F486246

General Info

Members Datasets Scaffolds Average Seq Length
938 466 1876 559

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10031465|Ga0105237_100314653
Length 622
Sequence MGEAASITTLRALSGLGKVARRFSFFVIRFNYMVRTSPTIQGAGTAPPGLTTGDKMVIRKNSCLAALAAIALFQVTACGGSDDDATLPQLPAATGATLTSCTDLVTRLSFPNTSIASSATVAAGTLTVAGTPIAAHCLVKGSMYSRVSTVDGNSYAIGFEMRLPNTWNGRFFYQANGGIDGSVATATGAVNGGPGLTNALNMGFAVLSSDAGHAGSLGPFFGIDPQARLDYGYQAVGKLTPMAKAAIQTAYGKGPDRSYIGGCSNGGRHTMVAAARYADQYDGFLVGNPGFRLPLAAIANIAAFQGYNTVASTPGDPSTGFTAAERTLVSNAVLAKCDALDGSADGLVQDTGACQAAFNLDRDVPTCSGARDGTCLSAAQKTVIGKRFAGVTTGSGTKIYSSWPFDAGIGGGNTAFWNFTAPPVLDSGAVGVIWQVPPENPATFNGPTFALTGDLDSMLAKVQATNATYTESALSFMTPPNPSSLGTLKNRGAKVMVYHGTSDPIFSSDDTTAWYESLRGANGGDASNFARFFRVPGMTHCAAGPSTDQFDMLTPLVAWVEQGQAPASVTASARGTGNAAGVNADVPASWSATRTRPLCPYPQVARYKGTGSVDSADSFSCQ

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
187 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
213 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
214 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
215 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
222 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
223 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
229 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
364 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
365 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
377 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
378 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
381 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
382 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
398 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
399 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
400 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
401 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
402 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
403 2547132374 Acidovorax radicis N35 Isolate Unclassified
404 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
405 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
406 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
407 2643221570 Acidovorax sp. Root568 Isolate Unclassified
408 2643221596 Acidovorax sp. Root70 Isolate Unclassified
409 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
410 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
411 2643221645 Massilia sp. Root351 Isolate Unclassified
412 2643221652 Acidovorax sp. Root402 Isolate Unclassified
413 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
414 2643221658 Variovorax sp. Root411 Isolate Unclassified
415 2643221664 Massilia sp. Root418 Isolate Unclassified
416 2643221672 Variovorax sp. Root434 Isolate Unclassified
417 2643221717 Acidovorax sp. Root267 Isolate Unclassified
418 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
419 2721755523 Delftia sp. HK171 Isolate Unclassified
420 2738541277 Variovorax sp. GV051 Isolate Unclassified
421 2738541307 Variovorax sp. GV008 Isolate Unclassified
422 2738543019 Variovorax sp. GV040 Isolate Unclassified
423 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
424 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
425 2818991446 Variovorax sp. 1180 Isolate Unclassified
426 2818991450 Burkholderia sp. 604 Isolate Unclassified
427 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
428 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
429 2842677519 Variovorax sp. R-72495 Isolate Unclassified
430 2842711865 Duganella sp. R-73148 Isolate Unclassified
431 2857553236 Duganella sp. R-74557 Isolate Unclassified
432 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
433 2899924645 Variovorax sp. 369 Isolate Unclassified
434 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
435 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
436 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
437 2904424332 Duganella sp. 1411 Isolate Rhizosphere
438 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
439 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
440 2904456579 Variovorax sp. 2002 Isolate Unclassified
441 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
442 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
443 2919476304 Duganella sp. 3397 Isolate Unclassified
444 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
445 2928037797 Variovorax sp. 1126 Isolate Unclassified
446 2928044640 Variovorax sp. 1128 Isolate Unclassified
447 2928051484 Variovorax sp. 1133 Isolate Unclassified
448 2928058823 Ralstonia sp. 1138 Isolate Unclassified
449 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
450 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
451 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
452 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
453 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
454 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
455 2929520902 Variovorax beijingensis 502 Isolate Unclassified
456 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
457 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
458 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
459 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
460 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
461 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
462 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
463 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
464 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
465 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
466 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92
Metatranscriptomes 0.11
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.45
Nodule 1.49
Rhizoplane 2.56
Rhizosphere 59.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10031465 3300009545 Bacteria 5380
2 JGI24741J21665_1000483 3300001915 Bacteria 12193
3 JGI24740J21852_10000011 3300001979 Bacteria 68823
4 JGI24740J21852_10000057 3300001979 Bacteria 35487
5 JGI25156J39149_1000766 3300002705 Bacteria 16671
6 JGI25156J39149_1001052 3300002705 Bacteria 12760
7 JGI25154J39366_1001383 3300002738 Bacteria 8786
8 JGI25150J39212_1001922 3300002774 Bacteria 5457
9 JGI25159J45721_1002978 3300002987 Bacteria 6157
10 JGI25151J46595_10000539 3300003187 Bacteria 35055
11 JGI25151J46595_10009324 3300003187 Bacteria 4654
12 JGI25165J46597_1002776 3300003214 Bacteria 5089
13 JGI25153J46596_10005865 3300003215 Bacteria 6359
14 rootL2_10017019 3300003322 Bacteria 2341
15 rootL2_10056402 3300003322 Bacteria 8479
16 rootH1_10060501 3300003323 Bacteria 3352
17 JGI25160J50197_1003596 3300003354 Bacteria 6881
18 JGI25160J50197_1003664 3300003354 Bacteria 6806
19 JGI25161J50226_1001263 3300003374 Bacteria 8121
20 JGI25161J50226_1001680 3300003374 Bacteria 6347
21 Ga0006562J51391_1103569 3300003578 Bacteria 2600
22 Ga0055539_1000168 3300003752 Bacteria 58108
23 Ga0055533_1000914 3300003756 Bacteria 8840
24 Ga0055533_1001105 3300003756 Bacteria 7721
25 Ga0055533_1003457 3300003756 Bacteria 3167
26 Ga0055532_1000033 3300003758 Bacteria 214652
27 Ga0055525_1000069 3300003759 Bacteria 186286
28 Ga0055525_1000438 3300003759 Bacteria 24329
29 Ga0055527_1002323 3300003760 Bacteria 3281
30 Ga0055535_1000024 3300003761 Bacteria 214652
31 Ga0055535_1000422 3300003761 Bacteria 39771
32 Ga0055535_1000625 3300003761 Bacteria 28582
33 Ga0055542_1000074 3300003762 Bacteria 141185
34 Ga0055542_1000087 3300003762 Bacteria 123666
35 Ga0055542_1000945 3300003762 Bacteria 19117
36 Ga0055529_1000044 3300003763 Bacteria 214652
37 Ga0055526_1000028 3300003771 Bacteria 150301
38 Ga0055526_1003120 3300003771 Bacteria 10739
39 Ga0055526_1006453 3300003771 Bacteria 6359
40 Ga0055526_1006607 3300003771 Bacteria 6244
41 Ga0055537_1000064 3300003773 Bacteria 77134
42 Ga0055537_1002664 3300003773 Bacteria 5831
43 Ga0055524_1002010 3300003775 Bacteria 10862
44 Ga0055524_1007424 3300003775 Bacteria 4654
45 Ga0055536_1002562 3300003781 Bacteria 10140
46 Ga0055536_1002590 3300003781 Bacteria 10076
47 Ga0055536_1005253 3300003781 Bacteria 6383
48 Ga0055534_1000094 3300003784 Bacteria 70029
49 Ga0055534_1002480 3300003784 Bacteria 6359
50 Ga0055528_1000142 3300003790 Bacteria 58220
51 Ga0055528_1000250 3300003790 Bacteria 45479
52 Ga0055528_1005571 3300003790 Bacteria 5831
53 Ga0055530_10000492 3300003791 Bacteria 34175
54 Ga0055530_10004165 3300003791 Bacteria 7639
55 Ga0055540_1001880 3300003792 Bacteria 11783
56 Ga0055540_1002209 3300003792 Bacteria 10565
57 Ga0055540_1002683 3300003792 Bacteria 9173
58 Ga0055540_1004595 3300003792 Bacteria 6135
59 Ga0055540_1004949 3300003792 Bacteria 5804
60 Ga0055540_1018559 3300003792 Bacteria 1903
61 Ga0055531_10000738 3300003794 Bacteria 27594
62 Ga0055531_10003879 3300003794 Bacteria 9360
63 Ga0055531_10003975 3300003794 Bacteria 9173
64 Ga0055531_10007175 3300003794 Bacteria 6135
65 Ga0055531_10016465 3300003794 Bacteria 3187
66 Ga0055541_1000910 3300003841 Bacteria 7060
67 Ga0055541_1006948 3300003841 Bacteria 1890
68 Ga0055543_1001897 3300004625 Bacteria 7554
69 Ga0055543_1003550 3300004625 Bacteria 4529
70 Ga0065165_1004159 3300005262 Bacteria 9265
71 Ga0070658_10004140 3300005327 Bacteria 11878
72 Ga0070658_10045957 3300005327 Bacteria 3533
73 Ga0070676_10000646 3300005328 Bacteria 16965
74 Ga0070676_10031428 3300005328 Bacteria 3033
75 Ga0070683_100048160 3300005329 Bacteria 3940
76 Ga0070670_100005736 3300005331 Bacteria 10485
77 Ga0070670_100055022 3300005331 Bacteria 3416
78 Ga0070670_100096969 3300005331 Bacteria 2536
79 Ga0068869_100000695 3300005334 Bacteria 19035
80 Ga0070682_100001807 3300005337 Bacteria 11949
81 Ga0068868_100021364 3300005338 Bacteria 4874
82 Ga0068868_100046105 3300005338 Bacteria 3412
83 Ga0070689_100003286 3300005340 Bacteria 10736
84 Ga0070661_100000027 3300005344 Bacteria 117972
85 Ga0070661_100037837 3300005344 Bacteria 3510
86 Ga0070661_100040997 3300005344 Bacteria 3378
87 Ga0070669_100015690 3300005353 Bacteria 5403
88 Ga0070675_100107152 3300005354 Bacteria 2360
89 Ga0070671_100150864 3300005355 Bacteria 1962
90 Ga0070673_100019369 3300005364 Bacteria 4884
91 Ga0070659_100001366 3300005366 Bacteria 17550
92 Ga0070659_100023144 3300005366 Bacteria 4750
93 Ga0070667_100012849 3300005367 Bacteria 6919
94 Ga0070667_100028651 3300005367 Bacteria 4638
95 Ga0070663_100000004 3300005455 Bacteria 254839
96 Ga0070678_100027281 3300005456 Bacteria 3877
97 Ga0070662_100007206 3300005457 Bacteria 7203
98 Ga0070662_100078902 3300005457 Bacteria 2447
99 Ga0068867_100001970 3300005459 Bacteria 14319
100 Ga0070706_100000883 3300005467 Bacteria 32838
101 Ga0070698_100193917 3300005471 Bacteria 1969
102 Ga0068853_100012984 3300005539 Bacteria 6790
103 Ga0068853_100056079 3300005539 Bacteria 3397
104 Ga0070672_100000608 3300005543 Bacteria 21058
105 Ga0070686_100006973 3300005544 Bacteria 6296
106 Ga0070665_100082825 3300005548 Bacteria 3213
107 Ga0070665_100113824 3300005548 Bacteria 2708
108 Ga0068855_100214467 3300005563 Bacteria 2162
109 Ga0070664_100000041 3300005564 Bacteria 78215
110 Ga0070664_100058732 3300005564 Bacteria 3272
111 Ga0070664_100066970 3300005564 Bacteria 3068
112 Ga0068857_100102702 3300005577 Bacteria 2566
113 Ga0068854_100000269 3300005578 Bacteria 35431
114 Ga0068854_100017329 3300005578 Bacteria 4819
115 Ga0068856_100000004 3300005614 Bacteria 233761
116 Ga0068856_100074398 3300005614 Bacteria 3363
117 Ga0068852_100002516 3300005616 Bacteria 12622
118 Ga0068852_100010490 3300005616 Bacteria 6927
119 Ga0068852_100092761 3300005616 Bacteria 2705
120 Ga0068852_100109475 3300005616 Bacteria 2509
121 Ga0068859_100028125 3300005617 Bacteria 5636
122 Ga0068864_100001546 3300005618 Bacteria 18969
123 Ga0068864_100011901 3300005618 Bacteria 7184
124 Ga0068864_100134455 3300005618 Bacteria 2225
125 Ga0068861_100006522 3300005719 Bacteria 7959
126 Ga0068861_100006534 3300005719 Bacteria 7954
127 Ga0068861_100152687 3300005719 Bacteria 1896
128 Ga0068851_10006026 3300005834 Bacteria 5525
129 Ga0068870_10004833 3300005840 Bacteria 5827
130 Ga0068860_100081289 3300005843 Bacteria 3081
131 Ga0068862_100014215 3300005844 Bacteria 6602
132 Ga0075365_10000480 3300006038 Bacteria 15124
133 Ga0075365_10004292 3300006038 Bacteria 7522
134 Ga0075365_10004816 3300006038 Bacteria 7200
135 Ga0075365_10007708 3300006038 Bacteria 6057
136 Ga0075363_100041976 3300006048 Bacteria 2415
137 Ga0075364_10009931 3300006051 Bacteria 5725
138 Ga0075362_10010286 3300006177 Bacteria 3648
139 Ga0075362_10022148 3300006177 Bacteria 2674
140 Ga0075367_10005227 3300006178 Bacteria 6416
141 Ga0075369_10007347 3300006186 Bacteria 4192
142 Ga0075366_10000542 3300006195 Bacteria 17576
143 Ga0075366_10008352 3300006195 Bacteria 5752
144 Ga0075366_10021377 3300006195 Bacteria 3761
145 Ga0075366_10043784 3300006195 Bacteria 2652
146 Ga0075370_10000416 3300006353 Bacteria 15732
147 Ga0075370_10001822 3300006353 Bacteria 9530
148 Ga0075370_10004927 3300006353 Bacteria 6559
149 Ga0075370_10010524 3300006353 Bacteria 4839
150 Ga0075370_10011785 3300006353 Bacteria 4602
151 Ga0075370_10024269 3300006353 Bacteria 3348
152 Ga0075370_10025838 3300006353 Bacteria 3249
153 Ga0075370_10027917 3300006353 Bacteria 3134
154 Ga0097620_100028125 3300006931 Bacteria 5636
155 Ga0079104_1000026 3300006946 Bacteria 216566
156 Ga0079104_1018388 3300006946 Bacteria 1979
157 Ga0099826_10017694 3300006948 Bacteria 5384
158 Ga0105251_10002012 3300009011 Bacteria 16509
159 Ga0105244_10004665 3300009036 Bacteria 9346
160 Ga0105244_10031538 3300009036 Bacteria 2812
161 Ga0105244_10033401 3300009036 Bacteria 2712
162 Ga0105250_10002478 3300009092 Bacteria 9258
163 Ga0105240_10033282 3300009093 Bacteria 6662
164 Ga0105243_10007028 3300009148 Bacteria 8661
165 Ga0105243_10016857 3300009148 Bacteria 5523
166 Ga0105243_10025505 3300009148 Bacteria 4518
167 Ga0105243_10031665 3300009148 Bacteria 4078
168 Ga0105242_10008883 3300009176 Bacteria 7711
169 Ga0105242_10009715 3300009176 Bacteria 7372
170 Ga0105239_10021943 3300010375 Bacteria 7038
171 Ga0157373_10101692 3300013100 Bacteria 2022
172 Ga0157371_10000028 3300013102 Bacteria 254964
173 Ga0157371_10092669 3300013102 Bacteria 2140
174 Ga0157370_10000002 3300013104 Bacteria 431400
175 Ga0157370_10003601 3300013104 Bacteria 18122
176 Ga0157369_10010892 3300013105 Bacteria 10357
177 Ga0157369_10024286 3300013105 Bacteria 6745
178 Ga0157374_10017910 3300013296 Bacteria 6243
179 Ga0163162_10114901 3300013306 Bacteria 2791
180 Ga0163162_10218742 3300013306 Bacteria 2035
181 Ga0157372_10000065 3300013307 Bacteria 114576
182 Ga0157372_10010625 3300013307 Bacteria 9795
183 Ga0157372_10013922 3300013307 Bacteria 8595
184 Ga0182008_10000858 3300014497 Bacteria 21100
185 Ga0182008_10002516 3300014497 Bacteria 11432
186 Ga0182008_10005059 3300014497 Bacteria 7577
187 Ga0182008_10007174 3300014497 Bacteria 6167
188 Ga0182008_10025714 3300014497 Bacteria 2990
189 Ga0157377_10000069 3300014745 Bacteria 80723
190 Ga0157379_10019666 3300014968 Bacteria 5965
191 Ga0182006_1000008 3300015261 Bacteria 449652
192 Ga0182006_1003884 3300015261 Bacteria 7489
193 Ga0182006_1006635 3300015261 Bacteria 5361
194 Ga0182006_1010451 3300015261 Bacteria 4128
195 Ga0182007_10000246 3300015262 Bacteria 36410
196 Ga0182007_10001069 3300015262 Bacteria 14939
197 Ga0182007_10002482 3300015262 Bacteria 9144
198 Ga0182005_1000022 3300015265 Bacteria 266181
199 Ga0183362_10002 3300015683 Bacteria 1432711
200 Ga0163161_10000065 3300017792 Bacteria 108321
201 Ga0163161_10001642 3300017792 Bacteria 16447
202 Ga0209436_103337 3300025208 Bacteria 4318
203 Ga0209784_100024 3300025224 Bacteria 394613
204 Ga0209784_100504 3300025224 Bacteria 15386
205 Ga0209566_100018 3300025225 Bacteria 448638
206 Ga0209566_100392 3300025225 Bacteria 35300
207 Ga0209674_100046 3300025226 Bacteria 357920
208 Ga0209674_100166 3300025226 Bacteria 85496
209 Ga0209674_100227 3300025226 Bacteria 50941
210 Ga0209674_100781 3300025226 Bacteria 10759
211 Ga0209672_100138 3300025228 Bacteria 70350
212 Ga0209672_101682 3300025228 Bacteria 7154
213 Ga0209147_100008 3300025229 Bacteria 777096
214 Ga0209147_100419 3300025229 Bacteria 27989
215 Ga0209147_100865 3300025229 Bacteria 14094
216 Ga0209563_100007 3300025230 Bacteria 1579402
217 Ga0209563_100039 3300025230 Bacteria 409717
218 Ga0209563_100090 3300025230 Bacteria 169322
219 Ga0207427_102687 3300025231 Bacteria 4480
220 Ga0209258_100013 3300025242 Bacteria 777096
221 Ga0209258_100176 3300025242 Bacteria 141261
222 Ga0209258_100199 3300025242 Bacteria 123718
223 Ga0207425_1001122 3300025245 Bacteria 12071
224 Ga0207425_1002323 3300025245 Bacteria 6806
225 Ga0209646_1000023 3300025246 Bacteria 441100
226 Ga0209646_1000063 3300025246 Bacteria 248065
227 Ga0209026_1001621 3300025250 Bacteria 9580
228 Ga0209677_100024 3300025253 Bacteria 406035
229 Ga0209677_103192 3300025253 Bacteria 5499
230 Ga0209677_106430 3300025253 Bacteria 2780
231 Ga0209148_1000019 3300025254 Bacteria 748518
232 Ga0209148_1000033 3300025254 Bacteria 555508
233 Ga0209148_1000179 3300025254 Bacteria 126083
234 Ga0209759_1000008 3300025256 Bacteria 461395
235 Ga0209759_1000252 3300025256 Bacteria 79418
236 Ga0209759_1001093 3300025256 Bacteria 17598
237 Ga0209129_1000071 3300025258 Bacteria 210729
238 Ga0209129_1003271 3300025258 Bacteria 7178
239 Ga0209129_1003785 3300025258 Bacteria 6354
240 Ga0209233_1000018 3300025261 Bacteria 886857
241 Ga0209565_1000025 3300025263 Bacteria 377969
242 Ga0209565_1000225 3300025263 Bacteria 63291
243 Ga0209565_1003810 3300025263 Bacteria 4759
244 Ga0209455_1000042 3300025272 Bacteria 419638
245 Ga0209673_1000149 3300025273 Bacteria 148659
246 Ga0209673_1000178 3300025273 Bacteria 128628
247 Ga0209673_1000209 3300025273 Bacteria 117670
248 Ga0209673_1000546 3300025273 Bacteria 61140
249 Ga0209673_1001087 3300025273 Bacteria 30591
250 Ga0209673_1008087 3300025273 Bacteria 4729
251 Ga0209130_1000335 3300025284 Bacteria 53993
252 Ga0209130_1000773 3300025284 Bacteria 27625
253 Ga0209130_1000889 3300025284 Bacteria 24355
254 Ga0209130_1001074 3300025284 Bacteria 20497
255 Ga0209675_1000017 3300025291 Bacteria 378002
256 Ga0209675_1000330 3300025291 Bacteria 41678
257 Ga0209675_1000726 3300025291 Bacteria 22391
258 Ga0209675_1004757 3300025291 Bacteria 5912
259 Ga0209675_1007352 3300025291 Bacteria 4236
260 Ga0209676_1000005 3300025292 Bacteria 1076001
261 Ga0209676_1000048 3300025292 Bacteria 403716
262 Ga0209676_1000124 3300025292 Bacteria 194206
263 Ga0209676_1000618 3300025292 Bacteria 51827
264 Ga0209676_1005892 3300025292 Bacteria 6228
265 Ga0209025_1000217 3300025294 Bacteria 137909
266 Ga0209025_1001632 3300025294 Bacteria 27895
267 Ga0209025_1004121 3300025294 Bacteria 12918
268 Ga0209025_1008870 3300025294 Bacteria 7123
269 Ga0209564_1000011 3300025295 Bacteria 822327
270 Ga0209564_1000239 3300025295 Bacteria 119761
271 Ga0209564_1000423 3300025295 Bacteria 74528
272 Ga0209564_1004174 3300025295 Bacteria 9027
273 Ga0209758_1000027 3300025297 Bacteria 549650
274 Ga0209758_1000640 3300025297 Bacteria 53312
275 Ga0209758_1004374 3300025297 Bacteria 11812
276 Ga0209050_1000007 3300025298 Bacteria 1187891
277 Ga0209050_1000012 3300025298 Bacteria 813717
278 Ga0209050_1001045 3300025298 Bacteria 34179
279 Ga0209050_1003991 3300025298 Bacteria 10406
280 Ga0209256_1000081 3300025299 Bacteria 222908
281 Ga0209256_1000095 3300025299 Bacteria 206120
282 Ga0209256_1004326 3300025299 Bacteria 9027
283 Ga0207426_1000027 3300025302 Bacteria 513176
284 Ga0207426_1000161 3300025302 Bacteria 172765
285 Ga0207426_1000176 3300025302 Bacteria 159819
286 Ga0209051_1000009 3300025303 Bacteria 706778
287 Ga0209051_1000019 3300025303 Bacteria 511268
288 Ga0209051_1000161 3300025303 Bacteria 125704
289 Ga0209051_1000207 3300025303 Bacteria 103683
290 Ga0209051_1000342 3300025303 Bacteria 70022
291 Ga0209051_1000553 3300025303 Bacteria 45537
292 Ga0209051_1031147 3300025303 Bacteria 2057
293 Ga0209257_1000011 3300025304 Bacteria 1112630
294 Ga0209257_1000024 3300025304 Bacteria 726068
295 Ga0209257_1000258 3300025304 Bacteria 122220
296 Ga0209257_1000497 3300025304 Bacteria 70185
297 Ga0209257_1007259 3300025304 Bacteria 6770
298 Ga0207655_1001510 3300025728 Bacteria 21219
299 Ga0207713_1000216 3300025735 Bacteria 77877
300 Ga0207647_10017352 3300025904 Bacteria 4893
301 Ga0207645_10001088 3300025907 Bacteria 22402
302 Ga0207645_10014282 3300025907 Bacteria 5319
303 Ga0207645_10032664 3300025907 Bacteria 3346
304 Ga0207705_10001595 3300025909 Bacteria 18008
305 Ga0207705_10108311 3300025909 Bacteria 2050
306 Ga0207654_10025261 3300025911 Bacteria 3202
307 Ga0207695_10007973 3300025913 Bacteria 13358
308 Ga0207671_10012547 3300025914 Bacteria 6805
309 Ga0207657_10009403 3300025919 Bacteria 9827
310 Ga0207657_10029448 3300025919 Bacteria 4998
311 Ga0207657_10161522 3300025919 Bacteria 1819
312 Ga0207649_10000685 3300025920 Bacteria 22462
313 Ga0207681_10013913 3300025923 Bacteria 4985
314 Ga0207681_10013942 3300025923 Bacteria 4981
315 Ga0207694_10021430 3300025924 Bacteria 4897
316 Ga0207650_10013966 3300025925 Bacteria 5574
317 Ga0207650_10080685 3300025925 Bacteria 2467
318 Ga0207659_10006927 3300025926 Bacteria 6966
319 Ga0207687_10034857 3300025927 Bacteria 3421
320 Ga0207690_10002716 3300025932 Bacteria 10679
321 Ga0207690_10027381 3300025932 Bacteria 3602
322 Ga0207706_10005682 3300025933 Bacteria 11617
323 Ga0207706_10043763 3300025933 Bacteria 3967
324 Ga0207706_10045849 3300025933 Bacteria 3872
325 Ga0207706_10116928 3300025933 Bacteria 2345
326 Ga0207686_10003686 3300025934 Bacteria 8210
327 Ga0207686_10003820 3300025934 Bacteria 8079
328 Ga0207709_10000079 3300025935 Bacteria 166220
329 Ga0207709_10000669 3300025935 Bacteria 27749
330 Ga0207709_10001323 3300025935 Bacteria 17535
331 Ga0207670_10002264 3300025936 Bacteria 10075
332 Ga0207691_10000679 3300025940 Bacteria 33608
333 Ga0207711_10165856 3300025941 Bacteria 2002
334 Ga0207689_10000725 3300025942 Bacteria 31641
335 Ga0207689_10038223 3300025942 Bacteria 3977
336 Ga0207661_10080313 3300025944 Bacteria 2691
337 Ga0207679_10000004 3300025945 Bacteria 589021
338 Ga0207679_10076189 3300025945 Bacteria 2548
339 Ga0207667_10096796 3300025949 Bacteria 3046
340 Ga0207667_10113394 3300025949 Bacteria 2795
341 Ga0207667_10252888 3300025949 Bacteria 1803
342 Ga0207651_10058495 3300025960 Bacteria 2664
343 Ga0207640_10000211 3300025981 Bacteria 40994
344 Ga0207640_10012778 3300025981 Bacteria 4794
345 Ga0207640_10019077 3300025981 Bacteria 4044
346 Ga0207658_10014951 3300025986 Bacteria 5320
347 Ga0207677_10008506 3300026023 Bacteria 5738
348 Ga0207677_10019506 3300026023 Bacteria 4096
349 Ga0207703_10038291 3300026035 Bacteria 3826
350 Ga0207639_10009478 3300026041 Bacteria 6720
351 Ga0207678_10000180 3300026067 Bacteria 54051
352 Ga0207702_10000020 3300026078 Bacteria 203299
353 Ga0207702_10007986 3300026078 Bacteria 8967
354 Ga0207648_10004458 3300026089 Bacteria 14366
355 Ga0207648_10004554 3300026089 Bacteria 14218
356 Ga0207648_10071462 3300026089 Bacteria 3024
357 Ga0207648_10081018 3300026089 Bacteria 2832
358 Ga0207674_10010346 3300026116 Bacteria 10576
359 Ga0207674_10060157 3300026116 Bacteria 3842
360 Ga0207674_10076146 3300026116 Bacteria 3364
361 Ga0207674_10208606 3300026116 Bacteria 1903
362 Ga0207675_100000273 3300026118 Bacteria 49026
363 Ga0207675_100000765 3300026118 Bacteria 32007
364 Ga0207675_100021837 3300026118 Bacteria 5960
365 Ga0207683_10011057 3300026121 Bacteria 7690
366 Ga0207683_10100635 3300026121 Bacteria 2580
367 Ga0207698_10021438 3300026142 Bacteria 4468
368 Ga0207698_10023722 3300026142 Bacteria 4291
369 Ga0209281_1000067 3300027111 Bacteria 284517
370 Ga0209282_1001023 3300027666 Bacteria 14708
371 Ga0209974_10015044 3300027876 Bacteria 2570
372 Ga0207428_10013627 3300027907 Bacteria 7092
373 Ga0268264_10058582 3300028381 Bacteria 3226
374 Ga0307517_10003441 3300028786 Bacteria 24604
375 Ga0307515_10000040 3300028794 Bacteria 322704
376 Ga0307515_10000058 3300028794 Bacteria 259680
377 Ga0307515_10000183 3300028794 Bacteria 154076
378 Ga0307515_10001346 3300028794 Bacteria 55608
379 Ga0307515_10012069 3300028794 Bacteria 16303
380 Ga0307515_10025071 3300028794 Bacteria 10342
381 Ga0307515_10073933 3300028794 Bacteria 4569
382 Ga0307515_10104117 3300028794 Bacteria 3395
383 Ga0307515_10120319 3300028794 Bacteria 2980
384 Ga0307515_10121568 3300028794 Bacteria 2953
385 Ga0307512_10035162 3300030522 Bacteria 4275
386 Ga0307512_10040192 3300030522 Bacteria 3908
387 Ga0316177_1155812 3300030731 Bacteria 2745
388 Ga0316178_1067235 3300030735 Bacteria 3028
389 Ga0316182_1211861 3300030745 Bacteria 5796
390 Ga0265327_10000108 3300031251 Bacteria 183209
391 Ga0265327_10012096 3300031251 Bacteria 5857
392 Ga0307513_10001393 3300031456 Bacteria 34808
393 Ga0307513_10002544 3300031456 Bacteria 25207
394 Ga0307513_10029784 3300031456 Bacteria 6213
395 Ga0307513_10057706 3300031456 Bacteria 4133
396 Ga0307513_10118098 3300031456 Bacteria 2627
397 Ga0307513_10139518 3300031456 Bacteria 2353
398 Ga0307509_10006292 3300031507 Bacteria 16042
399 Ga0307509_10022418 3300031507 Bacteria 7118
400 Ga0307408_100000171 3300031548 Bacteria 73180
401 Ga0307408_100010201 3300031548 Bacteria 6198
402 Ga0307508_10002459 3300031616 Bacteria 19534
403 Ga0307508_10025856 3300031616 Bacteria 5322
404 Ga0307514_10009679 3300031649 Bacteria 8084
405 Ga0307514_10076807 3300031649 Bacteria 2487
406 Ga0265342_10003734 3300031712 Bacteria 12316
407 Ga0307516_10000394 3300031730 Bacteria 57048
408 Ga0307516_10000709 3300031730 Bacteria 45280
409 Ga0307516_10043849 3300031730 Bacteria 4430
410 Ga0307405_10058112 3300031731 Bacteria 2432
411 Ga0307405_10065404 3300031731 Bacteria 2314
412 Ga0316577_10003504 3300031733 Bacteria 7938
413 Ga0307413_10063938 3300031824 Bacteria 2284
414 Ga0307406_10009023 3300031901 Bacteria 5575
415 Ga0307406_10014914 3300031901 Bacteria 4481
416 Ga0307406_10055227 3300031901 Bacteria 2538
417 Ga0307412_10077345 3300031911 Bacteria 2288
418 Ga0307409_100001404 3300031995 Bacteria 11782
419 Ga0307416_100001711 3300032002 Bacteria 12144
420 Ga0307416_100018029 3300032002 Bacteria 4960
421 Ga0307414_10099665 3300032004 Bacteria 2183
422 Ga0307510_10000467 3300033180 Bacteria 39376
423 Ga0307510_10027809 3300033180 Bacteria 6469
424 Ga0373931_0008464 3300035691 Bacteria 4881
425 Ga0316582_0014944 3300036647 Bacteria 4422
426 Ga0395899_0001262 3300037312 Bacteria 22015
427 Ga0395899_0007932 3300037312 Bacteria 8177
428 Ga0395899_0009990 3300037312 Bacteria 7279
429 Ga0395900_0006722 3300037418 Bacteria 11937
430 Ga0395900_0007236 3300037418 Bacteria 11494
431 Ga0395900_0040318 3300037418 Bacteria 4812
432 Ga0395900_0096206 3300037418 Bacteria 3042
433 Ga0395898_0014953 3300037466 Bacteria 7969
434 Ga0395898_0019254 3300037466 Bacteria 6949
435 Ga0395898_0035857 3300037466 Bacteria 4929
436 Ga0395905_0001220 3300037471 Bacteria 32038
437 Ga0395905_0004024 3300037471 Bacteria 15424
438 Ga0395905_0005314 3300037471 Bacteria 13162
439 Ga0395905_0006792 3300037471 Bacteria 11467
440 Ga0395905_0010108 3300037471 Bacteria 9198
441 Ga0395905_0013012 3300037471 Bacteria 7995
442 Ga0395905_0044653 3300037471 Bacteria 4158
443 Ga0395901_0002505 3300038443 Bacteria 18588
444 Ga0395901_0011310 3300038443 Bacteria 9042
445 Ga0395901_0094682 3300038443 Bacteria 3129
446 Ga0395901_0121647 3300038443 Bacteria 2743
447 Ga0395901_0203504 3300038443 Bacteria 2075
448 Ga0400483_039388 3300039062 Bacteria 10971
449 Ga0400483_059443 3300039062 Bacteria 2302
450 Ga0400483_195602 3300039062 Bacteria 8670
451 Ga0439436_0000586 3300041404 Bacteria 9641
452 Ga0439436_0005259 3300041404 Bacteria 3963
453 Ga0439436_0014067 3300041404 Bacteria 2418
454 Ga0439439_0002574 3300041406 Bacteria 3874
455 Ga0439439_0004979 3300041406 Bacteria 3014
456 Ga0439447_013177 3300041407 Bacteria 2352
457 Ga0439466_0015170 3300041411 Bacteria 2800
458 Ga0439465_0000571 3300041413 Bacteria 11082
459 Ga0439465_0020677 3300041413 Bacteria 2062
460 Ga0439431_0000218 3300041997 Bacteria 11553
461 Ga0439433_0000683 3300041999 Bacteria 6556
462 Ga0439445_0000180 3300042004 Bacteria 11305
463 Ga0439432_000464 3300042006 Bacteria 15181
464 Ga0439432_010622 3300042006 Bacteria 3184
465 Ga0439432_021413 3300042006 Bacteria 2143
466 Ga0439449_0000184 3300042007 Bacteria 21742
467 Ga0439449_0001212 3300042007 Bacteria 10127
468 Ga0439449_0004083 3300042007 Bacteria 5651
469 Ga0439449_0006024 3300042007 Bacteria 4631
470 Ga0439452_002076 3300042010 Bacteria 7603
471 Ga0439452_003379 3300042010 Bacteria 5604
472 Ga0439452_011899 3300042010 Bacteria 2490
473 Ga0439455_0006751 3300042012 Bacteria 2398
474 Ga0439457_007377 3300042014 Bacteria 2642
475 Ga0439462_0000535 3300042015 Bacteria 7527
476 Ga0439462_0001407 3300042015 Bacteria 5336
477 Ga0450911_001243 3300042115 Bacteria 6136
478 Ga0450923_000177 3300042125 Bacteria 5979
479 Ga0450923_006162 3300042125 Bacteria 1974
480 Ga0450890_003471 3300042127 Bacteria 2093
481 Ga0450906_005273 3300042145 Bacteria 2669
482 Ga0450910_004095 3300042147 Bacteria 1962
483 Ga0439446_0000560 3300042156 Bacteria 7536
484 Ga0439446_0002189 3300042156 Bacteria 4655
485 Ga0439446_0013243 3300042156 Bacteria 2262
486 Ga0450908_006164 3300042184 Bacteria 2284
487 Ga0450909_000694 3300042185 Bacteria 4509
488 Ga0439434_0000517 3300042435 Bacteria 10981
489 Ga0439434_0002373 3300042435 Bacteria 5468
490 Ga0439464_0014316 3300042439 Bacteria 2131
491 Ga0450918_000031 3300042531 Bacteria 28580
492 Ga0450918_001470 3300042531 Bacteria 4669
493 Ga0451577_0003137 3300042876 Bacteria 18623
494 Ga0451577_0005516 3300042876 Bacteria 12930
495 Ga0466986_0085020 3300044650 Bacteria 2188
496 Ga0466969_0030672 3300044656 Bacteria 2739
497 Ga0453683_0019338 3300044673 Bacteria 4364
498 Ga0453683_0026131 3300044673 Bacteria 3708
499 Ga0466965_0051731 3300044683 Bacteria 2038
500 Ga0466961_0000282 3300044693 Bacteria 33721
501 Ga0466964_0028039 3300044706 Bacteria 2215
502 Ga0453684_0006348 3300044712 Bacteria 22539
503 Ga0453684_0083911 3300044712 Bacteria 3964
504 Ga0453684_0087245 3300044712 Bacteria 3868
505 Ga0453684_0202031 3300044712 Bacteria 2316
506 Ga0466971_0056311 3300044719 Bacteria 1773
507 Ga0466968_0036189 3300044735 Bacteria 2068
508 Ga0466970_0003436 3300044765 Bacteria 7710
509 Ga0466957_0025411 3300044842 Bacteria 3510
510 Ga0466960_0023805 3300044901 Bacteria 2754
511 Ga0466959_0000688 3300045049 Bacteria 19769
512 Ga0451576_0012565 3300045051 Bacteria 9505
513 Ga0466967_0043465 3300045976 Bacteria 3890
514 Ga0495627_000001 3300046453 Bacteria 1104709
515 Ga0495592_0000522 3300046454 Bacteria 27736
516 Ga0495592_0005989 3300046454 Bacteria 9041
517 Ga0495603_0020046 3300046455 Bacteria 4052
518 Ga0495590_0000005 3300046457 Bacteria 384276
519 Ga0495590_0003118 3300046457 Bacteria 6778
520 Ga0495591_002109 3300046458 Bacteria 11445
521 Ga0495629_0000033 3300046459 Bacteria 120105
522 Ga0495629_0001604 3300046459 Bacteria 17768
523 Ga0495629_0006464 3300046459 Bacteria 8680
524 Ga0495638_0000027 3300046460 Bacteria 337569
525 Ga0495638_0007694 3300046460 Bacteria 7700
526 Ga0495638_0008411 3300046460 Bacteria 7319
527 Ga0495638_0019007 3300046460 Bacteria 4551
528 Ga0495641_0041619 3300046461 Bacteria 2134
529 Ga0495653_0000163 3300046463 Bacteria 54806
530 Ga0495653_0106316 3300046463 Bacteria 2024
531 Ga0495650_0000170 3300046471 Bacteria 143177
532 Ga0495650_0000213 3300046471 Bacteria 123910
533 Ga0495650_0000240 3300046471 Bacteria 109029
534 Ga0495650_0001256 3300046471 Bacteria 26185
535 Ga0495650_0002103 3300046471 Bacteria 17084
536 Ga0495650_0015376 3300046471 Bacteria 3926
537 Ga0495580_0002043 3300046472 Bacteria 17732
538 Ga0495580_0002298 3300046472 Bacteria 16682
539 Ga0495580_0028629 3300046472 Bacteria 4049
540 Ga0495582_0021694 3300046473 Bacteria 3514
541 Ga0495605_0000056 3300046474 Bacteria 155610
542 Ga0495605_0017680 3300046474 Bacteria 3835
543 Ga0495639_0002959 3300046475 Bacteria 7391
544 Ga0495664_0008185 3300046477 Bacteria 5824
545 Ga0495664_0063512 3300046477 Bacteria 2201
546 Ga0495585_0043088 3300046492 Bacteria 2525
547 Ga0495596_0000329 3300046500 Bacteria 30887
548 Ga0495596_0004008 3300046500 Bacteria 7267
549 Ga0495607_0000324 3300046501 Bacteria 49450
550 Ga0495607_0001029 3300046501 Bacteria 25590
551 Ga0495607_0001554 3300046501 Bacteria 20106
552 Ga0495607_0003470 3300046501 Bacteria 12074
553 Ga0495607_0004331 3300046501 Bacteria 10467
554 Ga0495607_0014753 3300046501 Bacteria 5079
555 Ga0495583_0000006 3300046506 Bacteria 436893
556 Ga0495583_0001372 3300046506 Bacteria 25059
557 Ga0495583_0002717 3300046506 Bacteria 14655
558 Ga0495583_0005135 3300046506 Bacteria 9018
559 Ga0495583_0007223 3300046506 Bacteria 7038
560 Ga0495606_0005944 3300046507 Bacteria 11455
561 Ga0495606_0006155 3300046507 Bacteria 11175
562 Ga0495606_0016499 3300046507 Bacteria 5627
563 Ga0495606_0020206 3300046507 Bacteria 4921
564 Ga0495608_0018452 3300046511 Bacteria 4811
565 Ga0495610_0000313 3300046512 Bacteria 51404
566 Ga0495610_0003626 3300046512 Bacteria 11892
567 Ga0495610_0006931 3300046512 Bacteria 7673
568 Ga0495610_0007978 3300046512 Bacteria 6943
569 Ga0495610_0023602 3300046512 Bacteria 3338
570 Ga0495616_0000020 3300046513 Bacteria 162840
571 Ga0495616_0000276 3300046513 Bacteria 41682
572 Ga0495616_0003088 3300046513 Bacteria 10788
573 Ga0495616_0003114 3300046513 Bacteria 10727
574 Ga0495616_0004322 3300046513 Bacteria 8971
575 Ga0495618_0002532 3300046514 Bacteria 11708
576 Ga0495620_0011565 3300046515 Bacteria 4599
577 Ga0495620_0026905 3300046515 Bacteria 2699
578 Ga0495628_0007214 3300046516 Bacteria 9622
579 Ga0495630_0002184 3300046517 Bacteria 13629
580 Ga0495630_0009783 3300046517 Bacteria 6901
581 Ga0495630_0110856 3300046517 Bacteria 2078
582 Ga0495631_0000537 3300046518 Bacteria 25460
583 Ga0495631_0001293 3300046518 Bacteria 15373
584 Ga0495631_0004854 3300046518 Bacteria 7086
585 Ga0495631_0022659 3300046518 Bacteria 2919
586 Ga0495632_0000176 3300046519 Bacteria 65711
587 Ga0495632_0001460 3300046519 Bacteria 19642
588 Ga0495632_0007706 3300046519 Bacteria 6724
589 Ga0495632_0008791 3300046519 Bacteria 6154
590 Ga0495632_0036658 3300046519 Bacteria 2493
591 Ga0495632_0074234 3300046519 Bacteria 1629
592 Ga0495637_0000008 3300046520 Bacteria 404658
593 Ga0495643_0000051 3300046522 Bacteria 207804
594 Ga0495643_0000141 3300046522 Bacteria 115660
595 Ga0495643_0000167 3300046522 Bacteria 104447
596 Ga0495643_0000180 3300046522 Bacteria 100398
597 Ga0495643_0000361 3300046522 Bacteria 61853
598 Ga0495643_0031175 3300046522 Bacteria 2969
599 Ga0495648_0000002 3300046524 Bacteria 593972
600 Ga0495648_0001678 3300046524 Bacteria 21418
601 Ga0495648_0023130 3300046524 Bacteria 4263
602 Ga0495666_0005457 3300046526 Bacteria 6404
603 Ga0495666_0008739 3300046526 Bacteria 5074
604 Ga0495666_0074895 3300046526 Bacteria 1605
605 Ga0495642_0000249 3300046528 Bacteria 30244
606 Ga0495642_0001355 3300046528 Bacteria 10948
607 Ga0495642_0026571 3300046528 Bacteria 2300
608 Ga0495654_0005620 3300046530 Bacteria 7256
609 Ga0495654_0006056 3300046530 Bacteria 6938
610 Ga0495665_0008977 3300046531 Bacteria 5424
611 Ga0495640_0016088 3300046533 Bacteria 5604
612 Ga0495640_0024491 3300046533 Bacteria 4389
613 Ga0495609_0000001 3300046538 Bacteria 1060094
614 Ga0495609_0000954 3300046538 Bacteria 20899
615 Ga0495609_0004645 3300046538 Bacteria 7453
616 Ga0495609_0011657 3300046538 Bacteria 4183
617 Ga0495609_0013404 3300046538 Bacteria 3872
618 Ga0495621_0001726 3300046539 Bacteria 5725
619 Ga0495621_0011558 3300046539 Bacteria 2736
620 Ga0495621_0022221 3300046539 Bacteria 2101
621 Ga0495597_0000141 3300046542 Bacteria 64457
622 Ga0495597_0000855 3300046542 Bacteria 23940
623 Ga0495622_0000096 3300046557 Bacteria 77784
624 Ga0495622_0000137 3300046557 Bacteria 62774
625 Ga0495633_0000033 3300046558 Bacteria 186714
626 Ga0495633_0000198 3300046558 Bacteria 76860
627 Ga0495633_0002017 3300046558 Bacteria 14675
628 Ga0495633_0003648 3300046558 Bacteria 10172
629 Ga0495633_0006300 3300046558 Bacteria 7067
630 Ga0495633_0041262 3300046558 Bacteria 2195
631 Ga0495656_0009836 3300046615 Bacteria 3453
632 Ga0495656_0010304 3300046615 Bacteria 3393
633 Ga0495668_0000065 3300046616 Bacteria 178985
634 Ga0495668_0000091 3300046616 Bacteria 144428
635 Ga0495668_0002605 3300046616 Bacteria 14593
636 Ga0495668_0012823 3300046616 Bacteria 4964
637 Ga0495634_0035873 3300046642 Bacteria 3393
638 Ga0495634_0065588 3300046642 Bacteria 2406
639 Ga0495611_0000410 3300046648 Bacteria 26643
640 Ga0495611_0005200 3300046648 Bacteria 5576
641 Ga0495625_0000053 3300046660 Bacteria 190575
642 Ga0495625_0000056 3300046660 Bacteria 186024
643 Ga0495625_0000857 3300046660 Bacteria 41346
644 Ga0495625_0002889 3300046660 Bacteria 17959
645 Ga0495625_0007984 3300046660 Bacteria 9094
646 Ga0495625_0013541 3300046660 Bacteria 6544
647 Ga0495625_0076904 3300046660 Bacteria 2333
648 Ga0495661_0000049 3300046665 Bacteria 144060
649 Ga0495661_0000053 3300046665 Bacteria 140234
650 Ga0495661_0000591 3300046665 Bacteria 37505
651 Ga0495661_0000804 3300046665 Bacteria 29643
652 Ga0495661_0011693 3300046665 Bacteria 5946
653 Ga0495661_0016925 3300046665 Bacteria 4818
654 Ga0495661_0032503 3300046665 Bacteria 3297
655 Ga0495588_0000098 3300046674 Bacteria 166999
656 Ga0495588_0013009 3300046674 Bacteria 3953
657 Ga0495623_0000657 3300046679 Bacteria 22944
658 Ga0495623_0008179 3300046679 Bacteria 6801
659 Ga0495646_0006241 3300046680 Bacteria 7558
660 Ga0495646_0023557 3300046680 Bacteria 3875
661 Ga0495646_0025718 3300046680 Bacteria 3701
662 Ga0495669_0004853 3300046684 Bacteria 5581
663 Ga0495669_0012144 3300046684 Bacteria 3662
664 Ga0495624_0002901 3300046690 Bacteria 12820
665 Ga0495624_0003617 3300046690 Bacteria 11443
666 Ga0495624_0052448 3300046690 Bacteria 2577
667 Ga0495670_0032140 3300046691 Bacteria 2609
668 Ga0495649_0000071 3300046694 Bacteria 89386
669 Ga0495649_0000680 3300046694 Bacteria 27698
670 Ga0495649_0004997 3300046694 Bacteria 8528
671 Ga0495649_0006112 3300046694 Bacteria 7526
672 Ga0495649_0017453 3300046694 Bacteria 4048
673 Ga0495649_0070248 3300046694 Bacteria 1878
674 Ga0495589_0000103 3300046794 Bacteria 81696
675 Ga0495589_0000154 3300046794 Bacteria 63333
676 Ga0495589_0008374 3300046794 Bacteria 5404
677 Ga0495589_0017710 3300046794 Bacteria 3655
678 Ga0495589_0031766 3300046794 Bacteria 2657
679 Ga0495600_0006015 3300046809 Bacteria 7343
680 Ga0495600_0029124 3300046809 Bacteria 3574
681 Ga0495660_0000024 3300046810 Bacteria 268209
682 Ga0495660_0000055 3300046810 Bacteria 134615
683 Ga0495660_0000970 3300046810 Bacteria 20959
684 Ga0495660_0006403 3300046810 Bacteria 6966
685 Ga0495660_0009244 3300046810 Bacteria 5760
686 Ga0495604_0000727 3300047317 Bacteria 27719
687 Ga0495604_0003084 3300047317 Bacteria 13328
688 Ga0495604_0044820 3300047317 Bacteria 3453
689 Ga0495636_0002436 3300047318 Bacteria 7132
690 Ga0495674_0002774 3300047319 Bacteria 16996
691 Ga0495674_0072396 3300047319 Bacteria 2972
692 Ga0495672_0000030 3300047320 Bacteria 305021
693 Ga0495672_0000033 3300047320 Bacteria 291992
694 Ga0495672_0001752 3300047320 Bacteria 20938
695 Ga0495676_0044798 3300047321 Bacteria 3607
696 Ga0495676_0050818 3300047321 Bacteria 3322
697 Ga0495676_0113890 3300047321 Bacteria 1979
698 Ga0495680_0177728 3300047322 Bacteria 1538
699 Ga0495683_0000168 3300047323 Bacteria 63828
700 Ga0495683_0027991 3300047323 Bacteria 2881
701 Ga0495683_0038186 3300047323 Bacteria 2432
702 Ga0495687_000019 3300047443 Bacteria 341756
703 Ga0495687_000523 3300047443 Bacteria 46029
704 Ga0495687_000559 3300047443 Bacteria 43900
705 Ga0495687_001650 3300047443 Bacteria 20063
706 Ga0495687_003727 3300047443 Bacteria 10810
707 Ga0495687_006879 3300047443 Bacteria 6851
708 Ga0495687_021060 3300047443 Bacteria 3165
709 Ga0495675_0030826 3300047444 Bacteria 3421
710 Ga0495677_0000009 3300047445 Bacteria 170927
711 Ga0495677_0000270 3300047445 Bacteria 22801
712 Ga0495677_0003231 3300047445 Bacteria 6357
713 Ga0495677_0004867 3300047445 Bacteria 5122
714 Ga0495677_0005508 3300047445 Bacteria 4800
715 Ga0495677_0018762 3300047445 Bacteria 2507
716 Ga0495679_000030 3300047446 Bacteria 180083
717 Ga0495679_007259 3300047446 Bacteria 4644
718 Ga0495679_013850 3300047446 Bacteria 3009
719 Ga0495685_001244 3300047447 Bacteria 7790
720 Ga0495681_0012312 3300047470 Bacteria 5035
721 Ga0495681_0016928 3300047470 Bacteria 4065
722 Ga0495684_0016462 3300047471 Bacteria 5694
723 Ga0495686_0002774 3300047472 Bacteria 15986
724 Ga0495686_0007264 3300047472 Bacteria 8331
725 Ga0495593_0046251 3300047673 Bacteria 2319
726 Ga0495602_0012277 3300048088 Bacteria 8815
727 Ga0495602_0051653 3300048088 Bacteria 3659
728 Ga0495602_0119294 3300048088 Bacteria 2125
729 Ga0495614_0007400 3300048089 Bacteria 4888
730 Ga0495626_0000053 3300048091 Bacteria 155543
731 Ga0495626_0000358 3300048091 Bacteria 47755
732 Ga0495626_0005003 3300048091 Bacteria 7920
733 Ga0496100_0007181 3300048903 Bacteria 6121
734 Ga0496100_0015084 3300048903 Bacteria 4506
735 Ga0496101_0000463 3300048904 Bacteria 25752
736 Ga0496101_0007886 3300048904 Bacteria 6931
737 Ga0496102_0003468 3300048905 Bacteria 13374
738 Ga0496102_0007533 3300048905 Bacteria 9305
739 Ga0496103_0002435 3300048906 Bacteria 11711
740 Ga0496103_0016461 3300048906 Bacteria 4413
741 Ga0496104_0009026 3300048907 Bacteria 8865
742 Ga0496104_0009388 3300048907 Bacteria 8700
743 Ga0496105_0006985 3300048908 Bacteria 8696
744 Ga0496106_0024143 3300048909 Bacteria 4519
745 Ga0496106_0039035 3300048909 Bacteria 3556
746 Ga0496108_0025609 3300048911 Bacteria 4863
747 Ga0496108_0078614 3300048911 Bacteria 2792
748 Ga0496110_0038356 3300048913 Bacteria 4168
749 Ga0496111_0048070 3300048914 Bacteria 3073
750 Ga0496111_0073066 3300048914 Bacteria 2497
751 Ga0496113_0001291 3300048916 Bacteria 13830
752 Ga0496113_0009064 3300048916 Bacteria 6520
753 Ga0496114_0040701 3300048917 Bacteria 3848
754 Ga0496114_0119503 3300048917 Bacteria 2265
755 Ga0496114_0127129 3300048917 Bacteria 2198
756 Ga0496116_0009285 3300048919 Bacteria 8404
757 Ga0496117_0010218 3300048920 Bacteria 8600
758 Ga0496117_0066403 3300048920 Bacteria 2447
759 Ga0496118_0000294 3300048921 Bacteria 86720
760 Ga0496118_0002121 3300048921 Bacteria 27768
761 Ga0496118_0014728 3300048921 Bacteria 7302
762 Ga0496118_0038696 3300048921 Bacteria 3819
763 Ga0496118_0049722 3300048921 Bacteria 3225
764 Ga0496121_0012765 3300048924 Bacteria 9100
765 Ga0496121_0060732 3300048924 Bacteria 3107
766 Ga0496122_0000552 3300048925 Bacteria 77275
767 Ga0496122_0001600 3300048925 Bacteria 35421
768 Ga0496122_0007484 3300048925 Bacteria 12114
769 Ga0496122_0012381 3300048925 Bacteria 8506
770 Ga0496122_0042973 3300048925 Bacteria 3547
771 Ga0496123_0001311 3300048926 Bacteria 35270
772 Ga0496123_0001585 3300048926 Bacteria 30921
773 Ga0496123_0001667 3300048926 Bacteria 29755
774 Ga0496123_0019147 3300048926 Bacteria 5404
775 Ga0496123_0032778 3300048926 Bacteria 3752
776 Ga0496124_0003655 3300048927 Bacteria 18611
777 Ga0496124_0004257 3300048927 Bacteria 16843
778 Ga0496124_0010001 3300048927 Bacteria 9686
779 Ga0496124_0041462 3300048927 Bacteria 3972
780 Ga0496124_0046482 3300048927 Bacteria 3716
781 Ga0496125_0001368 3300048928 Bacteria 35878
782 Ga0496125_0009516 3300048928 Bacteria 9972
783 Ga0496125_0026230 3300048928 Bacteria 5315
784 Ga0496125_0053345 3300048928 Bacteria 3315
785 Ga0496125_0107161 3300048928 Bacteria 2037
786 Ga0496125_0116807 3300048928 Bacteria 1915
787 Ga0495678_000002 3300049459 Bacteria 999613
788 Ga0495678_000024 3300049459 Bacteria 229034
789 Ga0495678_000040 3300049459 Bacteria 190664
790 Ga0495678_000061 3300049459 Bacteria 142649
791 Ga0495678_001554 3300049459 Bacteria 17698
792 Ga0495678_003955 3300049459 Bacteria 8867
793 Ga0495682_0000244 3300049460 Bacteria 43169
794 Ga0501036_0051935 3300049572 Bacteria 3472
795 Ga0501039_0021608 3300049575 Bacteria 4937
796 Ga0501040_0056061 3300049576 Bacteria 2704
797 Ga0501041_0073192 3300049577 Bacteria 2106
798 Ga0501042_0030684 3300049578 Bacteria 3799
799 Ga0501046_0000126 3300049580 Bacteria 81334
800 Ga0501047_0000160 3300049581 Bacteria 81946
801 Ga0501048_0000040 3300049582 Bacteria 63031
802 Ga0501067_0022633 3300049583 Bacteria 3478
803 Ga0501068_0009596 3300049584 Bacteria 5419
804 Ga0501071_0080840 3300049587 Bacteria 2377
805 Ga0501072_0040099 3300049588 Bacteria 3677
806 Ga0501073_0000076 3300049589 Bacteria 61536
807 Ga0501079_0000507 3300049741 Bacteria 25288
808 Ga0501079_0120997 3300049741 Bacteria 2036
809 Ga0501080_0000180 3300049742 Bacteria 46199
810 Ga0501080_0156063 3300049742 Bacteria 2108
811 Ga0501269_001273 3300049766 Bacteria 3386
812 Ga0501035_0066607 3300049822 Bacteria 3196
813 nmdc:mga03683_1072_c1 3300050489 Bacteria 8008
814 nmdc:mga03683_33430_c1 3300050489 Bacteria 2075
815 nmdc:mga03683_3616_c1 3300050489 Bacteria 5019
816 nmdc:mga03683_3846_c1 3300050489 Bacteria 4902
817 nmdc:mga03n38_117_c1 3300050490 Bacteria 17259
818 nmdc:mga03n38_33023_c1 3300050490 Bacteria 2198
819 nmdc:mga00v17_195_c1 3300050491 Bacteria 36325
820 nmdc:mga0yw44_29339_c1 3300050492 Bacteria 3175
821 nmdc:mga0yw44_38063_c1 3300050492 Bacteria 2844
822 nmdc:mga0yw44_52028_c1 3300050492 Bacteria 2482
823 nmdc:mga0k408_20161_c1 3300050493 Bacteria 3731
824 nmdc:mga0k408_23570_c1 3300050493 Bacteria 3474
825 nmdc:mga0k408_37461_c1 3300050493 Bacteria 2785
826 nmdc:mga0k408_535_c1 3300050493 Bacteria 20913
827 nmdc:mga0k408_58279_c1 3300050493 Bacteria 2243
828 nmdc:mga07m45_13297_c1 3300050496 Bacteria 4365
829 nmdc:mga07m45_1483_c1 3300050496 Bacteria 10779
830 nmdc:mga07m45_218_c2 3300050496 Bacteria 22025
831 nmdc:mga07m45_22053_c1 3300050496 Bacteria 3475
832 nmdc:mga07m45_2951_c1 3300050496 Bacteria 8079
833 nmdc:mga07m45_3087_c1 3300050496 Bacteria 7964
834 nmdc:mga07m45_36120_c1 3300050496 Bacteria 2751
835 nmdc:mga07m45_4694_c2 3300050496 Bacteria 5936
836 nmdc:mga07m45_49934_c1 3300050496 Bacteria 2356
837 nmdc:mga07m45_5845_c1 3300050496 Bacteria 6172
838 Ga0500610_0000409 3300053079 Bacteria 13147
839 Ga0500578_0061468 3300053086 Bacteria 2398
840 Ga0500644_0006310 3300053088 Bacteria 3031
841 Ga0500651_0014862 3300053093 Bacteria 4768
842 Ga0500562_004965 3300053108 Bacteria 3351
843 Ga0500571_000166 3300053110 Bacteria 23008
844 Ga0500593_000327 3300053117 Bacteria 19196
845 Ga0500594_0003936 3300053118 Bacteria 3273
846 Ga0500607_053898 3300053121 Bacteria 2131
847 Ga0500608_001339 3300053122 Bacteria 8814
848 Ga0500655_000714 3300053133 Bacteria 6565
849 Ga0500658_0000117 3300053134 Bacteria 37704
850 Ga0500658_0000243 3300053134 Bacteria 25613
851 Ga0500658_0000393 3300053134 Bacteria 19079
852 Ga0500658_0022042 3300053134 Bacteria 2417
853 Ga0500559_0000116 3300053136 Bacteria 63080
854 Ga0500564_009198 3300053138 Bacteria 4288
855 Ga0500568_0003268 3300053139 Bacteria 9151
856 Ga0500568_0004444 3300053139 Bacteria 7491
857 Ga0500586_002038 3300053145 Bacteria 4449
858 Ga0500616_0000016 3300053153 Bacteria 627087
859 Ga0500616_0028808 3300053153 Bacteria 3058
860 Ga0500627_0000151 3300053158 Bacteria 20432
861 Ga0500638_006320 3300053162 Bacteria 4835
862 Ga0501084_0004502 3300054114 Bacteria 11391
863 Ga0501082_0033843 3300060353 Bacteria 4408
864 Ga0466962_0023298 3300061719 Bacteria 2975
865 2510247946 2510065045 Bacteria 7761063
866 2513229117 2513020051 Bacteria 6053213
867 2514049639 2513237166 Bacteria 10373764
868 2515685684 2515154122 Bacteria 8609520
869 2527075965 2526164713 Bacteria 6780608
870 2548501745 2547132374 Bacteria 5530232
871 2587756986 2585428062 Bacteria 6842168
872 2597028083 2596583598 Bacteria 5251611
873 2599444772 2599185178 Bacteria 5365746
874 2643864132 2643221570 Bacteria 5103772
875 2643992432 2643221596 Bacteria 5006805
876 2644159235 2643221628 Bacteria 5745828
877 2644248109 2643221644 Bacteria 6865017
878 2644252711 2643221645 Bacteria 7207331
879 2644292165 2643221652 Bacteria 5140275
880 2644303568 2643221654 Bacteria 5273570
881 2644328524 2643221658 Bacteria 6064537
882 2644355223 2643221664 Bacteria 7272945
883 2644399761 2643221672 Bacteria 6322190
884 2644646528 2643221717 Bacteria 5676132
885 2719643622 2718217991 Bacteria 7829542
886 2722883001 2721755523 Bacteria 6430384
887 2738721322 2738541277 Bacteria 7458140
888 2738880665 2738541307 Bacteria 8606193
889 2739280991 2738543019 Bacteria 7459457
890 2746090533 2744054900 Bacteria 8399525
891 2746098710 2744054901 Bacteria 8397047
892 2819601629 2818991446 Bacteria 7757362
893 2819619543 2818991450 Bacteria 6962147
894 2831269240 2831265667 Bacteria 7184833
895 2831270225 2831265667 Bacteria 7184833
896 2838059217 2838054893 Bacteria 7451788
897 2838059969 2838054893 Bacteria 7451788
898 2842681107 2842677519 Bacteria 5615038
899 2842712448 2842711865 Bacteria 7155354
900 2857555321 2857553236 Bacteria 6166726
901 2885193111 2885192300 Bacteria 5882526
902 2899930692 2899924645 Bacteria 7487985
903 2900582551 2900577576 Bacteria 5438534
904 2900638869 2900634093 Bacteria 10263517
905 2902688174 2902682994 Bacteria 8951596
906 2904425033 2904424332 Bacteria 7633521
907 2904436274 2904434214 Bacteria 6230908
908 2904453206 2904449895 Bacteria 6927402
909 2904459185 2904456579 Bacteria 6819253
910 2906802388 2906799679 Bacteria 4031749
911 2919466845 2919462493 Bacteria 5817112
912 2919477682 2919476304 Bacteria 5888696
913 2921648285 2921643360 Bacteria 11448031
914 2928040986 2928037797 Bacteria 7273642
915 2928047828 2928044640 Bacteria 7271509
916 2928054017 2928051484 Bacteria 7773759
917 2928055720 2928051484 Bacteria 7773759
918 2928059903 2928058823 Bacteria 5520022
919 2928065770 2928064002 Bacteria 7419480
920 2928069819 2928064002 Bacteria 7419480
921 2928088523 2928084124 Bacteria 7159212
922 2928088689 2928084124 Bacteria 7159212
923 2928111430 2928108538 Bacteria 7360024
924 2928119345 2928115317 Bacteria 6477646
925 2928138232 2928135762 Bacteria 7259641
926 2928504960 2928503688 Bacteria 7268108
927 2929523946 2929520902 Bacteria 6765052
928 2945912709 2945909444 Bacteria 7065066
929 2945948377 2945945610 Bacteria 5951079
930 2945972775 2945972063 Bacteria 6086495
931 2990714745 2990710928 Bacteria 5002431
932 642615121 642555113 Bacteria 8214658
933 8021626165 8021622325 Bacteria 4844743
934 8021627220 8021626552 Bacteria 4665214
935 8021651154 8021648035 Bacteria 4772378
936 8045831330 8045830549 Bacteria 4444727
937 8047677419 8047673197 Bacteria 7395230
938 8055270490 8055266321 Bacteria 7999742
939 Ga0105237_10031465
940 JGI24741J21665_1000483
941 JGI24740J21852_10000011
942 JGI24740J21852_10000057
943 JGI25156J39149_1000766
944 JGI25156J39149_1001052
945 JGI25154J39366_1001383
946 JGI25150J39212_1001922
947 JGI25159J45721_1002978
948 JGI25151J46595_10000539
949 JGI25151J46595_10009324
950 JGI25165J46597_1002776
951 JGI25153J46596_10005865
952 rootL2_10017019
953 rootL2_10056402
954 rootH1_10060501
955 JGI25160J50197_1003596
956 JGI25160J50197_1003664
957 JGI25161J50226_1001263
958 JGI25161J50226_1001680
959 Ga0006562J51391_1103569
960 Ga0055539_1000168
961 Ga0055533_1000914
962 Ga0055533_1001105
963 Ga0055533_1003457
964 Ga0055532_1000033
965 Ga0055525_1000069
966 Ga0055525_1000438
967 Ga0055527_1002323
968 Ga0055535_1000024
969 Ga0055535_1000422
970 Ga0055535_1000625
971 Ga0055542_1000074
972 Ga0055542_1000087
973 Ga0055542_1000945
974 Ga0055529_1000044
975 Ga0055526_1000028
976 Ga0055526_1003120
977 Ga0055526_1006453
978 Ga0055526_1006607
979 Ga0055537_1000064
980 Ga0055537_1002664
981 Ga0055524_1002010
982 Ga0055524_1007424
983 Ga0055536_1002562
984 Ga0055536_1002590
985 Ga0055536_1005253
986 Ga0055534_1000094
987 Ga0055534_1002480
988 Ga0055528_1000142
989 Ga0055528_1000250
990 Ga0055528_1005571
991 Ga0055530_10000492
992 Ga0055530_10004165
993 Ga0055540_1001880
994 Ga0055540_1002209
995 Ga0055540_1002683
996 Ga0055540_1004595
997 Ga0055540_1004949
998 Ga0055540_1018559
999 Ga0055531_10000738
1000 Ga0055531_10003879
1001 Ga0055531_10003975
1002 Ga0055531_10007175
1003 Ga0055531_10016465
1004 Ga0055541_1000910
1005 Ga0055541_1006948
1006 Ga0055543_1001897
1007 Ga0055543_1003550
1008 Ga0065165_1004159
1009 Ga0070658_10004140
1010 Ga0070658_10045957
1011 Ga0070676_10000646
1012 Ga0070676_10031428
1013 Ga0070683_100048160
1014 Ga0070670_100005736
1015 Ga0070670_100055022
1016 Ga0070670_100096969
1017 Ga0068869_100000695
1018 Ga0070682_100001807
1019 Ga0068868_100021364
1020 Ga0068868_100046105
1021 Ga0070689_100003286
1022 Ga0070661_100000027
1023 Ga0070661_100037837
1024 Ga0070661_100040997
1025 Ga0070669_100015690
1026 Ga0070675_100107152
1027 Ga0070671_100150864
1028 Ga0070673_100019369
1029 Ga0070659_100001366
1030 Ga0070659_100023144
1031 Ga0070667_100012849
1032 Ga0070667_100028651
1033 Ga0070663_100000004
1034 Ga0070678_100027281
1035 Ga0070662_100007206
1036 Ga0070662_100078902
1037 Ga0068867_100001970
1038 Ga0070706_100000883
1039 Ga0070698_100193917
1040 Ga0068853_100012984
1041 Ga0068853_100056079
1042 Ga0070672_100000608
1043 Ga0070686_100006973
1044 Ga0070665_100082825
1045 Ga0070665_100113824
1046 Ga0068855_100214467
1047 Ga0070664_100000041
1048 Ga0070664_100058732
1049 Ga0070664_100066970
1050 Ga0068857_100102702
1051 Ga0068854_100000269
1052 Ga0068854_100017329
1053 Ga0068856_100000004
1054 Ga0068856_100074398
1055 Ga0068852_100002516
1056 Ga0068852_100010490
1057 Ga0068852_100092761
1058 Ga0068852_100109475
1059 Ga0068859_100028125
1060 Ga0068864_100001546
1061 Ga0068864_100011901
1062 Ga0068864_100134455
1063 Ga0068861_100006522
1064 Ga0068861_100006534
1065 Ga0068861_100152687
1066 Ga0068851_10006026
1067 Ga0068870_10004833
1068 Ga0068860_100081289
1069 Ga0068862_100014215
1070 Ga0075365_10000480
1071 Ga0075365_10004292
1072 Ga0075365_10004816
1073 Ga0075365_10007708
1074 Ga0075363_100041976
1075 Ga0075364_10009931
1076 Ga0075362_10010286
1077 Ga0075362_10022148
1078 Ga0075367_10005227
1079 Ga0075369_10007347
1080 Ga0075366_10000542
1081 Ga0075366_10008352
1082 Ga0075366_10021377
1083 Ga0075366_10043784
1084 Ga0075370_10000416
1085 Ga0075370_10001822
1086 Ga0075370_10004927
1087 Ga0075370_10010524
1088 Ga0075370_10011785
1089 Ga0075370_10024269
1090 Ga0075370_10025838
1091 Ga0075370_10027917
1092 Ga0097620_100028125
1093 Ga0079104_1000026
1094 Ga0079104_1018388
1095 Ga0099826_10017694
1096 Ga0105251_10002012
1097 Ga0105244_10004665
1098 Ga0105244_10031538
1099 Ga0105244_10033401
1100 Ga0105250_10002478
1101 Ga0105240_10033282
1102 Ga0105243_10007028
1103 Ga0105243_10016857
1104 Ga0105243_10025505
1105 Ga0105243_10031665
1106 Ga0105242_10008883
1107 Ga0105242_10009715
1108 Ga0105239_10021943
1109 Ga0157373_10101692
1110 Ga0157371_10000028
1111 Ga0157371_10092669
1112 Ga0157370_10000002
1113 Ga0157370_10003601
1114 Ga0157369_10010892
1115 Ga0157369_10024286
1116 Ga0157374_10017910
1117 Ga0163162_10114901
1118 Ga0163162_10218742
1119 Ga0157372_10000065
1120 Ga0157372_10010625
1121 Ga0157372_10013922
1122 Ga0182008_10000858
1123 Ga0182008_10002516
1124 Ga0182008_10005059
1125 Ga0182008_10007174
1126 Ga0182008_10025714
1127 Ga0157377_10000069
1128 Ga0157379_10019666
1129 Ga0182006_1000008
1130 Ga0182006_1003884
1131 Ga0182006_1006635
1132 Ga0182006_1010451
1133 Ga0182007_10000246
1134 Ga0182007_10001069
1135 Ga0182007_10002482
1136 Ga0182005_1000022
1137 Ga0183362_10002
1138 Ga0163161_10000065
1139 Ga0163161_10001642
1140 Ga0209436_103337
1141 Ga0209784_100024
1142 Ga0209784_100504
1143 Ga0209566_100018
1144 Ga0209566_100392
1145 Ga0209674_100046
1146 Ga0209674_100166
1147 Ga0209674_100227
1148 Ga0209674_100781
1149 Ga0209672_100138
1150 Ga0209672_101682
1151 Ga0209147_100008
1152 Ga0209147_100419
1153 Ga0209147_100865
1154 Ga0209563_100007
1155 Ga0209563_100039
1156 Ga0209563_100090
1157 Ga0207427_102687
1158 Ga0209258_100013
1159 Ga0209258_100176
1160 Ga0209258_100199
1161 Ga0207425_1001122
1162 Ga0207425_1002323
1163 Ga0209646_1000023
1164 Ga0209646_1000063
1165 Ga0209026_1001621
1166 Ga0209677_100024
1167 Ga0209677_103192
1168 Ga0209677_106430
1169 Ga0209148_1000019
1170 Ga0209148_1000033
1171 Ga0209148_1000179
1172 Ga0209759_1000008
1173 Ga0209759_1000252
1174 Ga0209759_1001093
1175 Ga0209129_1000071
1176 Ga0209129_1003271
1177 Ga0209129_1003785
1178 Ga0209233_1000018
1179 Ga0209565_1000025
1180 Ga0209565_1000225
1181 Ga0209565_1003810
1182 Ga0209455_1000042
1183 Ga0209673_1000149
1184 Ga0209673_1000178
1185 Ga0209673_1000209
1186 Ga0209673_1000546
1187 Ga0209673_1001087
1188 Ga0209673_1008087
1189 Ga0209130_1000335
1190 Ga0209130_1000773
1191 Ga0209130_1000889
1192 Ga0209130_1001074
1193 Ga0209675_1000017
1194 Ga0209675_1000330
1195 Ga0209675_1000726
1196 Ga0209675_1004757
1197 Ga0209675_1007352
1198 Ga0209676_1000005
1199 Ga0209676_1000048
1200 Ga0209676_1000124
1201 Ga0209676_1000618
1202 Ga0209676_1005892
1203 Ga0209025_1000217
1204 Ga0209025_1001632
1205 Ga0209025_1004121
1206 Ga0209025_1008870
1207 Ga0209564_1000011
1208 Ga0209564_1000239
1209 Ga0209564_1000423
1210 Ga0209564_1004174
1211 Ga0209758_1000027
1212 Ga0209758_1000640
1213 Ga0209758_1004374
1214 Ga0209050_1000007
1215 Ga0209050_1000012
1216 Ga0209050_1001045
1217 Ga0209050_1003991
1218 Ga0209256_1000081
1219 Ga0209256_1000095
1220 Ga0209256_1004326
1221 Ga0207426_1000027
1222 Ga0207426_1000161
1223 Ga0207426_1000176
1224 Ga0209051_1000009
1225 Ga0209051_1000019
1226 Ga0209051_1000161
1227 Ga0209051_1000207
1228 Ga0209051_1000342
1229 Ga0209051_1000553
1230 Ga0209051_1031147
1231 Ga0209257_1000011
1232 Ga0209257_1000024
1233 Ga0209257_1000258
1234 Ga0209257_1000497
1235 Ga0209257_1007259
1236 Ga0207655_1001510
1237 Ga0207713_1000216
1238 Ga0207647_10017352
1239 Ga0207645_10001088
1240 Ga0207645_10014282
1241 Ga0207645_10032664
1242 Ga0207705_10001595
1243 Ga0207705_10108311
1244 Ga0207654_10025261
1245 Ga0207695_10007973
1246 Ga0207671_10012547
1247 Ga0207657_10009403
1248 Ga0207657_10029448
1249 Ga0207657_10161522
1250 Ga0207649_10000685
1251 Ga0207681_10013913
1252 Ga0207681_10013942
1253 Ga0207694_10021430
1254 Ga0207650_10013966
1255 Ga0207650_10080685
1256 Ga0207659_10006927
1257 Ga0207687_10034857
1258 Ga0207690_10002716
1259 Ga0207690_10027381
1260 Ga0207706_10005682
1261 Ga0207706_10043763
1262 Ga0207706_10045849
1263 Ga0207706_10116928
1264 Ga0207686_10003686
1265 Ga0207686_10003820
1266 Ga0207709_10000079
1267 Ga0207709_10000669
1268 Ga0207709_10001323
1269 Ga0207670_10002264
1270 Ga0207691_10000679
1271 Ga0207711_10165856
1272 Ga0207689_10000725
1273 Ga0207689_10038223
1274 Ga0207661_10080313
1275 Ga0207679_10000004
1276 Ga0207679_10076189
1277 Ga0207667_10096796
1278 Ga0207667_10113394
1279 Ga0207667_10252888
1280 Ga0207651_10058495
1281 Ga0207640_10000211
1282 Ga0207640_10012778
1283 Ga0207640_10019077
1284 Ga0207658_10014951
1285 Ga0207677_10008506
1286 Ga0207677_10019506
1287 Ga0207703_10038291
1288 Ga0207639_10009478
1289 Ga0207678_10000180
1290 Ga0207702_10000020
1291 Ga0207702_10007986
1292 Ga0207648_10004458
1293 Ga0207648_10004554
1294 Ga0207648_10071462
1295 Ga0207648_10081018
1296 Ga0207674_10010346
1297 Ga0207674_10060157
1298 Ga0207674_10076146
1299 Ga0207674_10208606
1300 Ga0207675_100000273
1301 Ga0207675_100000765
1302 Ga0207675_100021837
1303 Ga0207683_10011057
1304 Ga0207683_10100635
1305 Ga0207698_10021438
1306 Ga0207698_10023722
1307 Ga0209281_1000067
1308 Ga0209282_1001023
1309 Ga0209974_10015044
1310 Ga0207428_10013627
1311 Ga0268264_10058582
1312 Ga0307517_10003441
1313 Ga0307515_10000040
1314 Ga0307515_10000058
1315 Ga0307515_10000183
1316 Ga0307515_10001346
1317 Ga0307515_10012069
1318 Ga0307515_10025071
1319 Ga0307515_10073933
1320 Ga0307515_10104117
1321 Ga0307515_10120319
1322 Ga0307515_10121568
1323 Ga0307512_10035162
1324 Ga0307512_10040192
1325 Ga0316177_1155812
1326 Ga0316178_1067235
1327 Ga0316182_1211861
1328 Ga0265327_10000108
1329 Ga0265327_10012096
1330 Ga0307513_10001393
1331 Ga0307513_10002544
1332 Ga0307513_10029784
1333 Ga0307513_10057706
1334 Ga0307513_10118098
1335 Ga0307513_10139518
1336 Ga0307509_10006292
1337 Ga0307509_10022418
1338 Ga0307408_100000171
1339 Ga0307408_100010201
1340 Ga0307508_10002459
1341 Ga0307508_10025856
1342 Ga0307514_10009679
1343 Ga0307514_10076807
1344 Ga0265342_10003734
1345 Ga0307516_10000394
1346 Ga0307516_10000709
1347 Ga0307516_10043849
1348 Ga0307405_10058112
1349 Ga0307405_10065404
1350 Ga0316577_10003504
1351 Ga0307413_10063938
1352 Ga0307406_10009023
1353 Ga0307406_10014914
1354 Ga0307406_10055227
1355 Ga0307412_10077345
1356 Ga0307409_100001404
1357 Ga0307416_100001711
1358 Ga0307416_100018029
1359 Ga0307414_10099665
1360 Ga0307510_10000467
1361 Ga0307510_10027809
1362 Ga0373931_0008464
1363 Ga0316582_0014944
1364 Ga0395899_0001262
1365 Ga0395899_0007932
1366 Ga0395899_0009990
1367 Ga0395900_0006722
1368 Ga0395900_0007236
1369 Ga0395900_0040318
1370 Ga0395900_0096206
1371 Ga0395898_0014953
1372 Ga0395898_0019254
1373 Ga0395898_0035857
1374 Ga0395905_0001220
1375 Ga0395905_0004024
1376 Ga0395905_0005314
1377 Ga0395905_0006792
1378 Ga0395905_0010108
1379 Ga0395905_0013012
1380 Ga0395905_0044653
1381 Ga0395901_0002505
1382 Ga0395901_0011310
1383 Ga0395901_0094682
1384 Ga0395901_0121647
1385 Ga0395901_0203504
1386 Ga0400483_039388
1387 Ga0400483_059443
1388 Ga0400483_195602
1389 Ga0439436_0000586
1390 Ga0439436_0005259
1391 Ga0439436_0014067
1392 Ga0439439_0002574
1393 Ga0439439_0004979
1394 Ga0439447_013177
1395 Ga0439466_0015170
1396 Ga0439465_0000571
1397 Ga0439465_0020677
1398 Ga0439431_0000218
1399 Ga0439433_0000683
1400 Ga0439445_0000180
1401 Ga0439432_000464
1402 Ga0439432_010622
1403 Ga0439432_021413
1404 Ga0439449_0000184
1405 Ga0439449_0001212
1406 Ga0439449_0004083
1407 Ga0439449_0006024
1408 Ga0439452_002076
1409 Ga0439452_003379
1410 Ga0439452_011899
1411 Ga0439455_0006751
1412 Ga0439457_007377
1413 Ga0439462_0000535
1414 Ga0439462_0001407
1415 Ga0450911_001243
1416 Ga0450923_000177
1417 Ga0450923_006162
1418 Ga0450890_003471
1419 Ga0450906_005273
1420 Ga0450910_004095
1421 Ga0439446_0000560
1422 Ga0439446_0002189
1423 Ga0439446_0013243
1424 Ga0450908_006164
1425 Ga0450909_000694
1426 Ga0439434_0000517
1427 Ga0439434_0002373
1428 Ga0439464_0014316
1429 Ga0450918_000031
1430 Ga0450918_001470
1431 Ga0451577_0003137
1432 Ga0451577_0005516
1433 Ga0466986_0085020
1434 Ga0466969_0030672
1435 Ga0453683_0019338
1436 Ga0453683_0026131
1437 Ga0466965_0051731
1438 Ga0466961_0000282
1439 Ga0466964_0028039
1440 Ga0453684_0006348
1441 Ga0453684_0083911
1442 Ga0453684_0087245
1443 Ga0453684_0202031
1444 Ga0466971_0056311
1445 Ga0466968_0036189
1446 Ga0466970_0003436
1447 Ga0466957_0025411
1448 Ga0466960_0023805
1449 Ga0466959_0000688
1450 Ga0451576_0012565
1451 Ga0466967_0043465
1452 Ga0495627_000001
1453 Ga0495592_0000522
1454 Ga0495592_0005989
1455 Ga0495603_0020046
1456 Ga0495590_0000005
1457 Ga0495590_0003118
1458 Ga0495591_002109
1459 Ga0495629_0000033
1460 Ga0495629_0001604
1461 Ga0495629_0006464
1462 Ga0495638_0000027
1463 Ga0495638_0007694
1464 Ga0495638_0008411
1465 Ga0495638_0019007
1466 Ga0495641_0041619
1467 Ga0495653_0000163
1468 Ga0495653_0106316
1469 Ga0495650_0000170
1470 Ga0495650_0000213
1471 Ga0495650_0000240
1472 Ga0495650_0001256
1473 Ga0495650_0002103
1474 Ga0495650_0015376
1475 Ga0495580_0002043
1476 Ga0495580_0002298
1477 Ga0495580_0028629
1478 Ga0495582_0021694
1479 Ga0495605_0000056
1480 Ga0495605_0017680
1481 Ga0495639_0002959
1482 Ga0495664_0008185
1483 Ga0495664_0063512
1484 Ga0495585_0043088
1485 Ga0495596_0000329
1486 Ga0495596_0004008
1487 Ga0495607_0000324
1488 Ga0495607_0001029
1489 Ga0495607_0001554
1490 Ga0495607_0003470
1491 Ga0495607_0004331
1492 Ga0495607_0014753
1493 Ga0495583_0000006
1494 Ga0495583_0001372
1495 Ga0495583_0002717
1496 Ga0495583_0005135
1497 Ga0495583_0007223
1498 Ga0495606_0005944
1499 Ga0495606_0006155
1500 Ga0495606_0016499
1501 Ga0495606_0020206
1502 Ga0495608_0018452
1503 Ga0495610_0000313
1504 Ga0495610_0003626
1505 Ga0495610_0006931
1506 Ga0495610_0007978
1507 Ga0495610_0023602
1508 Ga0495616_0000020
1509 Ga0495616_0000276
1510 Ga0495616_0003088
1511 Ga0495616_0003114
1512 Ga0495616_0004322
1513 Ga0495618_0002532
1514 Ga0495620_0011565
1515 Ga0495620_0026905
1516 Ga0495628_0007214
1517 Ga0495630_0002184
1518 Ga0495630_0009783
1519 Ga0495630_0110856
1520 Ga0495631_0000537
1521 Ga0495631_0001293
1522 Ga0495631_0004854
1523 Ga0495631_0022659
1524 Ga0495632_0000176
1525 Ga0495632_0001460
1526 Ga0495632_0007706
1527 Ga0495632_0008791
1528 Ga0495632_0036658
1529 Ga0495632_0074234
1530 Ga0495637_0000008
1531 Ga0495643_0000051
1532 Ga0495643_0000141
1533 Ga0495643_0000167
1534 Ga0495643_0000180
1535 Ga0495643_0000361
1536 Ga0495643_0031175
1537 Ga0495648_0000002
1538 Ga0495648_0001678
1539 Ga0495648_0023130
1540 Ga0495666_0005457
1541 Ga0495666_0008739
1542 Ga0495666_0074895
1543 Ga0495642_0000249
1544 Ga0495642_0001355
1545 Ga0495642_0026571
1546 Ga0495654_0005620
1547 Ga0495654_0006056
1548 Ga0495665_0008977
1549 Ga0495640_0016088
1550 Ga0495640_0024491
1551 Ga0495609_0000001
1552 Ga0495609_0000954
1553 Ga0495609_0004645
1554 Ga0495609_0011657
1555 Ga0495609_0013404
1556 Ga0495621_0001726
1557 Ga0495621_0011558
1558 Ga0495621_0022221
1559 Ga0495597_0000141
1560 Ga0495597_0000855
1561 Ga0495622_0000096
1562 Ga0495622_0000137
1563 Ga0495633_0000033
1564 Ga0495633_0000198
1565 Ga0495633_0002017
1566 Ga0495633_0003648
1567 Ga0495633_0006300
1568 Ga0495633_0041262
1569 Ga0495656_0009836
1570 Ga0495656_0010304
1571 Ga0495668_0000065
1572 Ga0495668_0000091
1573 Ga0495668_0002605
1574 Ga0495668_0012823
1575 Ga0495634_0035873
1576 Ga0495634_0065588
1577 Ga0495611_0000410
1578 Ga0495611_0005200
1579 Ga0495625_0000053
1580 Ga0495625_0000056
1581 Ga0495625_0000857
1582 Ga0495625_0002889
1583 Ga0495625_0007984
1584 Ga0495625_0013541
1585 Ga0495625_0076904
1586 Ga0495661_0000049
1587 Ga0495661_0000053
1588 Ga0495661_0000591
1589 Ga0495661_0000804
1590 Ga0495661_0011693
1591 Ga0495661_0016925
1592 Ga0495661_0032503
1593 Ga0495588_0000098
1594 Ga0495588_0013009
1595 Ga0495623_0000657
1596 Ga0495623_0008179
1597 Ga0495646_0006241
1598 Ga0495646_0023557
1599 Ga0495646_0025718
1600 Ga0495669_0004853
1601 Ga0495669_0012144
1602 Ga0495624_0002901
1603 Ga0495624_0003617
1604 Ga0495624_0052448
1605 Ga0495670_0032140
1606 Ga0495649_0000071
1607 Ga0495649_0000680
1608 Ga0495649_0004997
1609 Ga0495649_0006112
1610 Ga0495649_0017453
1611 Ga0495649_0070248
1612 Ga0495589_0000103
1613 Ga0495589_0000154
1614 Ga0495589_0008374
1615 Ga0495589_0017710
1616 Ga0495589_0031766
1617 Ga0495600_0006015
1618 Ga0495600_0029124
1619 Ga0495660_0000024
1620 Ga0495660_0000055
1621 Ga0495660_0000970
1622 Ga0495660_0006403
1623 Ga0495660_0009244
1624 Ga0495604_0000727
1625 Ga0495604_0003084
1626 Ga0495604_0044820
1627 Ga0495636_0002436
1628 Ga0495674_0002774
1629 Ga0495674_0072396
1630 Ga0495672_0000030
1631 Ga0495672_0000033
1632 Ga0495672_0001752
1633 Ga0495676_0044798
1634 Ga0495676_0050818
1635 Ga0495676_0113890
1636 Ga0495680_0177728
1637 Ga0495683_0000168
1638 Ga0495683_0027991
1639 Ga0495683_0038186
1640 Ga0495687_000019
1641 Ga0495687_000523
1642 Ga0495687_000559
1643 Ga0495687_001650
1644 Ga0495687_003727
1645 Ga0495687_006879
1646 Ga0495687_021060
1647 Ga0495675_0030826
1648 Ga0495677_0000009
1649 Ga0495677_0000270
1650 Ga0495677_0003231
1651 Ga0495677_0004867
1652 Ga0495677_0005508
1653 Ga0495677_0018762
1654 Ga0495679_000030
1655 Ga0495679_007259
1656 Ga0495679_013850
1657 Ga0495685_001244
1658 Ga0495681_0012312
1659 Ga0495681_0016928
1660 Ga0495684_0016462
1661 Ga0495686_0002774
1662 Ga0495686_0007264
1663 Ga0495593_0046251
1664 Ga0495602_0012277
1665 Ga0495602_0051653
1666 Ga0495602_0119294
1667 Ga0495614_0007400
1668 Ga0495626_0000053
1669 Ga0495626_0000358
1670 Ga0495626_0005003
1671 Ga0496100_0007181
1672 Ga0496100_0015084
1673 Ga0496101_0000463
1674 Ga0496101_0007886
1675 Ga0496102_0003468
1676 Ga0496102_0007533
1677 Ga0496103_0002435
1678 Ga0496103_0016461
1679 Ga0496104_0009026
1680 Ga0496104_0009388
1681 Ga0496105_0006985
1682 Ga0496106_0024143
1683 Ga0496106_0039035
1684 Ga0496108_0025609
1685 Ga0496108_0078614
1686 Ga0496110_0038356
1687 Ga0496111_0048070
1688 Ga0496111_0073066
1689 Ga0496113_0001291
1690 Ga0496113_0009064
1691 Ga0496114_0040701
1692 Ga0496114_0119503
1693 Ga0496114_0127129
1694 Ga0496116_0009285
1695 Ga0496117_0010218
1696 Ga0496117_0066403
1697 Ga0496118_0000294
1698 Ga0496118_0002121
1699 Ga0496118_0014728
1700 Ga0496118_0038696
1701 Ga0496118_0049722
1702 Ga0496121_0012765
1703 Ga0496121_0060732
1704 Ga0496122_0000552
1705 Ga0496122_0001600
1706 Ga0496122_0007484
1707 Ga0496122_0012381
1708 Ga0496122_0042973
1709 Ga0496123_0001311
1710 Ga0496123_0001585
1711 Ga0496123_0001667
1712 Ga0496123_0019147
1713 Ga0496123_0032778
1714 Ga0496124_0003655
1715 Ga0496124_0004257
1716 Ga0496124_0010001
1717 Ga0496124_0041462
1718 Ga0496124_0046482
1719 Ga0496125_0001368
1720 Ga0496125_0009516
1721 Ga0496125_0026230
1722 Ga0496125_0053345
1723 Ga0496125_0107161
1724 Ga0496125_0116807
1725 Ga0495678_000002
1726 Ga0495678_000024
1727 Ga0495678_000040
1728 Ga0495678_000061
1729 Ga0495678_001554
1730 Ga0495678_003955
1731 Ga0495682_0000244
1732 Ga0501036_0051935
1733 Ga0501039_0021608
1734 Ga0501040_0056061
1735 Ga0501041_0073192
1736 Ga0501042_0030684
1737 Ga0501046_0000126
1738 Ga0501047_0000160
1739 Ga0501048_0000040
1740 Ga0501067_0022633
1741 Ga0501068_0009596
1742 Ga0501071_0080840
1743 Ga0501072_0040099
1744 Ga0501073_0000076
1745 Ga0501079_0000507
1746 Ga0501079_0120997
1747 Ga0501080_0000180
1748 Ga0501080_0156063
1749 Ga0501269_001273
1750 Ga0501035_0066607
1751 nmdc:mga03683_1072_c1
1752 nmdc:mga03683_33430_c1
1753 nmdc:mga03683_3616_c1
1754 nmdc:mga03683_3846_c1
1755 nmdc:mga03n38_117_c1
1756 nmdc:mga03n38_33023_c1
1757 nmdc:mga00v17_195_c1
1758 nmdc:mga0yw44_29339_c1
1759 nmdc:mga0yw44_38063_c1
1760 nmdc:mga0yw44_52028_c1
1761 nmdc:mga0k408_20161_c1
1762 nmdc:mga0k408_23570_c1
1763 nmdc:mga0k408_37461_c1
1764 nmdc:mga0k408_535_c1
1765 nmdc:mga0k408_58279_c1
1766 nmdc:mga07m45_13297_c1
1767 nmdc:mga07m45_1483_c1
1768 nmdc:mga07m45_218_c2
1769 nmdc:mga07m45_22053_c1
1770 nmdc:mga07m45_2951_c1
1771 nmdc:mga07m45_3087_c1
1772 nmdc:mga07m45_36120_c1
1773 nmdc:mga07m45_4694_c2
1774 nmdc:mga07m45_49934_c1
1775 nmdc:mga07m45_5845_c1
1776 Ga0500610_0000409
1777 Ga0500578_0061468
1778 Ga0500644_0006310
1779 Ga0500651_0014862
1780 Ga0500562_004965
1781 Ga0500571_000166
1782 Ga0500593_000327
1783 Ga0500594_0003936
1784 Ga0500607_053898
1785 Ga0500608_001339
1786 Ga0500655_000714
1787 Ga0500658_0000117
1788 Ga0500658_0000243
1789 Ga0500658_0000393
1790 Ga0500658_0022042
1791 Ga0500559_0000116
1792 Ga0500564_009198
1793 Ga0500568_0003268
1794 Ga0500568_0004444
1795 Ga0500586_002038
1796 Ga0500616_0000016
1797 Ga0500616_0028808
1798 Ga0500627_0000151
1799 Ga0500638_006320
1800 Ga0501084_0004502
1801 Ga0501082_0033843
1802 Ga0466962_0023298
1803 2510247946
1804 2513229117
1805 2514049639
1806 2515685684
1807 2527075965
1808 2548501745
1809 2587756986
1810 2597028083
1811 2599444772
1812 2643864132
1813 2643992432
1814 2644159235
1815 2644248109
1816 2644252711
1817 2644292165
1818 2644303568
1819 2644328524
1820 2644355223
1821 2644399761
1822 2644646528
1823 2719643622
1824 2722883001
1825 2738721322
1826 2738880665
1827 2739280991
1828 2746090533
1829 2746098710
1830 2819601629
1831 2819619543
1832 2831269240
1833 2831270225
1834 2838059217
1835 2838059969
1836 2842681107
1837 2842712448
1838 2857555321
1839 2885193111
1840 2899930692
1841 2900582551
1842 2900638869
1843 2902688174
1844 2904425033
1845 2904436274
1846 2904453206
1847 2904459185
1848 2906802388
1849 2919466845
1850 2919477682
1851 2921648285
1852 2928040986
1853 2928047828
1854 2928054017
1855 2928055720
1856 2928059903
1857 2928065770
1858 2928069819
1859 2928088523
1860 2928088689
1861 2928111430
1862 2928119345
1863 2928138232
1864 2928504960
1865 2929523946
1866 2945912709
1867 2945948377
1868 2945972775
1869 2990714745
1870 642615121
1871 8021626165
1872 8021627220
1873 8021651154
1874 8045831330
1875 8047677419
1876 8055270490

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07519

Tannase

Tannase and feruloyl esterase

137

622

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qga-assembly5.cif.gz_E crystal structure of ideonella sakaiensis mhetase bound to the non-hydrolyzable ligand mheta 0.9247 48 576
6qg9-assembly5.cif.gz_E crystal structure of ideonella sakaiensis mhetase 0.9239 48 576
8ekg-assembly6.cif.gz_F mhetase variant thr159val, met192tyr, tyr252phe, tyr503trp 0.9215 48 576
6qz2-assembly4.cif.gz_D structure of mhetase from ideonella sakaiensis 0.919 58 576
6jtt-assembly1.cif.gz_A mhetase in complex with bhet 0.9155 48 576
ID Description Score Start End Superfamily
af_Q8IBH1_58_270_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8518 445 492 3.40.50.1820
af_Q0DRS5_1_166_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7989 205 249 3.40.50.1820
af_A4I2F6_184_375_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7779 180 233 3.40.50.1820
af_P76561_1_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7743 445 492 3.40.50.1820
af_I1JYD1_9_266_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7483 203 235 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q4WNV1-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9908 280 576 GO:0030600
GO:0045493
GO:0046872
AF-A0A1H6P4D6-F1-model_v4 deleted 0.9865 217 432
AF-A0A4Q3PHY6-F1-model_v4 deleted 0.9845 130 515
AF-A0A4Q4WNV1-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9842 280 576 GO:0030600
GO:0045493
GO:0046872
AF-A0A7U5AJR8-F1-model_v4 deleted 0.983 429 576

Map