 | 3300006353 | Bacteria | 3249 |
| 153 | Ga0075370_10027917 | 3300006353 | Bacteria | 3134 |
| 154 | Ga0097620_100028125 | 3300006931 | Bacteria | 5636 |
| 155 | Ga0079104_1000026 | 3300006946 | Bacteria | 216566 |
| 156 | Ga0079104_1018388 | 3300006946 | Bacteria | 1979 |
| 157 | Ga0099826_10017694 | 3300006948 | Bacteria | 5384 |
| 158 | Ga0105251_10002012 | 3300009011 | Bacteria | 16509 |
| 159 | Ga0105244_10004665 | 3300009036 | Bacteria | 9346 |
| 160 | Ga0105244_10031538 | 3300009036 | Bacteria | 2812 |
| 161 | Ga0105244_10033401 | 3300009036 | Bacteria | 2712 |
| 162 | Ga0105250_10002478 | 3300009092 | Bacteria | 9258 |
| 163 | Ga0105240_10033282 | 3300009093 | Bacteria | 6662 |
| 164 | Ga0105243_10007028 | 3300009148 | Bacteria | 8661 |
| 165 | Ga0105243_10016857 | 3300009148 | Bacteria | 5523 |
| 166 | Ga0105243_10025505 | 3300009148 | Bacteria | 4518 |
| 167 | Ga0105243_10031665 | 3300009148 | Bacteria | 4078 |
| 168 | Ga0105242_10008883 | 3300009176 | Bacteria | 7711 |
| 169 | Ga0105242_10009715 | 3300009176 | Bacteria | 7372 |
| 170 | Ga0105239_10021943 | 3300010375 | Bacteria | 7038 |
| 171 | Ga0157373_10101692 | 3300013100 | Bacteria | 2022 |
| 172 | Ga0157371_10000028 | 3300013102 | Bacteria | 254964 |
| 173 | Ga0157371_10092669 | 3300013102 | Bacteria | 2140 |
| 174 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 175 | Ga0157370_10003601 | 3300013104 | Bacteria | 18122 |
| 176 | Ga0157369_10010892 | 3300013105 | Bacteria | 10357 |
| 177 | Ga0157369_10024286 | 3300013105 | Bacteria | 6745 |
| 178 | Ga0157374_10017910 | 3300013296 | Bacteria | 6243 |
| 179 | Ga0163162_10114901 | 3300013306 | Bacteria | 2791 |
| 180 | Ga0163162_10218742 | 3300013306 | Bacteria | 2035 |
| 181 | Ga0157372_10000065 | 3300013307 | Bacteria | 114576 |
| 182 | Ga0157372_10010625 | 3300013307 | Bacteria | 9795 |
| 183 | Ga0157372_10013922 | 3300013307 | Bacteria | 8595 |
| 184 | Ga0182008_10000858 | 3300014497 | Bacteria | 21100 |
| 185 | Ga0182008_10002516 | 3300014497 | Bacteria | 11432 |
| 186 | Ga0182008_10005059 | 3300014497 | Bacteria | 7577 |
| 187 | Ga0182008_10007174 | 3300014497 | Bacteria | 6167 |
| 188 | Ga0182008_10025714 | 3300014497 | Bacteria | 2990 |
| 189 | Ga0157377_10000069 | 3300014745 | Bacteria | 80723 |
| 190 | Ga0157379_10019666 | 3300014968 | Bacteria | 5965 |
| 191 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 192 | Ga0182006_1003884 | 3300015261 | Bacteria | 7489 |
| 193 | Ga0182006_1006635 | 3300015261 | Bacteria | 5361 |
| 194 | Ga0182006_1010451 | 3300015261 | Bacteria | 4128 |
| 195 | Ga0182007_10000246 | 3300015262 | Bacteria | 36410 |
| 196 | Ga0182007_10001069 | 3300015262 | Bacteria | 14939 |
| 197 | Ga0182007_10002482 | 3300015262 | Bacteria | 9144 |
| 198 | Ga0182005_1000022 | 3300015265 | Bacteria | 266181 |
| 199 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 200 | Ga0163161_10000065 | 3300017792 | Bacteria | 108321 |
| 201 | Ga0163161_10001642 | 3300017792 | Bacteria | 16447 |
| 202 | Ga0209436_103337 | 3300025208 | Bacteria | 4318 |
| 203 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 204 | Ga0209784_100504 | 3300025224 | Bacteria | 15386 |
| 205 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 206 | Ga0209566_100392 | 3300025225 | Bacteria | 35300 |
| 207 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 208 | Ga0209674_100166 | 3300025226 | Bacteria | 85496 |
| 209 | Ga0209674_100227 | 3300025226 | Bacteria | 50941 |
| 210 | Ga0209674_100781 | 3300025226 | Bacteria | 10759 |
| 211 | Ga0209672_100138 | 3300025228 | Bacteria | 70350 |
| 212 | Ga0209672_101682 | 3300025228 | Bacteria | 7154 |
| 213 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 214 | Ga0209147_100419 | 3300025229 | Bacteria | 27989 |
| 215 | Ga0209147_100865 | 3300025229 | Bacteria | 14094 |
| 216 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 217 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 218 | Ga0209563_100090 | 3300025230 | Bacteria | 169322 |
| 219 | Ga0207427_102687 | 3300025231 | Bacteria | 4480 |
| 220 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 221 | Ga0209258_100176 | 3300025242 | Bacteria | 141261 |
| 222 | Ga0209258_100199 | 3300025242 | Bacteria | 123718 |
| 223 | Ga0207425_1001122 | 3300025245 | Bacteria | 12071 |
| 224 | Ga0207425_1002323 | 3300025245 | Bacteria | 6806 |
| 225 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 226 | Ga0209646_1000063 | 3300025246 | Bacteria | 248065 |
| 227 | Ga0209026_1001621 | 3300025250 | Bacteria | 9580 |
| 228 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 229 | Ga0209677_103192 | 3300025253 | Bacteria | 5499 |
| 230 | Ga0209677_106430 | 3300025253 | Bacteria | 2780 |
| 231 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 232 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 233 | Ga0209148_1000179 | 3300025254 | Bacteria | 126083 |
| 234 | Ga0209759_1000008 | 3300025256 | Bacteria | 461395 |
| 235 | Ga0209759_1000252 | 3300025256 | Bacteria | 79418 |
| 236 | Ga0209759_1001093 | 3300025256 | Bacteria | 17598 |
| 237 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 238 | Ga0209129_1003271 | 3300025258 | Bacteria | 7178 |
| 239 | Ga0209129_1003785 | 3300025258 | Bacteria | 6354 |
| 240 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 241 | Ga0209565_1000025 | 3300025263 | Bacteria | 377969 |
| 242 | Ga0209565_1000225 | 3300025263 | Bacteria | 63291 |
| 243 | Ga0209565_1003810 | 3300025263 | Bacteria | 4759 |
| 244 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 245 | Ga0209673_1000149 | 3300025273 | Bacteria | 148659 |
| 246 | Ga0209673_1000178 | 3300025273 | Bacteria | 128628 |
| 247 | Ga0209673_1000209 | 3300025273 | Bacteria | 117670 |
| 248 | Ga0209673_1000546 | 3300025273 | Bacteria | 61140 |
| 249 | Ga0209673_1001087 | 3300025273 | Bacteria | 30591 |
| 250 | Ga0209673_1008087 | 3300025273 | Bacteria | 4729 |
| 251 | Ga0209130_1000335 | 3300025284 | Bacteria | 53993 |
| 252 | Ga0209130_1000773 | 3300025284 | Bacteria | 27625 |
| 253 | Ga0209130_1000889 | 3300025284 | Bacteria | 24355 |
| 254 | Ga0209130_1001074 | 3300025284 | Bacteria | 20497 |
| 255 | Ga0209675_1000017 | 3300025291 | Bacteria | 378002 |
| 256 | Ga0209675_1000330 | 3300025291 | Bacteria | 41678 |
| 257 | Ga0209675_1000726 | 3300025291 | Bacteria | 22391 |
| 258 | Ga0209675_1004757 | 3300025291 | Bacteria | 5912 |
| 259 | Ga0209675_1007352 | 3300025291 | Bacteria | 4236 |
| 260 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 261 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 262 | Ga0209676_1000124 | 3300025292 | Bacteria | 194206 |
| 263 | Ga0209676_1000618 | 3300025292 | Bacteria | 51827 |
| 264 | Ga0209676_1005892 | 3300025292 | Bacteria | 6228 |
| 265 | Ga0209025_1000217 | 3300025294 | Bacteria | 137909 |
| 266 | Ga0209025_1001632 | 3300025294 | Bacteria | 27895 |
| 267 | Ga0209025_1004121 | 3300025294 | Bacteria | 12918 |
| 268 | Ga0209025_1008870 | 3300025294 | Bacteria | 7123 |
| 269 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 270 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 271 | Ga0209564_1000423 | 3300025295 | Bacteria | 74528 |
| 272 | Ga0209564_1004174 | 3300025295 | Bacteria | 9027 |
| 273 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 274 | Ga0209758_1000640 | 3300025297 | Bacteria | 53312 |
| 275 | Ga0209758_1004374 | 3300025297 | Bacteria | 11812 |
| 276 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 277 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 278 | Ga0209050_1001045 | 3300025298 | Bacteria | 34179 |
| 279 | Ga0209050_1003991 | 3300025298 | Bacteria | 10406 |
| 280 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 281 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 282 | Ga0209256_1004326 | 3300025299 | Bacteria | 9027 |
| 283 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 284 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 285 | Ga0207426_1000176 | 3300025302 | Bacteria | 159819 |
| 286 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 287 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 288 | Ga0209051_1000161 | 3300025303 | Bacteria | 125704 |
| 289 | Ga0209051_1000207 | 3300025303 | Bacteria | 103683 |
| 290 | Ga0209051_1000342 | 3300025303 | Bacteria | 70022 |
| 291 | Ga0209051_1000553 | 3300025303 | Bacteria | 45537 |
| 292 | Ga0209051_1031147 | 3300025303 | Bacteria | 2057 |
| 293 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 294 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 295 | Ga0209257_1000258 | 3300025304 | Bacteria | 122220 |
| 296 | Ga0209257_1000497 | 3300025304 | Bacteria | 70185 |
| 297 | Ga0209257_1007259 | 3300025304 | Bacteria | 6770 |
| 298 | Ga0207655_1001510 | 3300025728 | Bacteria | 21219 |
| 299 | Ga0207713_1000216 | 3300025735 | Bacteria | 77877 |
| 300 | Ga0207647_10017352 | 3300025904 | Bacteria | 4893 |
| 301 | Ga0207645_10001088 | 3300025907 | Bacteria | 22402 |
| 302 | Ga0207645_10014282 | 3300025907 | Bacteria | 5319 |
| 303 | Ga0207645_10032664 | 3300025907 | Bacteria | 3346 |
| 304 | Ga0207705_10001595 | 3300025909 | Bacteria | 18008 |
| 305 | Ga0207705_10108311 | 3300025909 | Bacteria | 2050 |
| 306 | Ga0207654_10025261 | 3300025911 | Bacteria | 3202 |
| 307 | Ga0207695_10007973 | 3300025913 | Bacteria | 13358 |
| 308 | Ga0207671_10012547 | 3300025914 | Bacteria | 6805 |
| 309 | Ga0207657_10009403 | 3300025919 | Bacteria | 9827 |
| 310 | Ga0207657_10029448 | 3300025919 | Bacteria | 4998 |
| 311 | Ga0207657_10161522 | 3300025919 | Bacteria | 1819 |
| 312 | Ga0207649_10000685 | 3300025920 | Bacteria | 22462 |
| 313 | Ga0207681_10013913 | 3300025923 | Bacteria | 4985 |
| 314 | Ga0207681_10013942 | 3300025923 | Bacteria | 4981 |
| 315 | Ga0207694_10021430 | 3300025924 | Bacteria | 4897 |
| 316 | Ga0207650_10013966 | 3300025925 | Bacteria | 5574 |
| 317 | Ga0207650_10080685 | 3300025925 | Bacteria | 2467 |
| 318 | Ga0207659_10006927 | 3300025926 | Bacteria | 6966 |
| 319 | Ga0207687_10034857 | 3300025927 | Bacteria | 3421 |
| 320 | Ga0207690_10002716 | 3300025932 | Bacteria | 10679 |
| 321 | Ga0207690_10027381 | 3300025932 | Bacteria | 3602 |
| 322 | Ga0207706_10005682 | 3300025933 | Bacteria | 11617 |
| 323 | Ga0207706_10043763 | 3300025933 | Bacteria | 3967 |
| 324 | Ga0207706_10045849 | 3300025933 | Bacteria | 3872 |
| 325 | Ga0207706_10116928 | 3300025933 | Bacteria | 2345 |
| 326 | Ga0207686_10003686 | 3300025934 | Bacteria | 8210 |
| 327 | Ga0207686_10003820 | 3300025934 | Bacteria | 8079 |
| 328 | Ga0207709_10000079 | 3300025935 | Bacteria | 166220 |
| 329 | Ga0207709_10000669 | 3300025935 | Bacteria | 27749 |
| 330 | Ga0207709_10001323 | 3300025935 | Bacteria | 17535 |
| 331 | Ga0207670_10002264 | 3300025936 | Bacteria | 10075 |
| 332 | Ga0207691_10000679 | 3300025940 | Bacteria | 33608 |
| 333 | Ga0207711_10165856 | 3300025941 | Bacteria | 2002 |
| 334 | Ga0207689_10000725 | 3300025942 | Bacteria | 31641 |
| 335 | Ga0207689_10038223 | 3300025942 | Bacteria | 3977 |
| 336 | Ga0207661_10080313 | 3300025944 | Bacteria | 2691 |
| 337 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 338 | Ga0207679_10076189 | 3300025945 | Bacteria | 2548 |
| 339 | Ga0207667_10096796 | 3300025949 | Bacteria | 3046 |
| 340 | Ga0207667_10113394 | 3300025949 | Bacteria | 2795 |
| 341 | Ga0207667_10252888 | 3300025949 | Bacteria | 1803 |
| 342 | Ga0207651_10058495 | 3300025960 | Bacteria | 2664 |
| 343 | Ga0207640_10000211 | 3300025981 | Bacteria | 40994 |
| 344 | Ga0207640_10012778 | 3300025981 | Bacteria | 4794 |
| 345 | Ga0207640_10019077 | 3300025981 | Bacteria | 4044 |
| 346 | Ga0207658_10014951 | 3300025986 | Bacteria | 5320 |
| 347 | Ga0207677_10008506 | 3300026023 | Bacteria | 5738 |
| 348 | Ga0207677_10019506 | 3300026023 | Bacteria | 4096 |
| 349 | Ga0207703_10038291 | 3300026035 | Bacteria | 3826 |
| 350 | Ga0207639_10009478 | 3300026041 | Bacteria | 6720 |
| 351 | Ga0207678_10000180 | 3300026067 | Bacteria | 54051 |
| 352 | Ga0207702_10000020 | 3300026078 | Bacteria | 203299 |
| 353 | Ga0207702_10007986 | 3300026078 | Bacteria | 8967 |
| 354 | Ga0207648_10004458 | 3300026089 | Bacteria | 14366 |
| 355 | Ga0207648_10004554 | 3300026089 | Bacteria | 14218 |
| 356 | Ga0207648_10071462 | 3300026089 | Bacteria | 3024 |
| 357 | Ga0207648_10081018 | 3300026089 | Bacteria | 2832 |
| 358 | Ga0207674_10010346 | 3300026116 | Bacteria | 10576 |
| 359 | Ga0207674_10060157 | 3300026116 | Bacteria | 3842 |
| 360 | Ga0207674_10076146 | 3300026116 | Bacteria | 3364 |
| 361 | Ga0207674_10208606 | 3300026116 | Bacteria | 1903 |
| 362 | Ga0207675_100000273 | 3300026118 | Bacteria | 49026 |
| 363 | Ga0207675_100000765 | 3300026118 | Bacteria | 32007 |
| 364 | Ga0207675_100021837 | 3300026118 | Bacteria | 5960 |
| 365 | Ga0207683_10011057 | 3300026121 | Bacteria | 7690 |
| 366 | Ga0207683_10100635 | 3300026121 | Bacteria | 2580 |
| 367 | Ga0207698_10021438 | 3300026142 | Bacteria | 4468 |
| 368 | Ga0207698_10023722 | 3300026142 | Bacteria | 4291 |
| 369 | Ga0209281_1000067 | 3300027111 | Bacteria | 284517 |
| 370 | Ga0209282_1001023 | 3300027666 | Bacteria | 14708 |
| 371 | Ga0209974_10015044 | 3300027876 | Bacteria | 2570 |
| 372 | Ga0207428_10013627 | 3300027907 | Bacteria | 7092 |
| 373 | Ga0268264_10058582 | 3300028381 | Bacteria | 3226 |
| 374 | Ga0307517_10003441 | 3300028786 | Bacteria | 24604 |
| 375 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 376 | Ga0307515_10000058 | 3300028794 | Bacteria | 259680 |
| 377 | Ga0307515_10000183 | 3300028794 | Bacteria | 154076 |
| 378 | Ga0307515_10001346 | 3300028794 | Bacteria | 55608 |
| 379 | Ga0307515_10012069 | 3300028794 | Bacteria | 16303 |
| 380 | Ga0307515_10025071 | 3300028794 | Bacteria | 10342 |
| 381 | Ga0307515_10073933 | 3300028794 | Bacteria | 4569 |
| 382 | Ga0307515_10104117 | 3300028794 | Bacteria | 3395 |
| 383 | Ga0307515_10120319 | 3300028794 | Bacteria | 2980 |
| 384 | Ga0307515_10121568 | 3300028794 | Bacteria | 2953 |
| 385 | Ga0307512_10035162 | 3300030522 | Bacteria | 4275 |
| 386 | Ga0307512_10040192 | 3300030522 | Bacteria | 3908 |
| 387 | Ga0316177_1155812 | 3300030731 | Bacteria | 2745 |
| 388 | Ga0316178_1067235 | 3300030735 | Bacteria | 3028 |
| 389 | Ga0316182_1211861 | 3300030745 | Bacteria | 5796 |
| 390 | Ga0265327_10000108 | 3300031251 | Bacteria | 183209 |
| 391 | Ga0265327_10012096 | 3300031251 | Bacteria | 5857 |
| 392 | Ga0307513_10001393 | 3300031456 | Bacteria | 34808 |
| 393 | Ga0307513_10002544 | 3300031456 | Bacteria | 25207 |
| 394 | Ga0307513_10029784 | 3300031456 | Bacteria | 6213 |
| 395 | Ga0307513_10057706 | 3300031456 | Bacteria | 4133 |
| 396 | Ga0307513_10118098 | 3300031456 | Bacteria | 2627 |
| 397 | Ga0307513_10139518 | 3300031456 | Bacteria | 2353 |
| 398 | Ga0307509_10006292 | 3300031507 | Bacteria | 16042 |
| 399 | Ga0307509_10022418 | 3300031507 | Bacteria | 7118 |
| 400 | Ga0307408_100000171 | 3300031548 | Bacteria | 73180 |
| 401 | Ga0307408_100010201 | 3300031548 | Bacteria | 6198 |
| 402 | Ga0307508_10002459 | 3300031616 | Bacteria | 19534 |
| 403 | Ga0307508_10025856 | 3300031616 | Bacteria | 5322 |
| 404 | Ga0307514_10009679 | 3300031649 | Bacteria | 8084 |
| 405 | Ga0307514_10076807 | 3300031649 | Bacteria | 2487 |
| 406 | Ga0265342_10003734 | 3300031712 | Bacteria | 12316 |
| 407 | Ga0307516_10000394 | 3300031730 | Bacteria | 57048 |
| 408 | Ga0307516_10000709 | 3300031730 | Bacteria | 45280 |
| 409 | Ga0307516_10043849 | 3300031730 | Bacteria | 4430 |
| 410 | Ga0307405_10058112 | 3300031731 | Bacteria | 2432 |
| 411 | Ga0307405_10065404 | 3300031731 | Bacteria | 2314 |
| 412 | Ga0316577_10003504 | 3300031733 | Bacteria | 7938 |
| 413 | Ga0307413_10063938 | 3300031824 | Bacteria | 2284 |
| 414 | Ga0307406_10009023 | 3300031901 | Bacteria | 5575 |
| 415 | Ga0307406_10014914 | 3300031901 | Bacteria | 4481 |
| 416 | Ga0307406_10055227 | 3300031901 | Bacteria | 2538 |
| 417 | Ga0307412_10077345 | 3300031911 | Bacteria | 2288 |
| 418 | Ga0307409_100001404 | 3300031995 | Bacteria | 11782 |
| 419 | Ga0307416_100001711 | 3300032002 | Bacteria | 12144 |
| 420 | Ga0307416_100018029 | 3300032002 | Bacteria | 4960 |
| 421 | Ga0307414_10099665 | 3300032004 | Bacteria | 2183 |
| 422 | Ga0307510_10000467 | 3300033180 | Bacteria | 39376 |
| 423 | Ga0307510_10027809 | 3300033180 | Bacteria | 6469 |
| 424 | Ga0373931_0008464 | 3300035691 | Bacteria | 4881 |
| 425 | Ga0316582_0014944 | 3300036647 | Bacteria | 4422 |
| 426 | Ga0395899_0001262 | 3300037312 | Bacteria | 22015 |
| 427 | Ga0395899_0007932 | 3300037312 | Bacteria | 8177 |
| 428 | Ga0395899_0009990 | 3300037312 | Bacteria | 7279 |
| 429 | Ga0395900_0006722 | 3300037418 | Bacteria | 11937 |
| 430 | Ga0395900_0007236 | 3300037418 | Bacteria | 11494 |
| 431 | Ga0395900_0040318 | 3300037418 | Bacteria | 4812 |
| 432 | Ga0395900_0096206 | 3300037418 | Bacteria | 3042 |
| 433 | Ga0395898_0014953 | 3300037466 | Bacteria | 7969 |
| 434 | Ga0395898_0019254 | 3300037466 | Bacteria | 6949 |
| 435 | Ga0395898_0035857 | 3300037466 | Bacteria | 4929 |
| 436 | Ga0395905_0001220 | 3300037471 | Bacteria | 32038 |
| 437 | Ga0395905_0004024 | 3300037471 | Bacteria | 15424 |
| 438 | Ga0395905_0005314 | 3300037471 | Bacteria | 13162 |
| 439 | Ga0395905_0006792 | 3300037471 | Bacteria | 11467 |
| 440 | Ga0395905_0010108 | 3300037471 | Bacteria | 9198 |
| 441 | Ga0395905_0013012 | 3300037471 | Bacteria | 7995 |
| 442 | Ga0395905_0044653 | 3300037471 | Bacteria | 4158 |
| 443 | Ga0395901_0002505 | 3300038443 | Bacteria | 18588 |
| 444 | Ga0395901_0011310 | 3300038443 | Bacteria | 9042 |
| 445 | Ga0395901_0094682 | 3300038443 | Bacteria | 3129 |
| 446 | Ga0395901_0121647 | 3300038443 | Bacteria | 2743 |
| 447 | Ga0395901_0203504 | 3300038443 | Bacteria | 2075 |
| 448 | Ga0400483_039388 | 3300039062 | Bacteria | 10971 |
| 449 | Ga0400483_059443 | 3300039062 | Bacteria | 2302 |
| 450 | Ga0400483_195602 | 3300039062 | Bacteria | 8670 |
| 451 | Ga0439436_0000586 | 3300041404 | Bacteria | 9641 |
| 452 | Ga0439436_0005259 | 3300041404 | Bacteria | 3963 |
| 453 | Ga0439436_0014067 | 3300041404 | Bacteria | 2418 |
| 454 | Ga0439439_0002574 | 3300041406 | Bacteria | 3874 |
| 455 | Ga0439439_0004979 | 3300041406 | Bacteria | 3014 |
| 456 | Ga0439447_013177 | 3300041407 | Bacteria | 2352 |
| 457 | Ga0439466_0015170 | 3300041411 | Bacteria | 2800 |
| 458 | Ga0439465_0000571 | 3300041413 | Bacteria | 11082 |
| 459 | Ga0439465_0020677 | 3300041413 | Bacteria | 2062 |
| 460 | Ga0439431_0000218 | 3300041997 | Bacteria | 11553 |
| 461 | Ga0439433_0000683 | 3300041999 | Bacteria | 6556 |
| 462 | Ga0439445_0000180 | 3300042004 | Bacteria | 11305 |
| 463 | Ga0439432_000464 | 3300042006 | Bacteria | 15181 |
| 464 | Ga0439432_010622 | 3300042006 | Bacteria | 3184 |
| 465 | Ga0439432_021413 | 3300042006 | Bacteria | 2143 |
| 466 | Ga0439449_0000184 | 3300042007 | Bacteria | 21742 |
| 467 | Ga0439449_0001212 | 3300042007 | Bacteria | 10127 |
| 468 | Ga0439449_0004083 | 3300042007 | Bacteria | 5651 |
| 469 | Ga0439449_0006024 | 3300042007 | Bacteria | 4631 |
| 470 | Ga0439452_002076 | 3300042010 | Bacteria | 7603 |
| 471 | Ga0439452_003379 | 3300042010 | Bacteria | 5604 |
| 472 | Ga0439452_011899 | 3300042010 | Bacteria | 2490 |
| 473 | Ga0439455_0006751 | 3300042012 | Bacteria | 2398 |
| 474 | Ga0439457_007377 | 3300042014 | Bacteria | 2642 |
| 475 | Ga0439462_0000535 | 3300042015 | Bacteria | 7527 |
| 476 | Ga0439462_0001407 | 3300042015 | Bacteria | 5336 |
| 477 | Ga0450911_001243 | 3300042115 | Bacteria | 6136 |
| 478 | Ga0450923_000177 | 3300042125 | Bacteria | 5979 |
| 479 | Ga0450923_006162 | 3300042125 | Bacteria | 1974 |
| 480 | Ga0450890_003471 | 3300042127 | Bacteria | 2093 |
| 481 | Ga0450906_005273 | 3300042145 | Bacteria | 2669 |
| 482 | Ga0450910_004095 | 3300042147 | Bacteria | 1962 |
| 483 | Ga0439446_0000560 | 3300042156 | Bacteria | 7536 |
| 484 | Ga0439446_0002189 | 3300042156 | Bacteria | 4655 |
| 485 | Ga0439446_0013243 | 3300042156 | Bacteria | 2262 |
| 486 | Ga0450908_006164 | 3300042184 | Bacteria | 2284 |
| 487 | Ga0450909_000694 | 3300042185 | Bacteria | 4509 |
| 488 | Ga0439434_0000517 | 3300042435 | Bacteria | 10981 |
| 489 | Ga0439434_0002373 | 3300042435 | Bacteria | 5468 |
| 490 | Ga0439464_0014316 | 3300042439 | Bacteria | 2131 |
| 491 | Ga0450918_000031 | 3300042531 | Bacteria | 28580 |
| 492 | Ga0450918_001470 | 3300042531 | Bacteria | 4669 |
| 493 | Ga0451577_0003137 | 3300042876 | Bacteria | 18623 |
| 494 | Ga0451577_0005516 | 3300042876 | Bacteria | 12930 |
| 495 | Ga0466986_0085020 | 3300044650 | Bacteria | 2188 |
| 496 | Ga0466969_0030672 | 3300044656 | Bacteria | 2739 |
| 497 | Ga0453683_0019338 | 3300044673 | Bacteria | 4364 |
| 498 | Ga0453683_0026131 | 3300044673 | Bacteria | 3708 |
| 499 | Ga0466965_0051731 | 3300044683 | Bacteria | 2038 |
| 500 | Ga0466961_0000282 | 3300044693 | Bacteria | 33721 |
| 501 | Ga0466964_0028039 | 3300044706 | Bacteria | 2215 |
| 502 | Ga0453684_0006348 | 3300044712 | Bacteria | 22539 |
| 503 | Ga0453684_0083911 | 3300044712 | Bacteria | 3964 |
| 504 | Ga0453684_0087245 | 3300044712 | Bacteria | 3868 |
| 505 | Ga0453684_0202031 | 3300044712 | Bacteria | 2316 |
| 506 | Ga0466971_0056311 | 3300044719 | Bacteria | 1773 |
| 507 | Ga0466968_0036189 | 3300044735 | Bacteria | 2068 |
| 508 | Ga0466970_0003436 | 3300044765 | Bacteria | 7710 |
| 509 | Ga0466957_0025411 | 3300044842 | Bacteria | 3510 |
| 510 | Ga0466960_0023805 | 3300044901 | Bacteria | 2754 |
| 511 | Ga0466959_0000688 | 3300045049 | Bacteria | 19769 |
| 512 | Ga0451576_0012565 | 3300045051 | Bacteria | 9505 |
| 513 | Ga0466967_0043465 | 3300045976 | Bacteria | 3890 |
| 514 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 515 | Ga0495592_0000522 | 3300046454 | Bacteria | 27736 |
| 516 | Ga0495592_0005989 | 3300046454 | Bacteria | 9041 |
| 517 | Ga0495603_0020046 | 3300046455 | Bacteria | 4052 |
| 518 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 519 | Ga0495590_0003118 | 3300046457 | Bacteria | 6778 |
| 520 | Ga0495591_002109 | 3300046458 | Bacteria | 11445 |
| 521 | Ga0495629_0000033 | 3300046459 | Bacteria | 120105 |
| 522 | Ga0495629_0001604 | 3300046459 | Bacteria | 17768 |
| 523 | Ga0495629_0006464 | 3300046459 | Bacteria | 8680 |
| 524 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 525 | Ga0495638_0007694 | 3300046460 | Bacteria | 7700 |
| 526 | Ga0495638_0008411 | 3300046460 | Bacteria | 7319 |
| 527 | Ga0495638_0019007 | 3300046460 | Bacteria | 4551 |
| 528 | Ga0495641_0041619 | 3300046461 | Bacteria | 2134 |
| 529 | Ga0495653_0000163 | 3300046463 | Bacteria | 54806 |
| 530 | Ga0495653_0106316 | 3300046463 | Bacteria | 2024 |
| 531 | Ga0495650_0000170 | 3300046471 | Bacteria | 143177 |
| 532 | Ga0495650_0000213 | 3300046471 | Bacteria | 123910 |
| 533 | Ga0495650_0000240 | 3300046471 | Bacteria | 109029 |
| 534 | Ga0495650_0001256 | 3300046471 | Bacteria | 26185 |
| 535 | Ga0495650_0002103 | 3300046471 | Bacteria | 17084 |
| 536 | Ga0495650_0015376 | 3300046471 | Bacteria | 3926 |
| 537 | Ga0495580_0002043 | 3300046472 | Bacteria | 17732 |
| 538 | Ga0495580_0002298 | 3300046472 | Bacteria | 16682 |
| 539 | Ga0495580_0028629 | 3300046472 | Bacteria | 4049 |
| 540 | Ga0495582_0021694 | 3300046473 | Bacteria | 3514 |
| 541 | Ga0495605_0000056 | 3300046474 | Bacteria | 155610 |
| 542 | Ga0495605_0017680 | 3300046474 | Bacteria | 3835 |
| 543 | Ga0495639_0002959 | 3300046475 | Bacteria | 7391 |
| 544 | Ga0495664_0008185 | 3300046477 | Bacteria | 5824 |
| 545 | Ga0495664_0063512 | 3300046477 | Bacteria | 2201 |
| 546 | Ga0495585_0043088 | 3300046492 | Bacteria | 2525 |
| 547 | Ga0495596_0000329 | 3300046500 | Bacteria | 30887 |
| 548 | Ga0495596_0004008 | 3300046500 | Bacteria | 7267 |
| 549 | Ga0495607_0000324 | 3300046501 | Bacteria | 49450 |
| 550 | Ga0495607_0001029 | 3300046501 | Bacteria | 25590 |
| 551 | Ga0495607_0001554 | 3300046501 | Bacteria | 20106 |
| 552 | Ga0495607_0003470 | 3300046501 | Bacteria | 12074 |
| 553 | Ga0495607_0004331 | 3300046501 | Bacteria | 10467 |
| 554 | Ga0495607_0014753 | 3300046501 | Bacteria | 5079 |
| 555 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 556 | Ga0495583_0001372 | 3300046506 | Bacteria | 25059 |
| 557 | Ga0495583_0002717 | 3300046506 | Bacteria | 14655 |
| 558 | Ga0495583_0005135 | 3300046506 | Bacteria | 9018 |
| 559 | Ga0495583_0007223 | 3300046506 | Bacteria | 7038 |
| 560 | Ga0495606_0005944 | 3300046507 | Bacteria | 11455 |
| 561 | Ga0495606_0006155 | 3300046507 | Bacteria | 11175 |
| 562 | Ga0495606_0016499 | 3300046507 | Bacteria | 5627 |
| 563 | Ga0495606_0020206 | 3300046507 | Bacteria | 4921 |
| 564 | Ga0495608_0018452 | 3300046511 | Bacteria | 4811 |
| 565 | Ga0495610_0000313 | 3300046512 | Bacteria | 51404 |
| 566 | Ga0495610_0003626 | 3300046512 | Bacteria | 11892 |
| 567 | Ga0495610_0006931 | 3300046512 | Bacteria | 7673 |
| 568 | Ga0495610_0007978 | 3300046512 | Bacteria | 6943 |
| 569 | Ga0495610_0023602 | 3300046512 | Bacteria | 3338 |
| 570 | Ga0495616_0000020 | 3300046513 | Bacteria | 162840 |
| 571 | Ga0495616_0000276 | 3300046513 | Bacteria | 41682 |
| 572 | Ga0495616_0003088 | 3300046513 | Bacteria | 10788 |
| 573 | Ga0495616_0003114 | 3300046513 | Bacteria | 10727 |
| 574 | Ga0495616_0004322 | 3300046513 | Bacteria | 8971 |
| 575 | Ga0495618_0002532 | 3300046514 | Bacteria | 11708 |
| 576 | Ga0495620_0011565 | 3300046515 | Bacteria | 4599 |
| 577 | Ga0495620_0026905 | 3300046515 | Bacteria | 2699 |
| 578 | Ga0495628_0007214 | 3300046516 | Bacteria | 9622 |
| 579 | Ga0495630_0002184 | 3300046517 | Bacteria | 13629 |
| 580 | Ga0495630_0009783 | 3300046517 | Bacteria | 6901 |
| 581 | Ga0495630_0110856 | 3300046517 | Bacteria | 2078 |
| 582 | Ga0495631_0000537 | 3300046518 | Bacteria | 25460 |
| 583 | Ga0495631_0001293 | 3300046518 | Bacteria | 15373 |
| 584 | Ga0495631_0004854 | 3300046518 | Bacteria | 7086 |
| 585 | Ga0495631_0022659 | 3300046518 | Bacteria | 2919 |
| 586 | Ga0495632_0000176 | 3300046519 | Bacteria | 65711 |
| 587 | Ga0495632_0001460 | 3300046519 | Bacteria | 19642 |
| 588 | Ga0495632_0007706 | 3300046519 | Bacteria | 6724 |
| 589 | Ga0495632_0008791 | 3300046519 | Bacteria | 6154 |
| 590 | Ga0495632_0036658 | 3300046519 | Bacteria | 2493 |
| 591 | Ga0495632_0074234 | 3300046519 | Bacteria | 1629 |
| 592 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 593 | Ga0495643_0000051 | 3300046522 | Bacteria | 207804 |
| 594 | Ga0495643_0000141 | 3300046522 | Bacteria | 115660 |
| 595 | Ga0495643_0000167 | 3300046522 | Bacteria | 104447 |
| 596 | Ga0495643_0000180 | 3300046522 | Bacteria | 100398 |
| 597 | Ga0495643_0000361 | 3300046522 | Bacteria | 61853 |
| 598 | Ga0495643_0031175 | 3300046522 | Bacteria | 2969 |
| 599 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 600 | Ga0495648_0001678 | 3300046524 | Bacteria | 21418 |
| 601 | Ga0495648_0023130 | 3300046524 | Bacteria | 4263 |
| 602 | Ga0495666_0005457 | 3300046526 | Bacteria | 6404 |
| 603 | Ga0495666_0008739 | 3300046526 | Bacteria | 5074 |
| 604 | Ga0495666_0074895 | 3300046526 | Bacteria | 1605 |
| 605 | Ga0495642_0000249 | 3300046528 | Bacteria | 30244 |
| 606 | Ga0495642_0001355 | 3300046528 | Bacteria | 10948 |
| 607 | Ga0495642_0026571 | 3300046528 | Bacteria | 2300 |
| 608 | Ga0495654_0005620 | 3300046530 | Bacteria | 7256 |
| 609 | Ga0495654_0006056 | 3300046530 | Bacteria | 6938 |
| 610 | Ga0495665_0008977 | 3300046531 | Bacteria | 5424 |
| 611 | Ga0495640_0016088 | 3300046533 | Bacteria | 5604 |
| 612 | Ga0495640_0024491 | 3300046533 | Bacteria | 4389 |
| 613 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 614 | Ga0495609_0000954 | 3300046538 | Bacteria | 20899 |
| 615 | Ga0495609_0004645 | 3300046538 | Bacteria | 7453 |
| 616 | Ga0495609_0011657 | 3300046538 | Bacteria | 4183 |
| 617 | Ga0495609_0013404 | 3300046538 | Bacteria | 3872 |
| 618 | Ga0495621_0001726 | 3300046539 | Bacteria | 5725 |
| 619 | Ga0495621_0011558 | 3300046539 | Bacteria | 2736 |
| 620 | Ga0495621_0022221 | 3300046539 | Bacteria | 2101 |
| 621 | Ga0495597_0000141 | 3300046542 | Bacteria | 64457 |
| 622 | Ga0495597_0000855 | 3300046542 | Bacteria | 23940 |
| 623 | Ga0495622_0000096 | 3300046557 | Bacteria | 77784 |
| 624 | Ga0495622_0000137 | 3300046557 | Bacteria | 62774 |
| 625 | Ga0495633_0000033 | 3300046558 | Bacteria | 186714 |
| 626 | Ga0495633_0000198 | 3300046558 | Bacteria | 76860 |
| 627 | Ga0495633_0002017 | 3300046558 | Bacteria | 14675 |
| 628 | Ga0495633_0003648 | 3300046558 | Bacteria | 10172 |
| 629 | Ga0495633_0006300 | 3300046558 | Bacteria | 7067 |
| 630 | Ga0495633_0041262 | 3300046558 | Bacteria | 2195 |
| 631 | Ga0495656_0009836 | 3300046615 | Bacteria | 3453 |
| 632 | Ga0495656_0010304 | 3300046615 | Bacteria | 3393 |
| 633 | Ga0495668_0000065 | 3300046616 | Bacteria | 178985 |
| 634 | Ga0495668_0000091 | 3300046616 | Bacteria | 144428 |
| 635 | Ga0495668_0002605 | 3300046616 | Bacteria | 14593 |
| 636 | Ga0495668_0012823 | 3300046616 | Bacteria | 4964 |
| 637 | Ga0495634_0035873 | 3300046642 | Bacteria | 3393 |
| 638 | Ga0495634_0065588 | 3300046642 | Bacteria | 2406 |
| 639 | Ga0495611_0000410 | 3300046648 | Bacteria | 26643 |
| 640 | Ga0495611_0005200 | 3300046648 | Bacteria | 5576 |
| 641 | Ga0495625_0000053 | 3300046660 | Bacteria | 190575 |
| 642 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 643 | Ga0495625_0000857 | 3300046660 | Bacteria | 41346 |
| 644 | Ga0495625_0002889 | 3300046660 | Bacteria | 17959 |
| 645 | Ga0495625_0007984 | 3300046660 | Bacteria | 9094 |
| 646 | Ga0495625_0013541 | 3300046660 | Bacteria | 6544 |
| 647 | Ga0495625_0076904 | 3300046660 | Bacteria | 2333 |
| 648 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 649 | Ga0495661_0000053 | 3300046665 | Bacteria | 140234 |
| 650 | Ga0495661_0000591 | 3300046665 | Bacteria | 37505 |
| 651 | Ga0495661_0000804 | 3300046665 | Bacteria | 29643 |
| 652 | Ga0495661_0011693 | 3300046665 | Bacteria | 5946 |
| 653 | Ga0495661_0016925 | 3300046665 | Bacteria | 4818 |
| 654 | Ga0495661_0032503 | 3300046665 | Bacteria | 3297 |
| 655 | Ga0495588_0000098 | 3300046674 | Bacteria | 166999 |
| 656 | Ga0495588_0013009 | 3300046674 | Bacteria | 3953 |
| 657 | Ga0495623_0000657 | 3300046679 | Bacteria | 22944 |
| 658 | Ga0495623_0008179 | 3300046679 | Bacteria | 6801 |
| 659 | Ga0495646_0006241 | 3300046680 | Bacteria | 7558 |
| 660 | Ga0495646_0023557 | 3300046680 | Bacteria | 3875 |
| 661 | Ga0495646_0025718 | 3300046680 | Bacteria | 3701 |
| 662 | Ga0495669_0004853 | 3300046684 | Bacteria | 5581 |
| 663 | Ga0495669_0012144 | 3300046684 | Bacteria | 3662 |
| 664 | Ga0495624_0002901 | 3300046690 | Bacteria | 12820 |
| 665 | Ga0495624_0003617 | 3300046690 | Bacteria | 11443 |
| 666 | Ga0495624_0052448 | 3300046690 | Bacteria | 2577 |
| 667 | Ga0495670_0032140 | 3300046691 | Bacteria | 2609 |
| 668 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 669 | Ga0495649_0000680 | 3300046694 | Bacteria | 27698 |
| 670 | Ga0495649_0004997 | 3300046694 | Bacteria | 8528 |
| 671 | Ga0495649_0006112 | 3300046694 | Bacteria | 7526 |
| 672 | Ga0495649_0017453 | 3300046694 | Bacteria | 4048 |
| 673 | Ga0495649_0070248 | 3300046694 | Bacteria | 1878 |
| 674 | Ga0495589_0000103 | 3300046794 | Bacteria | 81696 |
| 675 | Ga0495589_0000154 | 3300046794 | Bacteria | 63333 |
| 676 | Ga0495589_0008374 | 3300046794 | Bacteria | 5404 |
| 677 | Ga0495589_0017710 | 3300046794 | Bacteria | 3655 |
| 678 | Ga0495589_0031766 | 3300046794 | Bacteria | 2657 |
| 679 | Ga0495600_0006015 | 3300046809 | Bacteria | 7343 |
| 680 | Ga0495600_0029124 | 3300046809 | Bacteria | 3574 |
| 681 | Ga0495660_0000024 | 3300046810 | Bacteria | 268209 |
| 682 | Ga0495660_0000055 | 3300046810 | Bacteria | 134615 |
| 683 | Ga0495660_0000970 | 3300046810 | Bacteria | 20959 |
| 684 | Ga0495660_0006403 | 3300046810 | Bacteria | 6966 |
| 685 | Ga0495660_0009244 | 3300046810 | Bacteria | 5760 |
| 686 | Ga0495604_0000727 | 3300047317 | Bacteria | 27719 |
| 687 | Ga0495604_0003084 | 3300047317 | Bacteria | 13328 |
| 688 | Ga0495604_0044820 | 3300047317 | Bacteria | 3453 |
| 689 | Ga0495636_0002436 | 3300047318 | Bacteria | 7132 |
| 690 | Ga0495674_0002774 | 3300047319 | Bacteria | 16996 |
| 691 | Ga0495674_0072396 | 3300047319 | Bacteria | 2972 |
| 692 | Ga0495672_0000030 | 3300047320 | Bacteria | 305021 |
| 693 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 694 | Ga0495672_0001752 | 3300047320 | Bacteria | 20938 |
| 695 | Ga0495676_0044798 | 3300047321 | Bacteria | 3607 |
| 696 | Ga0495676_0050818 | 3300047321 | Bacteria | 3322 |
| 697 | Ga0495676_0113890 | 3300047321 | Bacteria | 1979 |
| 698 | Ga0495680_0177728 | 3300047322 | Bacteria | 1538 |
| 699 | Ga0495683_0000168 | 3300047323 | Bacteria | 63828 |
| 700 | Ga0495683_0027991 | 3300047323 | Bacteria | 2881 |
| 701 | Ga0495683_0038186 | 3300047323 | Bacteria | 2432 |
| 702 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 703 | Ga0495687_000523 | 3300047443 | Bacteria | 46029 |
| 704 | Ga0495687_000559 | 3300047443 | Bacteria | 43900 |
| 705 | Ga0495687_001650 | 3300047443 | Bacteria | 20063 |
| 706 | Ga0495687_003727 | 3300047443 | Bacteria | 10810 |
| 707 | Ga0495687_006879 | 3300047443 | Bacteria | 6851 |
| 708 | Ga0495687_021060 | 3300047443 | Bacteria | 3165 |
| 709 | Ga0495675_0030826 | 3300047444 | Bacteria | 3421 |
| 710 | Ga0495677_0000009 | 3300047445 | Bacteria | 170927 |
| 711 | Ga0495677_0000270 | 3300047445 | Bacteria | 22801 |
| 712 | Ga0495677_0003231 | 3300047445 | Bacteria | 6357 |
| 713 | Ga0495677_0004867 | 3300047445 | Bacteria | 5122 |
| 714 | Ga0495677_0005508 | 3300047445 | Bacteria | 4800 |
| 715 | Ga0495677_0018762 | 3300047445 | Bacteria | 2507 |
| 716 | Ga0495679_000030 | 3300047446 | Bacteria | 180083 |
| 717 | Ga0495679_007259 | 3300047446 | Bacteria | 4644 |
| 718 | Ga0495679_013850 | 3300047446 | Bacteria | 3009 |
| 719 | Ga0495685_001244 | 3300047447 | Bacteria | 7790 |
| 720 | Ga0495681_0012312 | 3300047470 | Bacteria | 5035 |
| 721 | Ga0495681_0016928 | 3300047470 | Bacteria | 4065 |
| 722 | Ga0495684_0016462 | 3300047471 | Bacteria | 5694 |
| 723 | Ga0495686_0002774 | 3300047472 | Bacteria | 15986 |
| 724 | Ga0495686_0007264 | 3300047472 | Bacteria | 8331 |
| 725 | Ga0495593_0046251 | 3300047673 | Bacteria | 2319 |
| 726 | Ga0495602_0012277 | 3300048088 | Bacteria | 8815 |
| 727 | Ga0495602_0051653 | 3300048088 | Bacteria | 3659 |
| 728 | Ga0495602_0119294 | 3300048088 | Bacteria | 2125 |
| 729 | Ga0495614_0007400 | 3300048089 | Bacteria | 4888 |
| 730 | Ga0495626_0000053 | 3300048091 | Bacteria | 155543 |
| 731 | Ga0495626_0000358 | 3300048091 | Bacteria | 47755 |
| 732 | Ga0495626_0005003 | 3300048091 | Bacteria | 7920 |
| 733 | Ga0496100_0007181 | 3300048903 | Bacteria | 6121 |
| 734 | Ga0496100_0015084 | 3300048903 | Bacteria | 4506 |
| 735 | Ga0496101_0000463 | 3300048904 | Bacteria | 25752 |
| 736 | Ga0496101_0007886 | 3300048904 | Bacteria | 6931 |
| 737 | Ga0496102_0003468 | 3300048905 | Bacteria | 13374 |
| 738 | Ga0496102_0007533 | 3300048905 | Bacteria | 9305 |
| 739 | Ga0496103_0002435 | 3300048906 | Bacteria | 11711 |
| 740 | Ga0496103_0016461 | 3300048906 | Bacteria | 4413 |
| 741 | Ga0496104_0009026 | 3300048907 | Bacteria | 8865 |
| 742 | Ga0496104_0009388 | 3300048907 | Bacteria | 8700 |
| 743 | Ga0496105_0006985 | 3300048908 | Bacteria | 8696 |
| 744 | Ga0496106_0024143 | 3300048909 | Bacteria | 4519 |
| 745 | Ga0496106_0039035 | 3300048909 | Bacteria | 3556 |
| 746 | Ga0496108_0025609 | 3300048911 | Bacteria | 4863 |
| 747 | Ga0496108_0078614 | 3300048911 | Bacteria | 2792 |
| 748 | Ga0496110_0038356 | 3300048913 | Bacteria | 4168 |
| 749 | Ga0496111_0048070 | 3300048914 | Bacteria | 3073 |
| 750 | Ga0496111_0073066 | 3300048914 | Bacteria | 2497 |
| 751 | Ga0496113_0001291 | 3300048916 | Bacteria | 13830 |
| 752 | Ga0496113_0009064 | 3300048916 | Bacteria | 6520 |
| 753 | Ga0496114_0040701 | 3300048917 | Bacteria | 3848 |
| 754 | Ga0496114_0119503 | 3300048917 | Bacteria | 2265 |
| 755 | Ga0496114_0127129 | 3300048917 | Bacteria | 2198 |
| 756 | Ga0496116_0009285 | 3300048919 | Bacteria | 8404 |
| 757 | Ga0496117_0010218 | 3300048920 | Bacteria | 8600 |
| 758 | Ga0496117_0066403 | 3300048920 | Bacteria | 2447 |
| 759 | Ga0496118_0000294 | 3300048921 | Bacteria | 86720 |
| 760 | Ga0496118_0002121 | 3300048921 | Bacteria | 27768 |
| 761 | Ga0496118_0014728 | 3300048921 | Bacteria | 7302 |
| 762 | Ga0496118_0038696 | 3300048921 | Bacteria | 3819 |
| 763 | Ga0496118_0049722 | 3300048921 | Bacteria | 3225 |
| 764 | Ga0496121_0012765 | 3300048924 | Bacteria | 9100 |
| 765 | Ga0496121_0060732 | 3300048924 | Bacteria | 3107 |
| 766 | Ga0496122_0000552 | 3300048925 | Bacteria | 77275 |
| 767 | Ga0496122_0001600 | 3300048925 | Bacteria | 35421 |
| 768 | Ga0496122_0007484 | 3300048925 | Bacteria | 12114 |
| 769 | Ga0496122_0012381 | 3300048925 | Bacteria | 8506 |
| 770 | Ga0496122_0042973 | 3300048925 | Bacteria | 3547 |
| 771 | Ga0496123_0001311 | 3300048926 | Bacteria | 35270 |
| 772 | Ga0496123_0001585 | 3300048926 | Bacteria | 30921 |
| 773 | Ga0496123_0001667 | 3300048926 | Bacteria | 29755 |
| 774 | Ga0496123_0019147 | 3300048926 | Bacteria | 5404 |
| 775 | Ga0496123_0032778 | 3300048926 | Bacteria | 3752 |
| 776 | Ga0496124_0003655 | 3300048927 | Bacteria | 18611 |
| 777 | Ga0496124_0004257 | 3300048927 | Bacteria | 16843 |
| 778 | Ga0496124_0010001 | 3300048927 | Bacteria | 9686 |
| 779 | Ga0496124_0041462 | 3300048927 | Bacteria | 3972 |
| 780 | Ga0496124_0046482 | 3300048927 | Bacteria | 3716 |
| 781 | Ga0496125_0001368 | 3300048928 | Bacteria | 35878 |
| 782 | Ga0496125_0009516 | 3300048928 | Bacteria | 9972 |
| 783 | Ga0496125_0026230 | 3300048928 | Bacteria | 5315 |
| 784 | Ga0496125_0053345 | 3300048928 | Bacteria | 3315 |
| 785 | Ga0496125_0107161 | 3300048928 | Bacteria | 2037 |
| 786 | Ga0496125_0116807 | 3300048928 | Bacteria | 1915 |
| 787 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 788 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 789 | Ga0495678_000040 | 3300049459 | Bacteria | 190664 |
| 790 | Ga0495678_000061 | 3300049459 | Bacteria | 142649 |
| 791 | Ga0495678_001554 | 3300049459 | Bacteria | 17698 |
| 792 | Ga0495678_003955 | 3300049459 | Bacteria | 8867 |
| 793 | Ga0495682_0000244 | 3300049460 | Bacteria | 43169 |
| 794 | Ga0501036_0051935 | 3300049572 | Bacteria | 3472 |
| 795 | Ga0501039_0021608 | 3300049575 | Bacteria | 4937 |
| 796 | Ga0501040_0056061 | 3300049576 | Bacteria | 2704 |
| 797 | Ga0501041_0073192 | 3300049577 | Bacteria | 2106 |
| 798 | Ga0501042_0030684 | 3300049578 | Bacteria | 3799 |
| 799 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 800 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 801 | Ga0501048_0000040 | 3300049582 | Bacteria | 63031 |
| 802 | Ga0501067_0022633 | 3300049583 | Bacteria | 3478 |
| 803 | Ga0501068_0009596 | 3300049584 | Bacteria | 5419 |
| 804 | Ga0501071_0080840 | 3300049587 | Bacteria | 2377 |
| 805 | Ga0501072_0040099 | 3300049588 | Bacteria | 3677 |
| 806 | Ga0501073_0000076 | 3300049589 | Bacteria | 61536 |
| 807 | Ga0501079_0000507 | 3300049741 | Bacteria | 25288 |
| 808 | Ga0501079_0120997 | 3300049741 | Bacteria | 2036 |
| 809 | Ga0501080_0000180 | 3300049742 | Bacteria | 46199 |
| 810 | Ga0501080_0156063 | 3300049742 | Bacteria | 2108 |
| 811 | Ga0501269_001273 | 3300049766 | Bacteria | 3386 |
| 812 | Ga0501035_0066607 | 3300049822 | Bacteria | 3196 |
| 813 | nmdc:mga03683_1072_c1 | 3300050489 | Bacteria | 8008 |
| 814 | nmdc:mga03683_33430_c1 | 3300050489 | Bacteria | 2075 |
| 815 | nmdc:mga03683_3616_c1 | 3300050489 | Bacteria | 5019 |
| 816 | nmdc:mga03683_3846_c1 | 3300050489 | Bacteria | 4902 |
| 817 | nmdc:mga03n38_117_c1 | 3300050490 | Bacteria | 17259 |
| 818 | nmdc:mga03n38_33023_c1 | 3300050490 | Bacteria | 2198 |
| 819 | nmdc:mga00v17_195_c1 | 3300050491 | Bacteria | 36325 |
| 820 | nmdc:mga0yw44_29339_c1 | 3300050492 | Bacteria | 3175 |
| 821 | nmdc:mga0yw44_38063_c1 | 3300050492 | Bacteria | 2844 |
| 822 | nmdc:mga0yw44_52028_c1 | 3300050492 | Bacteria | 2482 |
| 823 | nmdc:mga0k408_20161_c1 | 3300050493 | Bacteria | 3731 |
| 824 | nmdc:mga0k408_23570_c1 | 3300050493 | Bacteria | 3474 |
| 825 | nmdc:mga0k408_37461_c1 | 3300050493 | Bacteria | 2785 |
| 826 | nmdc:mga0k408_535_c1 | 3300050493 | Bacteria | 20913 |
| 827 | nmdc:mga0k408_58279_c1 | 3300050493 | Bacteria | 2243 |
| 828 | nmdc:mga07m45_13297_c1 | 3300050496 | Bacteria | 4365 |
| 829 | nmdc:mga07m45_1483_c1 | 3300050496 | Bacteria | 10779 |
| 830 | nmdc:mga07m45_218_c2 | 3300050496 | Bacteria | 22025 |
| 831 | nmdc:mga07m45_22053_c1 | 3300050496 | Bacteria | 3475 |
| 832 | nmdc:mga07m45_2951_c1 | 3300050496 | Bacteria | 8079 |
| 833 | nmdc:mga07m45_3087_c1 | 3300050496 | Bacteria | 7964 |
| 834 | nmdc:mga07m45_36120_c1 | 3300050496 | Bacteria | 2751 |
| 835 | nmdc:mga07m45_4694_c2 | 3300050496 | Bacteria | 5936 |
| 836 | nmdc:mga07m45_49934_c1 | 3300050496 | Bacteria | 2356 |
| 837 | nmdc:mga07m45_5845_c1 | 3300050496 | Bacteria | 6172 |
| 838 | Ga0500610_0000409 | 3300053079 | Bacteria | 13147 |
| 839 | Ga0500578_0061468 | 3300053086 | Bacteria | 2398 |
| 840 | Ga0500644_0006310 | 3300053088 | Bacteria | 3031 |
| 841 | Ga0500651_0014862 | 3300053093 | Bacteria | 4768 |
| 842 | Ga0500562_004965 | 3300053108 | Bacteria | 3351 |
| 843 | Ga0500571_000166 | 3300053110 | Bacteria | 23008 |
| 844 | Ga0500593_000327 | 3300053117 | Bacteria | 19196 |
| 845 | Ga0500594_0003936 | 3300053118 | Bacteria | 3273 |
| 846 | Ga0500607_053898 | 3300053121 | Bacteria | 2131 |
| 847 | Ga0500608_001339 | 3300053122 | Bacteria | 8814 |
| 848 | Ga0500655_000714 | 3300053133 | Bacteria | 6565 |
| 849 | Ga0500658_0000117 | 3300053134 | Bacteria | 37704 |
| 850 | Ga0500658_0000243 | 3300053134 | Bacteria | 25613 |
| 851 | Ga0500658_0000393 | 3300053134 | Bacteria | 19079 |
| 852 | Ga0500658_0022042 | 3300053134 | Bacteria | 2417 |
| 853 | Ga0500559_0000116 | 3300053136 | Bacteria | 63080 |
| 854 | Ga0500564_009198 | 3300053138 | Bacteria | 4288 |
| 855 | Ga0500568_0003268 | 3300053139 | Bacteria | 9151 |
| 856 | Ga0500568_0004444 | 3300053139 | Bacteria | 7491 |
| 857 | Ga0500586_002038 | 3300053145 | Bacteria | 4449 |
| 858 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 859 | Ga0500616_0028808 | 3300053153 | Bacteria | 3058 |
| 860 | Ga0500627_0000151 | 3300053158 | Bacteria | 20432 |
| 861 | Ga0500638_006320 | 3300053162 | Bacteria | 4835 |
| 862 | Ga0501084_0004502 | 3300054114 | Bacteria | 11391 |
| 863 | Ga0501082_0033843 | 3300060353 | Bacteria | 4408 |
| 864 | Ga0466962_0023298 | 3300061719 | Bacteria | 2975 |
| 865 | 2510247946 | 2510065045 | Bacteria | 7761063 |
| 866 | 2513229117 | 2513020051 | Bacteria | 6053213 |
| 867 | 2514049639 | 2513237166 | Bacteria | 10373764 |
| 868 | 2515685684 | 2515154122 | Bacteria | 8609520 |
| 869 | 2527075965 | 2526164713 | Bacteria | 6780608 |
| 870 | 2548501745 | 2547132374 | Bacteria | 5530232 |
| 871 | 2587756986 | 2585428062 | Bacteria | 6842168 |
| 872 | 2597028083 | 2596583598 | Bacteria | 5251611 |
| 873 | 2599444772 | 2599185178 | Bacteria | 5365746 |
| 874 | 2643864132 | 2643221570 | Bacteria | 5103772 |
| 875 | 2643992432 | 2643221596 | Bacteria | 5006805 |
| 876 | 2644159235 | 2643221628 | Bacteria | 5745828 |
| 877 | 2644248109 | 2643221644 | Bacteria | 6865017 |
| 878 | 2644252711 | 2643221645 | Bacteria | 7207331 |
| 879 | 2644292165 | 2643221652 | Bacteria | 5140275 |
| 880 | 2644303568 | 2643221654 | Bacteria | 5273570 |
| 881 | 2644328524 | 2643221658 | Bacteria | 6064537 |
| 882 | 2644355223 | 2643221664 | Bacteria | 7272945 |
| 883 | 2644399761 | 2643221672 | Bacteria | 6322190 |
| 884 | 2644646528 | 2643221717 | Bacteria | 5676132 |
| 885 | 2719643622 | 2718217991 | Bacteria | 7829542 |
| 886 | 2722883001 | 2721755523 | Bacteria | 6430384 |
| 887 | 2738721322 | 2738541277 | Bacteria | 7458140 |
| 888 | 2738880665 | 2738541307 | Bacteria | 8606193 |
| 889 | 2739280991 | 2738543019 | Bacteria | 7459457 |
| 890 | 2746090533 | 2744054900 | Bacteria | 8399525 |
| 891 | 2746098710 | 2744054901 | Bacteria | 8397047 |
| 892 | 2819601629 | 2818991446 | Bacteria | 7757362 |
| 893 | 2819619543 | 2818991450 | Bacteria | 6962147 |
| 894 | 2831269240 | 2831265667 | Bacteria | 7184833 |
| 895 | 2831270225 | 2831265667 | Bacteria | 7184833 |
| 896 | 2838059217 | 2838054893 | Bacteria | 7451788 |
| 897 | 2838059969 | 2838054893 | Bacteria | 7451788 |
| 898 | 2842681107 | 2842677519 | Bacteria | 5615038 |
| 899 | 2842712448 | 2842711865 | Bacteria | 7155354 |
| 900 | 2857555321 | 2857553236 | Bacteria | 6166726 |
| 901 | 2885193111 | 2885192300 | Bacteria | 5882526 |
| 902 | 2899930692 | 2899924645 | Bacteria | 7487985 |
| 903 | 2900582551 | 2900577576 | Bacteria | 5438534 |
| 904 | 2900638869 | 2900634093 | Bacteria | 10263517 |
| 905 | 2902688174 | 2902682994 | Bacteria | 8951596 |
| 906 | 2904425033 | 2904424332 | Bacteria | 7633521 |
| 907 | 2904436274 | 2904434214 | Bacteria | 6230908 |
| 908 | 2904453206 | 2904449895 | Bacteria | 6927402 |
| 909 | 2904459185 | 2904456579 | Bacteria | 6819253 |
| 910 | 2906802388 | 2906799679 | Bacteria | 4031749 |
| 911 | 2919466845 | 2919462493 | Bacteria | 5817112 |
| 912 | 2919477682 | 2919476304 | Bacteria | 5888696 |
| 913 | 2921648285 | 2921643360 | Bacteria | 11448031 |
| 914 | 2928040986 | 2928037797 | Bacteria | 7273642 |
| 915 | 2928047828 | 2928044640 | Bacteria | 7271509 |
| 916 | 2928054017 | 2928051484 | Bacteria | 7773759 |
| 917 | 2928055720 | 2928051484 | Bacteria | 7773759 |
| 918 | 2928059903 | 2928058823 | Bacteria | 5520022 |
| 919 | 2928065770 | 2928064002 | Bacteria | 7419480 |
| 920 | 2928069819 | 2928064002 | Bacteria | 7419480 |
| 921 | 2928088523 | 2928084124 | Bacteria | 7159212 |
| 922 | 2928088689 | 2928084124 | Bacteria | 7159212 |
| 923 | 2928111430 | 2928108538 | Bacteria | 7360024 |
| 924 | 2928119345 | 2928115317 | Bacteria | 6477646 |
| 925 | 2928138232 | 2928135762 | Bacteria | 7259641 |
| 926 | 2928504960 | 2928503688 | Bacteria | 7268108 |
| 927 | 2929523946 | 2929520902 | Bacteria | 6765052 |
| 928 | 2945912709 | 2945909444 | Bacteria | 7065066 |
| 929 | 2945948377 | 2945945610 | Bacteria | 5951079 |
| 930 | 2945972775 | 2945972063 | Bacteria | 6086495 |
| 931 | 2990714745 | 2990710928 | Bacteria | 5002431 |
| 932 | 642615121 | 642555113 | Bacteria | 8214658 |
| 933 | 8021626165 | 8021622325 | Bacteria | 4844743 |
| 934 | 8021627220 | 8021626552 | Bacteria | 4665214 |
| 935 | 8021651154 | 8021648035 | Bacteria | 4772378 |
| 936 | 8045831330 | 8045830549 | Bacteria | 4444727 |
| 937 | 8047677419 | 8047673197 | Bacteria | 7395230 |
| 938 | 8055270490 | 8055266321 | Bacteria | 7999742 |
| 939 | Ga0105237_10031465 | |||
| 940 | JGI24741J21665_1000483 | |||
| 941 | JGI24740J21852_10000011 | |||
| 942 | JGI24740J21852_10000057 | |||
| 943 | JGI25156J39149_1000766 | |||
| 944 | JGI25156J39149_1001052 | |||
| 945 | JGI25154J39366_1001383 | |||
| 946 | JGI25150J39212_1001922 | |||
| 947 | JGI25159J45721_1002978 | |||
| 948 | JGI25151J46595_10000539 | |||
| 949 | JGI25151J46595_10009324 | |||
| 950 | JGI25165J46597_1002776 | |||
| 951 | JGI25153J46596_10005865 | |||
| 952 | rootL2_10017019 | |||
| 953 | rootL2_10056402 | |||
| 954 | rootH1_10060501 | |||
| 955 | JGI25160J50197_1003596 | |||
| 956 | JGI25160J50197_1003664 | |||
| 957 | JGI25161J50226_1001263 | |||
| 958 | JGI25161J50226_1001680 | |||
| 959 | Ga0006562J51391_1103569 | |||
| 960 | Ga0055539_1000168 | |||
| 961 | Ga0055533_1000914 | |||
| 962 | Ga0055533_1001105 | |||
| 963 | Ga0055533_1003457 | |||
| 964 | Ga0055532_1000033 | |||
| 965 | Ga0055525_1000069 | |||
| 966 | Ga0055525_1000438 | |||
| 967 | Ga0055527_1002323 | |||
| 968 | Ga0055535_1000024 | |||
| 969 | Ga0055535_1000422 | |||
| 970 | Ga0055535_1000625 | |||
| 971 | Ga0055542_1000074 | |||
| 972 | Ga0055542_1000087 | |||
| 973 | Ga0055542_1000945 | |||
| 974 | Ga0055529_1000044 | |||
| 975 | Ga0055526_1000028 | |||
| 976 | Ga0055526_1003120 | |||
| 977 | Ga0055526_1006453 | |||
| 978 | Ga0055526_1006607 | |||
| 979 | Ga0055537_1000064 | |||
| 980 | Ga0055537_1002664 | |||
| 981 | Ga0055524_1002010 | |||
| 982 | Ga0055524_1007424 | |||
| 983 | Ga0055536_1002562 | |||
| 984 | Ga0055536_1002590 | |||
| 985 | Ga0055536_1005253 | |||
| 986 | Ga0055534_1000094 | |||
| 987 | Ga0055534_1002480 | |||
| 988 | Ga0055528_1000142 | |||
| 989 | Ga0055528_1000250 | |||
| 990 | Ga0055528_1005571 | |||
| 991 | Ga0055530_10000492 | |||
| 992 | Ga0055530_10004165 | |||
| 993 | Ga0055540_1001880 | |||
| 994 | Ga0055540_1002209 | |||
| 995 | Ga0055540_1002683 | |||
| 996 | Ga0055540_1004595 | |||
| 997 | Ga0055540_1004949 | |||
| 998 | Ga0055540_1018559 | |||
| 999 | Ga0055531_10000738 | |||
| 1000 | Ga0055531_10003879 | |||
| 1001 | Ga0055531_10003975 | |||
| 1002 | Ga0055531_10007175 | |||
| 1003 | Ga0055531_10016465 | |||
| 1004 | Ga0055541_1000910 | |||
| 1005 | Ga0055541_1006948 | |||
| 1006 | Ga0055543_1001897 | |||
| 1007 | Ga0055543_1003550 | |||
| 1008 | Ga0065165_1004159 | |||
| 1009 | Ga0070658_10004140 | |||
| 1010 | Ga0070658_10045957 | |||
| 1011 | Ga0070676_10000646 | |||
| 1012 | Ga0070676_10031428 | |||
| 1013 | Ga0070683_100048160 | |||
| 1014 | Ga0070670_100005736 | |||
| 1015 | Ga0070670_100055022 | |||
| 1016 | Ga0070670_100096969 | |||
| 1017 | Ga0068869_100000695 | |||
| 1018 | Ga0070682_100001807 | |||
| 1019 | Ga0068868_100021364 | |||
| 1020 | Ga0068868_100046105 | |||
| 1021 | Ga0070689_100003286 | |||
| 1022 | Ga0070661_100000027 | |||
| 1023 | Ga0070661_100037837 | |||
| 1024 | Ga0070661_100040997 | |||
| 1025 | Ga0070669_100015690 | |||
| 1026 | Ga0070675_100107152 | |||
| 1027 | Ga0070671_100150864 | |||
| 1028 | Ga0070673_100019369 | |||
| 1029 | Ga0070659_100001366 | |||
| 1030 | Ga0070659_100023144 | |||
| 1031 | Ga0070667_100012849 | |||
| 1032 | Ga0070667_100028651 | |||
| 1033 | Ga0070663_100000004 | |||
| 1034 | Ga0070678_100027281 | |||
| 1035 | Ga0070662_100007206 | |||
| 1036 | Ga0070662_100078902 | |||
| 1037 | Ga0068867_100001970 | |||
| 1038 | Ga0070706_100000883 | |||
| 1039 | Ga0070698_100193917 | |||
| 1040 | Ga0068853_100012984 | |||
| 1041 | Ga0068853_100056079 | |||
| 1042 | Ga0070672_100000608 | |||
| 1043 | Ga0070686_100006973 | |||
| 1044 | Ga0070665_100082825 | |||
| 1045 | Ga0070665_100113824 | |||
| 1046 | Ga0068855_100214467 | |||
| 1047 | Ga0070664_100000041 | |||
| 1048 | Ga0070664_100058732 | |||
| 1049 | Ga0070664_100066970 | |||
| 1050 | Ga0068857_100102702 | |||
| 1051 | Ga0068854_100000269 | |||
| 1052 | Ga0068854_100017329 | |||
| 1053 | Ga0068856_100000004 | |||
| 1054 | Ga0068856_100074398 | |||
| 1055 | Ga0068852_100002516 | |||
| 1056 | Ga0068852_100010490 | |||
| 1057 | Ga0068852_100092761 | |||
| 1058 | Ga0068852_100109475 | |||
| 1059 | Ga0068859_100028125 | |||
| 1060 | Ga0068864_100001546 | |||
| 1061 | Ga0068864_100011901 | |||
| 1062 | Ga0068864_100134455 | |||
| 1063 | Ga0068861_100006522 | |||
| 1064 | Ga0068861_100006534 | |||
| 1065 | Ga0068861_100152687 | |||
| 1066 | Ga0068851_10006026 | |||
| 1067 | Ga0068870_10004833 | |||
| 1068 | Ga0068860_100081289 | |||
| 1069 | Ga0068862_100014215 | |||
| 1070 | Ga0075365_10000480 | |||
| 1071 | Ga0075365_10004292 | |||
| 1072 | Ga0075365_10004816 | |||
| 1073 | Ga0075365_10007708 | |||
| 1074 | Ga0075363_100041976 | |||
| 1075 | Ga0075364_10009931 | |||
| 1076 | Ga0075362_10010286 | |||
| 1077 | Ga0075362_10022148 | |||
| 1078 | Ga0075367_10005227 | |||
| 1079 | Ga0075369_10007347 | |||
| 1080 | Ga0075366_10000542 | |||
| 1081 | Ga0075366_10008352 | |||
| 1082 | Ga0075366_10021377 | |||
| 1083 | Ga0075366_10043784 | |||
| 1084 | Ga0075370_10000416 | |||
| 1085 | Ga0075370_10001822 | |||
| 1086 | Ga0075370_10004927 | |||
| 1087 | Ga0075370_10010524 | |||
| 1088 | Ga0075370_10011785 | |||
| 1089 | Ga0075370_10024269 | |||
| 1090 | Ga0075370_10025838 | |||
| 1091 | Ga0075370_10027917 | |||
| 1092 | Ga0097620_100028125 | |||
| 1093 | Ga0079104_1000026 | |||
| 1094 | Ga0079104_1018388 | |||
| 1095 | Ga0099826_10017694 | |||
| 1096 | Ga0105251_10002012 | |||
| 1097 | Ga0105244_10004665 | |||
| 1098 | Ga0105244_10031538 | |||
| 1099 | Ga0105244_10033401 | |||
| 1100 | Ga0105250_10002478 | |||
| 1101 | Ga0105240_10033282 | |||
| 1102 | Ga0105243_10007028 | |||
| 1103 | Ga0105243_10016857 | |||
| 1104 | Ga0105243_10025505 | |||
| 1105 | Ga0105243_10031665 | |||
| 1106 | Ga0105242_10008883 | |||
| 1107 | Ga0105242_10009715 | |||
| 1108 | Ga0105239_10021943 | |||
| 1109 | Ga0157373_10101692 | |||
| 1110 | Ga0157371_10000028 | |||
| 1111 | Ga0157371_10092669 | |||
| 1112 | Ga0157370_10000002 | |||
| 1113 | Ga0157370_10003601 | |||
| 1114 | Ga0157369_10010892 | |||
| 1115 | Ga0157369_10024286 | |||
| 1116 | Ga0157374_10017910 | |||
| 1117 | Ga0163162_10114901 | |||
| 1118 | Ga0163162_10218742 | |||
| 1119 | Ga0157372_10000065 | |||
| 1120 | Ga0157372_10010625 | |||
| 1121 | Ga0157372_10013922 | |||
| 1122 | Ga0182008_10000858 | |||
| 1123 | Ga0182008_10002516 | |||
| 1124 | Ga0182008_10005059 | |||
| 1125 | Ga0182008_10007174 | |||
| 1126 | Ga0182008_10025714 | |||
| 1127 | Ga0157377_10000069 | |||
| 1128 | Ga0157379_10019666 | |||
| 1129 | Ga0182006_1000008 | |||
| 1130 | Ga0182006_1003884 | |||
| 1131 | Ga0182006_1006635 | |||
| 1132 | Ga0182006_1010451 | |||
| 1133 | Ga0182007_10000246 | |||
| 1134 | Ga0182007_10001069 | |||
| 1135 | Ga0182007_10002482 | |||
| 1136 | Ga0182005_1000022 | |||
| 1137 | Ga0183362_10002 | |||
| 1138 | Ga0163161_10000065 | |||
| 1139 | Ga0163161_10001642 | |||
| 1140 | Ga0209436_103337 | |||
| 1141 | Ga0209784_100024 | |||
| 1142 | Ga0209784_100504 | |||
| 1143 | Ga0209566_100018 | |||
| 1144 | Ga0209566_100392 | |||
| 1145 | Ga0209674_100046 | |||
| 1146 | Ga0209674_100166 | |||
| 1147 | Ga0209674_100227 | |||
| 1148 | Ga0209674_100781 | |||
| 1149 | Ga0209672_100138 | |||
| 1150 | Ga0209672_101682 | |||
| 1151 | Ga0209147_100008 | |||
| 1152 | Ga0209147_100419 | |||
| 1153 | Ga0209147_100865 | |||
| 1154 | Ga0209563_100007 | |||
| 1155 | Ga0209563_100039 | |||
| 1156 | Ga0209563_100090 | |||
| 1157 | Ga0207427_102687 | |||
| 1158 | Ga0209258_100013 | |||
| 1159 | Ga0209258_100176 | |||
| 1160 | Ga0209258_100199 | |||
| 1161 | Ga0207425_1001122 | |||
| 1162 | Ga0207425_1002323 | |||
| 1163 | Ga0209646_1000023 | |||
| 1164 | Ga0209646_1000063 | |||
| 1165 | Ga0209026_1001621 | |||
| 1166 | Ga0209677_100024 | |||
| 1167 | Ga0209677_103192 | |||
| 1168 | Ga0209677_106430 | |||
| 1169 | Ga0209148_1000019 | |||
| 1170 | Ga0209148_1000033 | |||
| 1171 | Ga0209148_1000179 | |||
| 1172 | Ga0209759_1000008 | |||
| 1173 | Ga0209759_1000252 | |||
| 1174 | Ga0209759_1001093 | |||
| 1175 | Ga0209129_1000071 | |||
| 1176 | Ga0209129_1003271 | |||
| 1177 | Ga0209129_1003785 | |||
| 1178 | Ga0209233_1000018 | |||
| 1179 | Ga0209565_1000025 | |||
| 1180 | Ga0209565_1000225 | |||
| 1181 | Ga0209565_1003810 | |||
| 1182 | Ga0209455_1000042 | |||
| 1183 | Ga0209673_1000149 | |||
| 1184 | Ga0209673_1000178 | |||
| 1185 | Ga0209673_1000209 | |||
| 1186 | Ga0209673_1000546 | |||
| 1187 | Ga0209673_1001087 | |||
| 1188 | Ga0209673_1008087 | |||
| 1189 | Ga0209130_1000335 | |||
| 1190 | Ga0209130_1000773 | |||
| 1191 | Ga0209130_1000889 | |||
| 1192 | Ga0209130_1001074 | |||
| 1193 | Ga0209675_1000017 | |||
| 1194 | Ga0209675_1000330 | |||
| 1195 | Ga0209675_1000726 | |||
| 1196 | Ga0209675_1004757 | |||
| 1197 | Ga0209675_1007352 | |||
| 1198 | Ga0209676_1000005 | |||
| 1199 | Ga0209676_1000048 | |||
| 1200 | Ga0209676_1000124 | |||
| 1201 | Ga0209676_1000618 | |||
| 1202 | Ga0209676_1005892 | |||
| 1203 | Ga0209025_1000217 | |||
| 1204 | Ga0209025_1001632 | |||
| 1205 | Ga0209025_1004121 | |||
| 1206 | Ga0209025_1008870 | |||
| 1207 | Ga0209564_1000011 | |||
| 1208 | Ga0209564_1000239 | |||
| 1209 | Ga0209564_1000423 | |||
| 1210 | Ga0209564_1004174 | |||
| 1211 | Ga0209758_1000027 | |||
| 1212 | Ga0209758_1000640 | |||
| 1213 | Ga0209758_1004374 | |||
| 1214 | Ga0209050_1000007 | |||
| 1215 | Ga0209050_1000012 | |||
| 1216 | Ga0209050_1001045 | |||
| 1217 | Ga0209050_1003991 | |||
| 1218 | Ga0209256_1000081 | |||
| 1219 | Ga0209256_1000095 | |||
| 1220 | Ga0209256_1004326 | |||
| 1221 | Ga0207426_1000027 | |||
| 1222 | Ga0207426_1000161 | |||
| 1223 | Ga0207426_1000176 | |||
| 1224 | Ga0209051_1000009 | |||
| 1225 | Ga0209051_1000019 | |||
| 1226 | Ga0209051_1000161 | |||
| 1227 | Ga0209051_1000207 | |||
| 1228 | Ga0209051_1000342 | |||
| 1229 | Ga0209051_1000553 | |||
| 1230 | Ga0209051_1031147 | |||
| 1231 | Ga0209257_1000011 | |||
| 1232 | Ga0209257_1000024 | |||
| 1233 | Ga0209257_1000258 | |||
| 1234 | Ga0209257_1000497 | |||
| 1235 | Ga0209257_1007259 | |||
| 1236 | Ga0207655_1001510 | |||
| 1237 | Ga0207713_1000216 | |||
| 1238 | Ga0207647_10017352 | |||
| 1239 | Ga0207645_10001088 | |||
| 1240 | Ga0207645_10014282 | |||
| 1241 | Ga0207645_10032664 | |||
| 1242 | Ga0207705_10001595 | |||
| 1243 | Ga0207705_10108311 | |||
| 1244 | Ga0207654_10025261 | |||
| 1245 | Ga0207695_10007973 | |||
| 1246 | Ga0207671_10012547 | |||
| 1247 | Ga0207657_10009403 | |||
| 1248 | Ga0207657_10029448 | |||
| 1249 | Ga0207657_10161522 | |||
| 1250 | Ga0207649_10000685 | |||
| 1251 | Ga0207681_10013913 | |||
| 1252 | Ga0207681_10013942 | |||
| 1253 | Ga0207694_10021430 | |||
| 1254 | Ga0207650_10013966 | |||
| 1255 | Ga0207650_10080685 | |||
| 1256 | Ga0207659_10006927 | |||
| 1257 | Ga0207687_10034857 | |||
| 1258 | Ga0207690_10002716 | |||
| 1259 | Ga0207690_10027381 | |||
| 1260 | Ga0207706_10005682 | |||
| 1261 | Ga0207706_10043763 | |||
| 1262 | Ga0207706_10045849 | |||
| 1263 | Ga0207706_10116928 | |||
| 1264 | Ga0207686_10003686 | |||
| 1265 | Ga0207686_10003820 | |||
| 1266 | Ga0207709_10000079 | |||
| 1267 | Ga0207709_10000669 | |||
| 1268 | Ga0207709_10001323 | |||
| 1269 | Ga0207670_10002264 | |||
| 1270 | Ga0207691_10000679 | |||
| 1271 | Ga0207711_10165856 | |||
| 1272 | Ga0207689_10000725 | |||
| 1273 | Ga0207689_10038223 | |||
| 1274 | Ga0207661_10080313 | |||
| 1275 | Ga0207679_10000004 | |||
| 1276 | Ga0207679_10076189 | |||
| 1277 | Ga0207667_10096796 | |||
| 1278 | Ga0207667_10113394 | |||
| 1279 | Ga0207667_10252888 | |||
| 1280 | Ga0207651_10058495 | |||
| 1281 | Ga0207640_10000211 | |||
| 1282 | Ga0207640_10012778 | |||
| 1283 | Ga0207640_10019077 | |||
| 1284 | Ga0207658_10014951 | |||
| 1285 | Ga0207677_10008506 | |||
| 1286 | Ga0207677_10019506 | |||
| 1287 | Ga0207703_10038291 | |||
| 1288 | Ga0207639_10009478 | |||
| 1289 | Ga0207678_10000180 | |||
| 1290 | Ga0207702_10000020 | |||
| 1291 | Ga0207702_10007986 | |||
| 1292 | Ga0207648_10004458 | |||
| 1293 | Ga0207648_10004554 | |||
| 1294 | Ga0207648_10071462 | |||
| 1295 | Ga0207648_10081018 | |||
| 1296 | Ga0207674_10010346 | |||
| 1297 | Ga0207674_10060157 | |||
| 1298 | Ga0207674_10076146 | |||
| 1299 | Ga0207674_10208606 | |||
| 1300 | Ga0207675_100000273 | |||
| 1301 | Ga0207675_100000765 | |||
| 1302 | Ga0207675_100021837 | |||
| 1303 | Ga0207683_10011057 | |||
| 1304 | Ga0207683_10100635 | |||
| 1305 | Ga0207698_10021438 | |||
| 1306 | Ga0207698_10023722 | |||
| 1307 | Ga0209281_1000067 | |||
| 1308 | Ga0209282_1001023 | |||
| 1309 | Ga0209974_10015044 | |||
| 1310 | Ga0207428_10013627 | |||
| 1311 | Ga0268264_10058582 | |||
| 1312 | Ga0307517_10003441 | |||
| 1313 | Ga0307515_10000040 | |||
| 1314 | Ga0307515_10000058 | |||
| 1315 | Ga0307515_10000183 | |||
| 1316 | Ga0307515_10001346 | |||
| 1317 | Ga0307515_10012069 | |||
| 1318 | Ga0307515_10025071 | |||
| 1319 | Ga0307515_10073933 | |||
| 1320 | Ga0307515_10104117 | |||
| 1321 | Ga0307515_10120319 | |||
| 1322 | Ga0307515_10121568 | |||
| 1323 | Ga0307512_10035162 | |||
| 1324 | Ga0307512_10040192 | |||
| 1325 | Ga0316177_1155812 | |||
| 1326 | Ga0316178_1067235 | |||
| 1327 | Ga0316182_1211861 | |||
| 1328 | Ga0265327_10000108 | |||
| 1329 | Ga0265327_10012096 | |||
| 1330 | Ga0307513_10001393 | |||
| 1331 | Ga0307513_10002544 | |||
| 1332 | Ga0307513_10029784 | |||
| 1333 | Ga0307513_10057706 | |||
| 1334 | Ga0307513_10118098 | |||
| 1335 | Ga0307513_10139518 | |||
| 1336 | Ga0307509_10006292 | |||
| 1337 | Ga0307509_10022418 | |||
| 1338 | Ga0307408_100000171 | |||
| 1339 | Ga0307408_100010201 | |||
| 1340 | Ga0307508_10002459 | |||
| 1341 | Ga0307508_10025856 | |||
| 1342 | Ga0307514_10009679 | |||
| 1343 | Ga0307514_10076807 | |||
| 1344 | Ga0265342_10003734 | |||
| 1345 | Ga0307516_10000394 | |||
| 1346 | Ga0307516_10000709 | |||
| 1347 | Ga0307516_10043849 | |||
| 1348 | Ga0307405_10058112 | |||
| 1349 | Ga0307405_10065404 | |||
| 1350 | Ga0316577_10003504 | |||
| 1351 | Ga0307413_10063938 | |||
| 1352 | Ga0307406_10009023 | |||
| 1353 | Ga0307406_10014914 | |||
| 1354 | Ga0307406_10055227 | |||
| 1355 | Ga0307412_10077345 | |||
| 1356 | Ga0307409_100001404 | |||
| 1357 | Ga0307416_100001711 | |||
| 1358 | Ga0307416_100018029 | |||
| 1359 | Ga0307414_10099665 | |||
| 1360 | Ga0307510_10000467 | |||
| 1361 | Ga0307510_10027809 | |||
| 1362 | Ga0373931_0008464 | |||
| 1363 | Ga0316582_0014944 | |||
| 1364 | Ga0395899_0001262 | |||
| 1365 | Ga0395899_0007932 | |||
| 1366 | Ga0395899_0009990 | |||
| 1367 | Ga0395900_0006722 | |||
| 1368 | Ga0395900_0007236 | |||
| 1369 | Ga0395900_0040318 | |||
| 1370 | Ga0395900_0096206 | |||
| 1371 | Ga0395898_0014953 | |||
| 1372 | Ga0395898_0019254 | |||
| 1373 | Ga0395898_0035857 | |||
| 1374 | Ga0395905_0001220 | |||
| 1375 | Ga0395905_0004024 | |||
| 1376 | Ga0395905_0005314 | |||
| 1377 | Ga0395905_0006792 | |||
| 1378 | Ga0395905_0010108 | |||
| 1379 | Ga0395905_0013012 | |||
| 1380 | Ga0395905_0044653 | |||
| 1381 | Ga0395901_0002505 | |||
| 1382 | Ga0395901_0011310 | |||
| 1383 | Ga0395901_0094682 | |||
| 1384 | Ga0395901_0121647 | |||
| 1385 | Ga0395901_0203504 | |||
| 1386 | Ga0400483_039388 | |||
| 1387 | Ga0400483_059443 | |||
| 1388 | Ga0400483_195602 | |||
| 1389 | Ga0439436_0000586 | |||
| 1390 | Ga0439436_0005259 | |||
| 1391 | Ga0439436_0014067 | |||
| 1392 | Ga0439439_0002574 | |||
| 1393 | Ga0439439_0004979 | |||
| 1394 | Ga0439447_013177 | |||
| 1395 | Ga0439466_0015170 | |||
| 1396 | Ga0439465_0000571 | |||
| 1397 | Ga0439465_0020677 | |||
| 1398 | Ga0439431_0000218 | |||
| 1399 | Ga0439433_0000683 | |||
| 1400 | Ga0439445_0000180 | |||
| 1401 | Ga0439432_000464 | |||
| 1402 | Ga0439432_010622 | |||
| 1403 | Ga0439432_021413 | |||
| 1404 | Ga0439449_0000184 | |||
| 1405 | Ga0439449_0001212 | |||
| 1406 | Ga0439449_0004083 | |||
| 1407 | Ga0439449_0006024 | |||
| 1408 | Ga0439452_002076 | |||
| 1409 | Ga0439452_003379 | |||
| 1410 | Ga0439452_011899 | |||
| 1411 | Ga0439455_0006751 | |||
| 1412 | Ga0439457_007377 | |||
| 1413 | Ga0439462_0000535 | |||
| 1414 | Ga0439462_0001407 | |||
| 1415 | Ga0450911_001243 | |||
| 1416 | Ga0450923_000177 | |||
| 1417 | Ga0450923_006162 | |||
| 1418 | Ga0450890_003471 | |||
| 1419 | Ga0450906_005273 | |||
| 1420 | Ga0450910_004095 | |||
| 1421 | Ga0439446_0000560 | |||
| 1422 | Ga0439446_0002189 | |||
| 1423 | Ga0439446_0013243 | |||
| 1424 | Ga0450908_006164 | |||
| 1425 | Ga0450909_000694 | |||
| 1426 | Ga0439434_0000517 | |||
| 1427 | Ga0439434_0002373 | |||
| 1428 | Ga0439464_0014316 | |||
| 1429 | Ga0450918_000031 | |||
| 1430 | Ga0450918_001470 | |||
| 1431 | Ga0451577_0003137 | |||
| 1432 | Ga0451577_0005516 | |||
| 1433 | Ga0466986_0085020 | |||
| 1434 | Ga0466969_0030672 | |||
| 1435 | Ga0453683_0019338 | |||
| 1436 | Ga0453683_0026131 | |||
| 1437 | Ga0466965_0051731 | |||
| 1438 | Ga0466961_0000282 | |||
| 1439 | Ga0466964_0028039 | |||
| 1440 | Ga0453684_0006348 | |||
| 1441 | Ga0453684_0083911 | |||
| 1442 | Ga0453684_0087245 | |||
| 1443 | Ga0453684_0202031 | |||
| 1444 | Ga0466971_0056311 | |||
| 1445 | Ga0466968_0036189 | |||
| 1446 | Ga0466970_0003436 | |||
| 1447 | Ga0466957_0025411 | |||
| 1448 | Ga0466960_0023805 | |||
| 1449 | Ga0466959_0000688 | |||
| 1450 | Ga0451576_0012565 | |||
| 1451 | Ga0466967_0043465 | |||
| 1452 | Ga0495627_000001 | |||
| 1453 | Ga0495592_0000522 | |||
| 1454 | Ga0495592_0005989 | |||
| 1455 | Ga0495603_0020046 | |||
| 1456 | Ga0495590_0000005 | |||
| 1457 | Ga0495590_0003118 | |||
| 1458 | Ga0495591_002109 | |||
| 1459 | Ga0495629_0000033 | |||
| 1460 | Ga0495629_0001604 | |||
| 1461 | Ga0495629_0006464 | |||
| 1462 | Ga0495638_0000027 | |||
| 1463 | Ga0495638_0007694 | |||
| 1464 | Ga0495638_0008411 | |||
| 1465 | Ga0495638_0019007 | |||
| 1466 | Ga0495641_0041619 | |||
| 1467 | Ga0495653_0000163 | |||
| 1468 | Ga0495653_0106316 | |||
| 1469 | Ga0495650_0000170 | |||
| 1470 | Ga0495650_0000213 | |||
| 1471 | Ga0495650_0000240 | |||
| 1472 | Ga0495650_0001256 | |||
| 1473 | Ga0495650_0002103 | |||
| 1474 | Ga0495650_0015376 | |||
| 1475 | Ga0495580_0002043 | |||
| 1476 | Ga0495580_0002298 | |||
| 1477 | Ga0495580_0028629 | |||
| 1478 | Ga0495582_0021694 | |||
| 1479 | Ga0495605_0000056 | |||
| 1480 | Ga0495605_0017680 | |||
| 1481 | Ga0495639_0002959 | |||
| 1482 | Ga0495664_0008185 | |||
| 1483 | Ga0495664_0063512 | |||
| 1484 | Ga0495585_0043088 | |||
| 1485 | Ga0495596_0000329 | |||
| 1486 | Ga0495596_0004008 | |||
| 1487 | Ga0495607_0000324 | |||
| 1488 | Ga0495607_0001029 | |||
| 1489 | Ga0495607_0001554 | |||
| 1490 | Ga0495607_0003470 | |||
| 1491 | Ga0495607_0004331 | |||
| 1492 | Ga0495607_0014753 | |||
| 1493 | Ga0495583_0000006 | |||
| 1494 | Ga0495583_0001372 | |||
| 1495 | Ga0495583_0002717 | |||
| 1496 | Ga0495583_0005135 | |||
| 1497 | Ga0495583_0007223 | |||
| 1498 | Ga0495606_0005944 | |||
| 1499 | Ga0495606_0006155 | |||
| 1500 | Ga0495606_0016499 | |||
| 1501 | Ga0495606_0020206 | |||
| 1502 | Ga0495608_0018452 | |||
| 1503 | Ga0495610_0000313 | |||
| 1504 | Ga0495610_0003626 | |||
| 1505 | Ga0495610_0006931 | |||
| 1506 | Ga0495610_0007978 | |||
| 1507 | Ga0495610_0023602 | |||
| 1508 | Ga0495616_0000020 | |||
| 1509 | Ga0495616_0000276 | |||
| 1510 | Ga0495616_0003088 | |||
| 1511 | Ga0495616_0003114 | |||
| 1512 | Ga0495616_0004322 | |||
| 1513 | Ga0495618_0002532 | |||
| 1514 | Ga0495620_0011565 | |||
| 1515 | Ga0495620_0026905 | |||
| 1516 | Ga0495628_0007214 | |||
| 1517 | Ga0495630_0002184 | |||
| 1518 | Ga0495630_0009783 | |||
| 1519 | Ga0495630_0110856 | |||
| 1520 | Ga0495631_0000537 | |||
| 1521 | Ga0495631_0001293 | |||
| 1522 | Ga0495631_0004854 | |||
| 1523 | Ga0495631_0022659 | |||
| 1524 | Ga0495632_0000176 | |||
| 1525 | Ga0495632_0001460 | |||
| 1526 | Ga0495632_0007706 | |||
| 1527 | Ga0495632_0008791 | |||
| 1528 | Ga0495632_0036658 | |||
| 1529 | Ga0495632_0074234 | |||
| 1530 | Ga0495637_0000008 | |||
| 1531 | Ga0495643_0000051 | |||
| 1532 | Ga0495643_0000141 | |||
| 1533 | Ga0495643_0000167 | |||
| 1534 | Ga0495643_0000180 | |||
| 1535 | Ga0495643_0000361 | |||
| 1536 | Ga0495643_0031175 | |||
| 1537 | Ga0495648_0000002 | |||
| 1538 | Ga0495648_0001678 | |||
| 1539 | Ga0495648_0023130 | |||
| 1540 | Ga0495666_0005457 | |||
| 1541 | Ga0495666_0008739 | |||
| 1542 | Ga0495666_0074895 | |||
| 1543 | Ga0495642_0000249 | |||
| 1544 | Ga0495642_0001355 | |||
| 1545 | Ga0495642_0026571 | |||
| 1546 | Ga0495654_0005620 | |||
| 1547 | Ga0495654_0006056 | |||
| 1548 | Ga0495665_0008977 | |||
| 1549 | Ga0495640_0016088 | |||
| 1550 | Ga0495640_0024491 | |||
| 1551 | Ga0495609_0000001 | |||
| 1552 | Ga0495609_0000954 | |||
| 1553 | Ga0495609_0004645 | |||
| 1554 | Ga0495609_0011657 | |||
| 1555 | Ga0495609_0013404 | |||
| 1556 | Ga0495621_0001726 | |||
| 1557 | Ga0495621_0011558 | |||
| 1558 | Ga0495621_0022221 | |||
| 1559 | Ga0495597_0000141 | |||
| 1560 | Ga0495597_0000855 | |||
| 1561 | Ga0495622_0000096 | |||
| 1562 | Ga0495622_0000137 | |||
| 1563 | Ga0495633_0000033 | |||
| 1564 | Ga0495633_0000198 | |||
| 1565 | Ga0495633_0002017 | |||
| 1566 | Ga0495633_0003648 | |||
| 1567 | Ga0495633_0006300 | |||
| 1568 | Ga0495633_0041262 | |||
| 1569 | Ga0495656_0009836 | |||
| 1570 | Ga0495656_0010304 | |||
| 1571 | Ga0495668_0000065 | |||
| 1572 | Ga0495668_0000091 | |||
| 1573 | Ga0495668_0002605 | |||
| 1574 | Ga0495668_0012823 | |||
| 1575 | Ga0495634_0035873 | |||
| 1576 | Ga0495634_0065588 | |||
| 1577 | Ga0495611_0000410 | |||
| 1578 | Ga0495611_0005200 | |||
| 1579 | Ga0495625_0000053 | |||
| 1580 | Ga0495625_0000056 | |||
| 1581 | Ga0495625_0000857 | |||
| 1582 | Ga0495625_0002889 | |||
| 1583 | Ga0495625_0007984 | |||
| 1584 | Ga0495625_0013541 | |||
| 1585 | Ga0495625_0076904 | |||
| 1586 | Ga0495661_0000049 | |||
| 1587 | Ga0495661_0000053 | |||
| 1588 | Ga0495661_0000591 | |||
| 1589 | Ga0495661_0000804 | |||
| 1590 | Ga0495661_0011693 | |||
| 1591 | Ga0495661_0016925 | |||
| 1592 | Ga0495661_0032503 | |||
| 1593 | Ga0495588_0000098 | |||
| 1594 | Ga0495588_0013009 | |||
| 1595 | Ga0495623_0000657 | |||
| 1596 | Ga0495623_0008179 | |||
| 1597 | Ga0495646_0006241 | |||
| 1598 | Ga0495646_0023557 | |||
| 1599 | Ga0495646_0025718 | |||
| 1600 | Ga0495669_0004853 | |||
| 1601 | Ga0495669_0012144 | |||
| 1602 | Ga0495624_0002901 | |||
| 1603 | Ga0495624_0003617 | |||
| 1604 | Ga0495624_0052448 | |||
| 1605 | Ga0495670_0032140 | |||
| 1606 | Ga0495649_0000071 | |||
| 1607 | Ga0495649_0000680 | |||
| 1608 | Ga0495649_0004997 | |||
| 1609 | Ga0495649_0006112 | |||
| 1610 | Ga0495649_0017453 | |||
| 1611 | Ga0495649_0070248 | |||
| 1612 | Ga0495589_0000103 | |||
| 1613 | Ga0495589_0000154 | |||
| 1614 | Ga0495589_0008374 | |||
| 1615 | Ga0495589_0017710 | |||
| 1616 | Ga0495589_0031766 | |||
| 1617 | Ga0495600_0006015 | |||
| 1618 | Ga0495600_0029124 | |||
| 1619 | Ga0495660_0000024 | |||
| 1620 | Ga0495660_0000055 | |||
| 1621 | Ga0495660_0000970 | |||
| 1622 | Ga0495660_0006403 | |||
| 1623 | Ga0495660_0009244 | |||
| 1624 | Ga0495604_0000727 | |||
| 1625 | Ga0495604_0003084 | |||
| 1626 | Ga0495604_0044820 | |||
| 1627 | Ga0495636_0002436 | |||
| 1628 | Ga0495674_0002774 | |||
| 1629 | Ga0495674_0072396 | |||
| 1630 | Ga0495672_0000030 | |||
| 1631 | Ga0495672_0000033 | |||
| 1632 | Ga0495672_0001752 | |||
| 1633 | Ga0495676_0044798 | |||
| 1634 | Ga0495676_0050818 | |||
| 1635 | Ga0495676_0113890 | |||
| 1636 | Ga0495680_0177728 | |||
| 1637 | Ga0495683_0000168 | |||
| 1638 | Ga0495683_0027991 | |||
| 1639 | Ga0495683_0038186 | |||
| 1640 | Ga0495687_000019 | |||
| 1641 | Ga0495687_000523 | |||
| 1642 | Ga0495687_000559 | |||
| 1643 | Ga0495687_001650 | |||
| 1644 | Ga0495687_003727 | |||
| 1645 | Ga0495687_006879 | |||
| 1646 | Ga0495687_021060 | |||
| 1647 | Ga0495675_0030826 | |||
| 1648 | Ga0495677_0000009 | |||
| 1649 | Ga0495677_0000270 | |||
| 1650 | Ga0495677_0003231 | |||
| 1651 | Ga0495677_0004867 | |||
| 1652 | Ga0495677_0005508 | |||
| 1653 | Ga0495677_0018762 | |||
| 1654 | Ga0495679_000030 | |||
| 1655 | Ga0495679_007259 | |||
| 1656 | Ga0495679_013850 | |||
| 1657 | Ga0495685_001244 | |||
| 1658 | Ga0495681_0012312 | |||
| 1659 | Ga0495681_0016928 | |||
| 1660 | Ga0495684_0016462 | |||
| 1661 | Ga0495686_0002774 | |||
| 1662 | Ga0495686_0007264 | |||
| 1663 | Ga0495593_0046251 | |||
| 1664 | Ga0495602_0012277 | |||
| 1665 | Ga0495602_0051653 | |||
| 1666 | Ga0495602_0119294 | |||
| 1667 | Ga0495614_0007400 | |||
| 1668 | Ga0495626_0000053 | |||
| 1669 | Ga0495626_0000358 | |||
| 1670 | Ga0495626_0005003 | |||
| 1671 | Ga0496100_0007181 | |||
| 1672 | Ga0496100_0015084 | |||
| 1673 | Ga0496101_0000463 | |||
| 1674 | Ga0496101_0007886 | |||
| 1675 | Ga0496102_0003468 | |||
| 1676 | Ga0496102_0007533 | |||
| 1677 | Ga0496103_0002435 | |||
| 1678 | Ga0496103_0016461 | |||
| 1679 | Ga0496104_0009026 | |||
| 1680 | Ga0496104_0009388 | |||
| 1681 | Ga0496105_0006985 | |||
| 1682 | Ga0496106_0024143 | |||
| 1683 | Ga0496106_0039035 | |||
| 1684 | Ga0496108_0025609 | |||
| 1685 | Ga0496108_0078614 | |||
| 1686 | Ga0496110_0038356 | |||
| 1687 | Ga0496111_0048070 | |||
| 1688 | Ga0496111_0073066 | |||
| 1689 | Ga0496113_0001291 | |||
| 1690 | Ga0496113_0009064 | |||
| 1691 | Ga0496114_0040701 | |||
| 1692 | Ga0496114_0119503 | |||
| 1693 | Ga0496114_0127129 | |||
| 1694 | Ga0496116_0009285 | |||
| 1695 | Ga0496117_0010218 | |||
| 1696 | Ga0496117_0066403 | |||
| 1697 | Ga0496118_0000294 | |||
| 1698 | Ga0496118_0002121 | |||
| 1699 | Ga0496118_0014728 | |||
| 1700 | Ga0496118_0038696 | |||
| 1701 | Ga0496118_0049722 | |||
| 1702 | Ga0496121_0012765 | |||
| 1703 | Ga0496121_0060732 | |||
| 1704 | Ga0496122_0000552 | |||
| 1705 | Ga0496122_0001600 | |||
| 1706 | Ga0496122_0007484 | |||
| 1707 | Ga0496122_0012381 | |||
| 1708 | Ga0496122_0042973 | |||
| 1709 | Ga0496123_0001311 | |||
| 1710 | Ga0496123_0001585 | |||
| 1711 | Ga0496123_0001667 | |||
| 1712 | Ga0496123_0019147 | |||
| 1713 | Ga0496123_0032778 | |||
| 1714 | Ga0496124_0003655 | |||
| 1715 | Ga0496124_0004257 | |||
| 1716 | Ga0496124_0010001 | |||
| 1717 | Ga0496124_0041462 | |||
| 1718 | Ga0496124_0046482 | |||
| 1719 | Ga0496125_0001368 | |||
| 1720 | Ga0496125_0009516 | |||
| 1721 | Ga0496125_0026230 | |||
| 1722 | Ga0496125_0053345 | |||
| 1723 | Ga0496125_0107161 | |||
| 1724 | Ga0496125_0116807 | |||
| 1725 | Ga0495678_000002 | |||
| 1726 | Ga0495678_000024 | |||
| 1727 | Ga0495678_000040 | |||
| 1728 | Ga0495678_000061 | |||
| 1729 | Ga0495678_001554 | |||
| 1730 | Ga0495678_003955 | |||
| 1731 | Ga0495682_0000244 | |||
| 1732 | Ga0501036_0051935 | |||
| 1733 | Ga0501039_0021608 | |||
| 1734 | Ga0501040_0056061 | |||
| 1735 | Ga0501041_0073192 | |||
| 1736 | Ga0501042_0030684 | |||
| 1737 | Ga0501046_0000126 | |||
| 1738 | Ga0501047_0000160 | |||
| 1739 | Ga0501048_0000040 | |||
| 1740 | Ga0501067_0022633 | |||
| 1741 | Ga0501068_0009596 | |||
| 1742 | Ga0501071_0080840 | |||
| 1743 | Ga0501072_0040099 | |||
| 1744 | Ga0501073_0000076 | |||
| 1745 | Ga0501079_0000507 | |||
| 1746 | Ga0501079_0120997 | |||
| 1747 | Ga0501080_0000180 | |||
| 1748 | Ga0501080_0156063 | |||
| 1749 | Ga0501269_001273 | |||
| 1750 | Ga0501035_0066607 | |||
| 1751 | nmdc:mga03683_1072_c1 | |||
| 1752 | nmdc:mga03683_33430_c1 | |||
| 1753 | nmdc:mga03683_3616_c1 | |||
| 1754 | nmdc:mga03683_3846_c1 | |||
| 1755 | nmdc:mga03n38_117_c1 | |||
| 1756 | nmdc:mga03n38_33023_c1 | |||
| 1757 | nmdc:mga00v17_195_c1 | |||
| 1758 | nmdc:mga0yw44_29339_c1 | |||
| 1759 | nmdc:mga0yw44_38063_c1 | |||
| 1760 | nmdc:mga0yw44_52028_c1 | |||
| 1761 | nmdc:mga0k408_20161_c1 | |||
| 1762 | nmdc:mga0k408_23570_c1 | |||
| 1763 | nmdc:mga0k408_37461_c1 | |||
| 1764 | nmdc:mga0k408_535_c1 | |||
| 1765 | nmdc:mga0k408_58279_c1 | |||
| 1766 | nmdc:mga07m45_13297_c1 | |||
| 1767 | nmdc:mga07m45_1483_c1 | |||
| 1768 | nmdc:mga07m45_218_c2 | |||
| 1769 | nmdc:mga07m45_22053_c1 | |||
| 1770 | nmdc:mga07m45_2951_c1 | |||
| 1771 | nmdc:mga07m45_3087_c1 | |||
| 1772 | nmdc:mga07m45_36120_c1 | |||
| 1773 | nmdc:mga07m45_4694_c2 | |||
| 1774 | nmdc:mga07m45_49934_c1 | |||
| 1775 | nmdc:mga07m45_5845_c1 | |||
| 1776 | Ga0500610_0000409 | |||
| 1777 | Ga0500578_0061468 | |||
| 1778 | Ga0500644_0006310 | |||
| 1779 | Ga0500651_0014862 | |||
| 1780 | Ga0500562_004965 | |||
| 1781 | Ga0500571_000166 | |||
| 1782 | Ga0500593_000327 | |||
| 1783 | Ga0500594_0003936 | |||
| 1784 | Ga0500607_053898 | |||
| 1785 | Ga0500608_001339 | |||
| 1786 | Ga0500655_000714 | |||
| 1787 | Ga0500658_0000117 | |||
| 1788 | Ga0500658_0000243 | |||
| 1789 | Ga0500658_0000393 | |||
| 1790 | Ga0500658_0022042 | |||
| 1791 | Ga0500559_0000116 | |||
| 1792 | Ga0500564_009198 | |||
| 1793 | Ga0500568_0003268 | |||
| 1794 | Ga0500568_0004444 | |||
| 1795 | Ga0500586_002038 | |||
| 1796 | Ga0500616_0000016 | |||
| 1797 | Ga0500616_0028808 | |||
| 1798 | Ga0500627_0000151 | |||
| 1799 | Ga0500638_006320 | |||
| 1800 | Ga0501084_0004502 | |||
| 1801 | Ga0501082_0033843 | |||
| 1802 | Ga0466962_0023298 | |||
| 1803 | 2510247946 | |||
| 1804 | 2513229117 | |||
| 1805 | 2514049639 | |||
| 1806 | 2515685684 | |||
| 1807 | 2527075965 | |||
| 1808 | 2548501745 | |||
| 1809 | 2587756986 | |||
| 1810 | 2597028083 | |||
| 1811 | 2599444772 | |||
| 1812 | 2643864132 | |||
| 1813 | 2643992432 | |||
| 1814 | 2644159235 | |||
| 1815 | 2644248109 | |||
| 1816 | 2644252711 | |||
| 1817 | 2644292165 | |||
| 1818 | 2644303568 | |||
| 1819 | 2644328524 | |||
| 1820 | 2644355223 | |||
| 1821 | 2644399761 | |||
| 1822 | 2644646528 | |||
| 1823 | 2719643622 | |||
| 1824 | 2722883001 | |||
| 1825 | 2738721322 | |||
| 1826 | 2738880665 | |||
| 1827 | 2739280991 | |||
| 1828 | 2746090533 | |||
| 1829 | 2746098710 | |||
| 1830 | 2819601629 | |||
| 1831 | 2819619543 | |||
| 1832 | 2831269240 | |||
| 1833 | 2831270225 | |||
| 1834 | 2838059217 | |||
| 1835 | 2838059969 | |||
| 1836 | 2842681107 | |||
| 1837 | 2842712448 | |||
| 1838 | 2857555321 | |||
| 1839 | 2885193111 | |||
| 1840 | 2899930692 | |||
| 1841 | 2900582551 | |||
| 1842 | 2900638869 | |||
| 1843 | 2902688174 | |||
| 1844 | 2904425033 | |||
| 1845 | 2904436274 | |||
| 1846 | 2904453206 | |||
| 1847 | 2904459185 | |||
| 1848 | 2906802388 | |||
| 1849 | 2919466845 | |||
| 1850 | 2919477682 | |||
| 1851 | 2921648285 | |||
| 1852 | 2928040986 | |||
| 1853 | 2928047828 | |||
| 1854 | 2928054017 | |||
| 1855 | 2928055720 | |||
| 1856 | 2928059903 | |||
| 1857 | 2928065770 | |||
| 1858 | 2928069819 | |||
| 1859 | 2928088523 | |||
| 1860 | 2928088689 | |||
| 1861 | 2928111430 | |||
| 1862 | 2928119345 | |||
| 1863 | 2928138232 | |||
| 1864 | 2928504960 | |||
| 1865 | 2929523946 | |||
| 1866 | 2945912709 | |||
| 1867 | 2945948377 | |||
| 1868 | 2945972775 | |||
| 1869 | 2990714745 | |||
| 1870 | 642615121 | |||
| 1871 | 8021626165 | |||
| 1872 | 8021627220 | |||
| 1873 | 8021651154 | |||
| 1874 | 8045831330 | |||
| 1875 | 8047677419 | |||
| 1876 | 8055270490 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qga-assembly5.cif.gz_E | crystal structure of ideonella sakaiensis mhetase bound to the non-hydrolyzable ligand mheta | 0.9247 | 48 | 576 |
| 6qg9-assembly5.cif.gz_E | crystal structure of ideonella sakaiensis mhetase | 0.9239 | 48 | 576 |
| 8ekg-assembly6.cif.gz_F | mhetase variant thr159val, met192tyr, tyr252phe, tyr503trp | 0.9215 | 48 | 576 |
| 6qz2-assembly4.cif.gz_D | structure of mhetase from ideonella sakaiensis | 0.919 | 58 | 576 |
| 6jtt-assembly1.cif.gz_A | mhetase in complex with bhet | 0.9155 | 48 | 576 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IBH1_58_270_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8518 | 445 | 492 | 3.40.50.1820 |
| af_Q0DRS5_1_166_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7989 | 205 | 249 | 3.40.50.1820 |
| af_A4I2F6_184_375_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7779 | 180 | 233 | 3.40.50.1820 |
| af_P76561_1_206_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7743 | 445 | 492 | 3.40.50.1820 |
| af_I1JYD1_9_266_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7483 | 203 | 235 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4WNV1-F1-model_v4 | Carboxylic ester hydrolase (EC 3.1.1.-) | 0.9908 | 280 | 576 |
GO:0030600
GO:0045493 GO:0046872 |
| AF-A0A1H6P4D6-F1-model_v4 | deleted | 0.9865 | 217 | 432 |
|
| AF-A0A4Q3PHY6-F1-model_v4 | deleted | 0.9845 | 130 | 515 |
|
| AF-A0A4Q4WNV1-F1-model_v4 | Carboxylic ester hydrolase (EC 3.1.1.-) | 0.9842 | 280 | 576 |
GO:0030600
GO:0045493 GO:0046872 |
| AF-A0A7U5AJR8-F1-model_v4 | deleted | 0.983 | 429 | 576 |
|