F486247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 521 | 1876 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10012593|Ga0105238_100125931 |
| Length | 316 |
| Sequence | MSRRHRRRASWRKPLPGSSSKAHLNRRCKHHRAVDPSLANQPVSKETAMSNSKVVVVTGVSSGIGRATAAKFAKRGCRVFGTVRNVAKAAPLAGVELVEMDVSDDASVKSGIQFIIDRAKHIDVLVNNAGTSLIGAVEETSIAEATALFDANVFGILRTAQAVLPQMRAQRNGRVVNISSVLGFLPAPYMGLYAASKHAVEGLSETLDHEVRQFGVRISLVEPTFTRTNLDVNAPQARAKISDYDRERDLASRAIVKSVKGAPEPDGVADAVVDAALGAWRMRRTPGRQASLLSKLRRFMPAAPVDASLRKTFGLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 99 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 224 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 225 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 226 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 229 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 304 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 305 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 311 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 322 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 336 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 337 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 338 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 339 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 340 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 341 | 2512875024 | |||
| 342 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 343 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 344 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 345 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 346 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 347 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 348 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 349 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 350 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 351 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 352 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 353 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 354 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 355 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 356 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 357 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 358 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 359 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 360 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 361 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 362 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 363 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 364 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 365 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 366 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 367 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 368 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 369 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 370 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 371 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 372 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 373 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 374 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 375 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 376 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 377 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 378 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 379 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 380 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 381 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 382 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 383 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 384 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 385 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 386 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 387 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 388 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 389 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 390 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 391 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 392 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 393 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 394 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 395 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 396 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 397 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 398 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 399 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 400 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 401 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 402 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 403 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 404 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 405 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 406 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 407 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 408 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 409 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 410 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 411 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 412 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 413 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 414 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 415 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 416 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 417 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 418 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 419 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 420 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 421 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 422 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 423 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 424 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 425 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 426 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 427 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 428 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 429 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 430 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 431 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 432 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 433 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 434 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 435 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 436 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 437 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 438 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 439 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 440 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 441 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 442 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 443 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 444 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 445 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 446 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 447 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 448 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 449 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 450 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 451 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 452 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 453 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 454 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 455 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 456 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 457 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 458 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 459 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 460 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 461 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 462 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 463 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 464 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 465 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 466 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 467 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 468 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 469 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 470 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 471 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 472 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 473 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 474 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 475 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 476 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 477 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 478 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 479 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 480 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 481 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 482 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 483 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 484 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 485 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 486 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 487 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 488 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 489 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 490 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 491 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 492 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 493 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 494 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 495 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 496 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 497 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 498 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 499 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 500 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 501 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 502 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 503 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 504 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 505 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 506 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 507 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 508 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 509 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 510 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 511 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 512 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 513 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 514 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 515 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 516 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 517 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 518 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 519 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 520 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 521 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.85 |
| Metatranscriptomes | 0.32 |
| Isolates | 19.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.65 |
| Nodule | 15.25 |
| Rhizoplane | 0.85 |
| Rhizosphere | 47.97 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10012593 | 3300009551 | Bacteria | 8538 |
| 2 | JGI24740J21852_10000061 | 3300001979 | Bacteria | 34865 |
| 3 | JGI24740J21852_10000399 | 3300001979 | Bacteria | 18646 |
| 4 | JGI24740J21852_10002819 | 3300001979 | Bacteria | 7774 |
| 5 | JGI24739J22299_10000076 | 3300001989 | Bacteria | 27668 |
| 6 | JGI24739J22299_10002903 | 3300001989 | Bacteria | 6579 |
| 7 | JGI24739J22299_10003435 | 3300001989 | Bacteria | 6042 |
| 8 | JGI24739J22299_10020345 | 3300001989 | Bacteria | 2371 |
| 9 | JGI24737J22298_10000304 | 3300001990 | Bacteria | 16452 |
| 10 | JGI24735J21928_10000201 | 3300002067 | Bacteria | 21023 |
| 11 | JGI24735J21928_10000454 | 3300002067 | Bacteria | 14377 |
| 12 | JGI24735J21928_10014636 | 3300002067 | Bacteria | 2455 |
| 13 | JGI25155J39150_1000039 | 3300002704 | Bacteria | 91670 |
| 14 | JGI25156J39149_1000096 | 3300002705 | Bacteria | 64397 |
| 15 | JGI25156J39149_1009783 | 3300002705 | Bacteria | 2303 |
| 16 | JGI25156J39149_1011488 | 3300002705 | Bacteria | 1999 |
| 17 | JGI25154J39366_1000077 | 3300002738 | Bacteria | 90455 |
| 18 | JGI25154J39366_1000148 | 3300002738 | Bacteria | 54914 |
| 19 | JGI25154J39366_1000725 | 3300002738 | Bacteria | 14907 |
| 20 | JGI25154J39366_1004071 | 3300002738 | Bacteria | 2766 |
| 21 | JGI25154J39366_1010875 | 3300002738 | Bacteria | 1062 |
| 22 | JGI25158J39367_1001215 | 3300002739 | Bacteria | 4631 |
| 23 | JGI25157J39369_1000065 | 3300002741 | Bacteria | 98536 |
| 24 | JGI25157J39369_1000573 | 3300002741 | Bacteria | 21883 |
| 25 | JGI25157J39369_1001461 | 3300002741 | Bacteria | 8783 |
| 26 | JGI25152J39213_1000003 | 3300002773 | Bacteria | 214804 |
| 27 | JGI25150J39212_1000035 | 3300002774 | Bacteria | 90105 |
| 28 | JGI25150J39212_1000446 | 3300002774 | Bacteria | 18374 |
| 29 | JGI25150J39212_1003091 | 3300002774 | Bacteria | 3982 |
| 30 | JGI25150J39212_1010085 | 3300002774 | Bacteria | 1770 |
| 31 | JGI25150J39212_1016234 | 3300002774 | Bacteria | 1224 |
| 32 | JGI25159J45721_1001030 | 3300002987 | Bacteria | 11942 |
| 33 | JGI25151J46595_10003534 | 3300003187 | Bacteria | 8595 |
| 34 | JGI25153J46596_10000046 | 3300003215 | Bacteria | 148355 |
| 35 | JGI25153J46596_10010646 | 3300003215 | Bacteria | 4140 |
| 36 | JGI25153J46596_10022613 | 3300003215 | Bacteria | 2311 |
| 37 | rootH1_10178903 | 3300003323 | Bacteria | 3964 |
| 38 | rootH1_10183483 | 3300003323 | Bacteria | 1037 |
| 39 | JGI25160J50197_1034153 | 3300003354 | Bacteria | 1267 |
| 40 | Ga0006562J51391_1055123 | 3300003578 | Bacteria | 1589 |
| 41 | Ga0006562J51391_1055124 | 3300003578 | Bacteria | 2460 |
| 42 | Ga0055538_1003839 | 3300003751 | Bacteria | 1816 |
| 43 | Ga0055539_1000059 | 3300003752 | Bacteria | 146394 |
| 44 | Ga0055539_1000692 | 3300003752 | Bacteria | 8734 |
| 45 | Ga0055533_1000664 | 3300003756 | Bacteria | 11419 |
| 46 | Ga0055533_1000803 | 3300003756 | Bacteria | 9795 |
| 47 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 48 | Ga0055532_1000025 | 3300003758 | Bacteria | 240145 |
| 49 | Ga0055532_1001236 | 3300003758 | Bacteria | 7540 |
| 50 | Ga0055525_1000207 | 3300003759 | Bacteria | 66980 |
| 51 | Ga0055525_1000447 | 3300003759 | Bacteria | 23685 |
| 52 | Ga0055527_1000108 | 3300003760 | Bacteria | 59457 |
| 53 | Ga0055527_1000336 | 3300003760 | Bacteria | 24072 |
| 54 | Ga0055527_1000901 | 3300003760 | Bacteria | 7539 |
| 55 | Ga0055527_1003809 | 3300003760 | Bacteria | 2166 |
| 56 | Ga0055535_1000019 | 3300003761 | Bacteria | 240145 |
| 57 | Ga0055535_1000080 | 3300003761 | Bacteria | 108370 |
| 58 | Ga0055535_1000712 | 3300003761 | Bacteria | 25305 |
| 59 | Ga0055535_1000899 | 3300003761 | Bacteria | 20328 |
| 60 | Ga0055535_1002175 | 3300003761 | Bacteria | 7540 |
| 61 | Ga0055535_1002380 | 3300003761 | Bacteria | 6716 |
| 62 | Ga0055535_1012321 | 3300003761 | Bacteria | 1311 |
| 63 | Ga0055542_1000577 | 3300003762 | Bacteria | 31820 |
| 64 | Ga0055542_1000764 | 3300003762 | Bacteria | 24368 |
| 65 | Ga0055542_1000773 | 3300003762 | Bacteria | 24058 |
| 66 | Ga0055542_1000898 | 3300003762 | Bacteria | 20328 |
| 67 | Ga0055542_1002053 | 3300003762 | Bacteria | 7573 |
| 68 | Ga0055529_1000035 | 3300003763 | Bacteria | 240145 |
| 69 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 70 | Ga0055529_1000172 | 3300003763 | Bacteria | 89025 |
| 71 | Ga0055529_1000613 | 3300003763 | Bacteria | 26951 |
| 72 | Ga0055529_1000665 | 3300003763 | Bacteria | 24058 |
| 73 | Ga0055529_1000686 | 3300003763 | Bacteria | 23167 |
| 74 | Ga0055526_1000089 | 3300003771 | Bacteria | 83426 |
| 75 | Ga0055526_1001925 | 3300003771 | Bacteria | 14356 |
| 76 | Ga0055537_1000046 | 3300003773 | Bacteria | 88251 |
| 77 | Ga0055537_1000064 | 3300003773 | Bacteria | 77134 |
| 78 | Ga0055537_1004523 | 3300003773 | Bacteria | 3962 |
| 79 | Ga0055537_1015409 | 3300003773 | Bacteria | 1342 |
| 80 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 81 | Ga0055524_1002020 | 3300003775 | Bacteria | 10826 |
| 82 | Ga0055524_1008763 | 3300003775 | Bacteria | 4175 |
| 83 | Ga0055524_1035429 | 3300003775 | Bacteria | 1361 |
| 84 | Ga0055536_1003378 | 3300003781 | Bacteria | 8611 |
| 85 | Ga0055536_1005290 | 3300003781 | Bacteria | 6353 |
| 86 | Ga0055534_1000094 | 3300003784 | Bacteria | 70029 |
| 87 | Ga0055534_1000446 | 3300003784 | Bacteria | 24264 |
| 88 | Ga0055534_1007964 | 3300003784 | Bacteria | 2455 |
| 89 | Ga0055528_1000142 | 3300003790 | Bacteria | 58220 |
| 90 | Ga0055528_1000250 | 3300003790 | Bacteria | 45479 |
| 91 | Ga0055528_1001134 | 3300003790 | Bacteria | 17390 |
| 92 | Ga0055528_1015750 | 3300003790 | Bacteria | 2713 |
| 93 | Ga0055528_1024132 | 3300003790 | Bacteria | 1834 |
| 94 | Ga0055530_10000015 | 3300003791 | Bacteria | 148790 |
| 95 | Ga0055530_10002108 | 3300003791 | Bacteria | 13254 |
| 96 | Ga0055530_10003589 | 3300003791 | Bacteria | 8717 |
| 97 | Ga0055530_10004951 | 3300003791 | Bacteria | 6590 |
| 98 | Ga0055530_10004954 | 3300003791 | Bacteria | 6588 |
| 99 | Ga0055540_1000039 | 3300003792 | Bacteria | 161844 |
| 100 | Ga0055540_1001343 | 3300003792 | Bacteria | 14821 |
| 101 | Ga0055531_10001229 | 3300003794 | Bacteria | 19501 |
| 102 | Ga0055531_10002703 | 3300003794 | Bacteria | 11678 |
| 103 | Ga0055531_10003176 | 3300003794 | Bacteria | 10567 |
| 104 | Ga0055531_10016754 | 3300003794 | Bacteria | 3139 |
| 105 | Ga0055531_10025689 | 3300003794 | Unclassified | 2130 |
| 106 | Ga0055531_10028559 | 3300003794 | Bacteria | 1920 |
| 107 | Ga0055541_1001078 | 3300003841 | Bacteria | 6251 |
| 108 | Ga0055541_1005811 | 3300003841 | Bacteria | 2135 |
| 109 | Ga0055541_1007353 | 3300003841 | Bacteria | 1814 |
| 110 | Ga0058692_1000035 | 3300003856 | Bacteria | 152983 |
| 111 | Ga0065165_1019916 | 3300005262 | Bacteria | 2379 |
| 112 | Ga0065165_1052000 | 3300005262 | Unclassified | 1159 |
| 113 | Ga0065704_10004493 | 3300005289 | Bacteria | 4724 |
| 114 | Ga0065707_10236624 | 3300005295 | Bacteria | 1170 |
| 115 | Ga0070658_10099137 | 3300005327 | Bacteria | 2407 |
| 116 | Ga0070690_100063390 | 3300005330 | Bacteria | 2385 |
| 117 | Ga0070682_100092374 | 3300005337 | Bacteria | 1982 |
| 118 | Ga0070660_100180758 | 3300005339 | Bacteria | 1707 |
| 119 | Ga0070660_100244152 | 3300005339 | Bacteria | 1463 |
| 120 | Ga0070661_100000192 | 3300005344 | Bacteria | 50400 |
| 121 | Ga0070661_100289858 | 3300005344 | Bacteria | 1272 |
| 122 | Ga0070661_100335551 | 3300005344 | Bacteria | 1183 |
| 123 | Ga0070673_100527205 | 3300005364 | Bacteria | 1071 |
| 124 | Ga0070659_100016932 | 3300005366 | Bacteria | 5479 |
| 125 | Ga0070667_100281583 | 3300005367 | Bacteria | 1493 |
| 126 | Ga0070714_100007578 | 3300005435 | Bacteria | 8454 |
| 127 | Ga0070713_100047670 | 3300005436 | Bacteria | 3523 |
| 128 | Ga0070708_100259188 | 3300005445 | Bacteria | 1634 |
| 129 | Ga0070663_100000009 | 3300005455 | Bacteria | 187718 |
| 130 | Ga0070663_100002493 | 3300005455 | Bacteria | 10384 |
| 131 | Ga0070678_100173468 | 3300005456 | Bacteria | 1758 |
| 132 | Ga0070706_100689778 | 3300005467 | Bacteria | 947 |
| 133 | Ga0070707_100000050 | 3300005468 | Bacteria | 102427 |
| 134 | Ga0070707_100013883 | 3300005468 | Bacteria | 7544 |
| 135 | Ga0068853_100005429 | 3300005539 | Bacteria | 9990 |
| 136 | Ga0068853_100044371 | 3300005539 | Bacteria | 3806 |
| 137 | Ga0068853_100047285 | 3300005539 | Bacteria | 3692 |
| 138 | Ga0068853_100080874 | 3300005539 | Bacteria | 2844 |
| 139 | Ga0068853_100169119 | 3300005539 | Bacteria | 1977 |
| 140 | Ga0068853_100243994 | 3300005539 | Bacteria | 1647 |
| 141 | Ga0070696_100003577 | 3300005546 | Bacteria | 10354 |
| 142 | Ga0070693_100003915 | 3300005547 | Bacteria | 6984 |
| 143 | Ga0070665_100000220 | 3300005548 | Bacteria | 95539 |
| 144 | Ga0068855_100048863 | 3300005563 | Bacteria | 4992 |
| 145 | Ga0068855_100256025 | 3300005563 | Bacteria | 1951 |
| 146 | Ga0068855_100266042 | 3300005563 | Bacteria | 1908 |
| 147 | Ga0068855_100337859 | 3300005563 | Bacteria | 1661 |
| 148 | Ga0068855_100391040 | 3300005563 | Bacteria | 1525 |
| 149 | Ga0070664_100000200 | 3300005564 | Bacteria | 42627 |
| 150 | Ga0068857_100000118 | 3300005577 | Bacteria | 47043 |
| 151 | Ga0068857_100000300 | 3300005577 | Bacteria | 34132 |
| 152 | Ga0068857_100033961 | 3300005577 | Bacteria | 4512 |
| 153 | Ga0068857_100240893 | 3300005577 | Bacteria | 1656 |
| 154 | Ga0068857_100258624 | 3300005577 | Bacteria | 1597 |
| 155 | Ga0068854_100000017 | 3300005578 | Bacteria | 142796 |
| 156 | Ga0068854_100002114 | 3300005578 | Bacteria | 12177 |
| 157 | Ga0068854_100026322 | 3300005578 | Bacteria | 3997 |
| 158 | Ga0068854_100036364 | 3300005578 | Bacteria | 3452 |
| 159 | Ga0068854_100086608 | 3300005578 | Bacteria | 2323 |
| 160 | Ga0068856_100000069 | 3300005614 | Bacteria | 95628 |
| 161 | Ga0068856_100008554 | 3300005614 | Bacteria | 9948 |
| 162 | Ga0068856_100057987 | 3300005614 | Bacteria | 3824 |
| 163 | Ga0068856_100125992 | 3300005614 | Bacteria | 2564 |
| 164 | Ga0068856_100130944 | 3300005614 | Bacteria | 2513 |
| 165 | Ga0068856_100164875 | 3300005614 | Bacteria | 2227 |
| 166 | Ga0068856_100232050 | 3300005614 | Bacteria | 1860 |
| 167 | Ga0068852_100010857 | 3300005616 | Bacteria | 6825 |
| 168 | Ga0068852_100019054 | 3300005616 | Bacteria | 5422 |
| 169 | Ga0068852_100055638 | 3300005616 | Bacteria | 3416 |
| 170 | Ga0068864_100020667 | 3300005618 | Bacteria | 5509 |
| 171 | Ga0068861_100316122 | 3300005719 | Bacteria | 1358 |
| 172 | Ga0068851_10009946 | 3300005834 | Bacteria | 4428 |
| 173 | Ga0068863_100326424 | 3300005841 | Bacteria | 1491 |
| 174 | Ga0068858_100082199 | 3300005842 | Bacteria | 2994 |
| 175 | Ga0068860_100176728 | 3300005843 | Bacteria | 2063 |
| 176 | Ga0068860_100365447 | 3300005843 | Bacteria | 1422 |
| 177 | Ga0081455_10003754 | 3300005937 | Bacteria | 17353 |
| 178 | Ga0075368_10056409 | 3300006042 | Bacteria | 1567 |
| 179 | Ga0075363_100009812 | 3300006048 | Bacteria | 4513 |
| 180 | Ga0075364_10010108 | 3300006051 | Bacteria | 5690 |
| 181 | Ga0075364_10016634 | 3300006051 | Bacteria | 4578 |
| 182 | Ga0075364_10077748 | 3300006051 | Bacteria | 2191 |
| 183 | Ga0075362_10005736 | 3300006177 | Bacteria | 4569 |
| 184 | Ga0075362_10052084 | 3300006177 | Bacteria | 1833 |
| 185 | Ga0075367_10086159 | 3300006178 | Bacteria | 1906 |
| 186 | Ga0075367_10236545 | 3300006178 | Bacteria | 1144 |
| 187 | Ga0075366_10031852 | 3300006195 | Bacteria | 3104 |
| 188 | Ga0075366_10159414 | 3300006195 | Bacteria | 1367 |
| 189 | Ga0075366_10244640 | 3300006195 | Bacteria | 1094 |
| 190 | Ga0097621_100111794 | 3300006237 | Bacteria | 2309 |
| 191 | Ga0075370_10000478 | 3300006353 | Bacteria | 15041 |
| 192 | Ga0075370_10001797 | 3300006353 | Bacteria | 9587 |
| 193 | Ga0075370_10002208 | 3300006353 | Bacteria | 8944 |
| 194 | Ga0075370_10061400 | 3300006353 | Bacteria | 2141 |
| 195 | Ga0075370_10089556 | 3300006353 | Bacteria | 1774 |
| 196 | Ga0075370_10100854 | 3300006353 | Bacteria | 1670 |
| 197 | Ga0075370_10118051 | 3300006353 | Bacteria | 1543 |
| 198 | Ga0075370_10181617 | 3300006353 | Bacteria | 1238 |
| 199 | Ga0075433_10033333 | 3300006852 | Bacteria | 4415 |
| 200 | Ga0075434_100380900 | 3300006871 | Unclassified | 1431 |
| 201 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 202 | Ga0099826_10123691 | 3300006948 | Bacteria | 1519 |
| 203 | Ga0099794_10041823 | 3300007265 | Bacteria | 2183 |
| 204 | Ga0105244_10002796 | 3300009036 | Bacteria | 12976 |
| 205 | Ga0105244_10014339 | 3300009036 | Bacteria | 4585 |
| 206 | Ga0105240_10001373 | 3300009093 | Bacteria | 41833 |
| 207 | Ga0105240_10007869 | 3300009093 | Bacteria | 15381 |
| 208 | Ga0105240_10015313 | 3300009093 | Bacteria | 10433 |
| 209 | Ga0105240_10101731 | 3300009093 | Bacteria | 3494 |
| 210 | Ga0105240_10185957 | 3300009093 | Bacteria | 2447 |
| 211 | Ga0105240_10236925 | 3300009093 | Bacteria | 2117 |
| 212 | Ga0105240_10491616 | 3300009093 | Bacteria | 1366 |
| 213 | Ga0105245_10054669 | 3300009098 | Bacteria | 3586 |
| 214 | Ga0105245_10080505 | 3300009098 | Bacteria | 2976 |
| 215 | Ga0105247_10059139 | 3300009101 | Bacteria | 2372 |
| 216 | Ga0114129_10034549 | 3300009147 | Bacteria | 7142 |
| 217 | Ga0114129_10450022 | 3300009147 | Unclassified | 1689 |
| 218 | Ga0105243_10001884 | 3300009148 | Bacteria | 17875 |
| 219 | Ga0105243_10080551 | 3300009148 | Bacteria | 2656 |
| 220 | Ga0105241_10092987 | 3300009174 | Bacteria | 2382 |
| 221 | Ga0105248_10383016 | 3300009177 | Bacteria | 1584 |
| 222 | Ga0105237_10000063 | 3300009545 | Bacteria | 141759 |
| 223 | Ga0105237_10002287 | 3300009545 | Bacteria | 23805 |
| 224 | Ga0105237_10008414 | 3300009545 | Bacteria | 11176 |
| 225 | Ga0105237_10257281 | 3300009545 | Bacteria | 1748 |
| 226 | Ga0105237_10302147 | 3300009545 | Bacteria | 1604 |
| 227 | Ga0105238_10003995 | 3300009551 | Bacteria | 14639 |
| 228 | Ga0105238_10009539 | 3300009551 | Bacteria | 9713 |
| 229 | Ga0105238_10154003 | 3300009551 | Bacteria | 2273 |
| 230 | Ga0105238_10283280 | 3300009551 | Bacteria | 1639 |
| 231 | Ga0105249_10031041 | 3300009553 | Bacteria | 4831 |
| 232 | Ga0105239_10001649 | 3300010375 | Bacteria | 29428 |
| 233 | Ga0105239_10089272 | 3300010375 | Bacteria | 3399 |
| 234 | Ga0105239_10091015 | 3300010375 | Bacteria | 3366 |
| 235 | Ga0105239_10186106 | 3300010375 | Bacteria | 2324 |
| 236 | Ga0105239_10228300 | 3300010375 | Bacteria | 2089 |
| 237 | Ga0105239_10309436 | 3300010375 | Bacteria | 1780 |
| 238 | Ga0105246_10043190 | 3300011119 | Bacteria | 3057 |
| 239 | Ga0105246_10044367 | 3300011119 | Bacteria | 3021 |
| 240 | Ga0105246_10235199 | 3300011119 | Bacteria | 1445 |
| 241 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 242 | Ga0157314_1000500 | 3300012500 | Bacteria | 3747 |
| 243 | Ga0157373_10021453 | 3300013100 | Bacteria | 4692 |
| 244 | Ga0157373_10036397 | 3300013100 | Bacteria | 3533 |
| 245 | Ga0157373_10167305 | 3300013100 | Bacteria | 1547 |
| 246 | Ga0157373_10486471 | 3300013100 | Bacteria | 891 |
| 247 | Ga0157371_10000033 | 3300013102 | Bacteria | 225328 |
| 248 | Ga0157370_10000010 | 3300013104 | Bacteria | 218199 |
| 249 | Ga0157370_10050072 | 3300013104 | Bacteria | 3995 |
| 250 | Ga0157370_10171700 | 3300013104 | Bacteria | 2015 |
| 251 | Ga0157370_10439286 | 3300013104 | Bacteria | 1200 |
| 252 | Ga0157369_10011384 | 3300013105 | Bacteria | 10101 |
| 253 | Ga0157369_10067951 | 3300013105 | Bacteria | 3830 |
| 254 | Ga0157369_10076620 | 3300013105 | Bacteria | 3585 |
| 255 | Ga0157374_10657418 | 3300013296 | Bacteria | 1060 |
| 256 | Ga0157372_10000176 | 3300013307 | Bacteria | 70656 |
| 257 | Ga0157372_10008352 | 3300013307 | Bacteria | 11008 |
| 258 | Ga0157372_10284402 | 3300013307 | Bacteria | 1923 |
| 259 | Ga0157372_10748345 | 3300013307 | Bacteria | 1136 |
| 260 | Ga0157372_10811878 | 3300013307 | Bacteria | 1086 |
| 261 | Ga0157375_10735423 | 3300013308 | Bacteria | 1139 |
| 262 | Ga0157380_10492263 | 3300014326 | Bacteria | 1189 |
| 263 | Ga0182008_10000920 | 3300014497 | Bacteria | 20488 |
| 264 | Ga0182008_10007295 | 3300014497 | Bacteria | 6114 |
| 265 | Ga0182008_10027139 | 3300014497 | Bacteria | 2903 |
| 266 | Ga0182008_10142036 | 3300014497 | Bacteria | 1201 |
| 267 | Ga0157379_10028052 | 3300014968 | Bacteria | 5011 |
| 268 | Ga0157376_10345446 | 3300014969 | Bacteria | 1422 |
| 269 | Ga0182006_1000019 | 3300015261 | Bacteria | 294192 |
| 270 | Ga0182006_1000198 | 3300015261 | Bacteria | 61642 |
| 271 | Ga0182006_1000675 | 3300015261 | Bacteria | 23953 |
| 272 | Ga0182006_1007099 | 3300015261 | Bacteria | 5155 |
| 273 | Ga0182006_1013260 | 3300015261 | Bacteria | 3580 |
| 274 | Ga0182006_1018614 | 3300015261 | Bacteria | 2932 |
| 275 | Ga0182006_1042845 | 3300015261 | Bacteria | 1771 |
| 276 | Ga0182006_1045281 | 3300015261 | Bacteria | 1713 |
| 277 | Ga0182007_10000671 | 3300015262 | Bacteria | 19659 |
| 278 | Ga0182007_10006301 | 3300015262 | Bacteria | 5103 |
| 279 | Ga0182007_10015627 | 3300015262 | Bacteria | 2825 |
| 280 | Ga0182007_10026923 | 3300015262 | Bacteria | 1988 |
| 281 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 282 | Ga0182005_1000902 | 3300015265 | Bacteria | 12991 |
| 283 | Ga0163161_10002721 | 3300017792 | Bacteria | 12561 |
| 284 | Ga0154015_1514660 | 3300020610 | Bacteria | 27088 |
| 285 | Ga0209435_100043 | 3300025206 | Bacteria | 102049 |
| 286 | Ga0209435_100050 | 3300025206 | Bacteria | 91356 |
| 287 | Ga0209435_100092 | 3300025206 | Bacteria | 40616 |
| 288 | Ga0209436_102805 | 3300025208 | Bacteria | 4958 |
| 289 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 290 | Ga0209784_100172 | 3300025224 | Bacteria | 55681 |
| 291 | Ga0209784_101451 | 3300025224 | Bacteria | 3135 |
| 292 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 293 | Ga0209566_100194 | 3300025225 | Bacteria | 63005 |
| 294 | Ga0209566_101022 | 3300025225 | Bacteria | 11775 |
| 295 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 296 | Ga0209674_100049 | 3300025226 | Bacteria | 346969 |
| 297 | Ga0209674_100114 | 3300025226 | Bacteria | 139197 |
| 298 | Ga0209674_100283 | 3300025226 | Bacteria | 37540 |
| 299 | Ga0209674_103302 | 3300025226 | Bacteria | 3020 |
| 300 | Ga0209672_100025 | 3300025228 | Bacteria | 350006 |
| 301 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 302 | Ga0209672_100100 | 3300025228 | Bacteria | 108785 |
| 303 | Ga0209672_100103 | 3300025228 | Bacteria | 104244 |
| 304 | Ga0209672_100260 | 3300025228 | Bacteria | 39122 |
| 305 | Ga0209672_105493 | 3300025228 | Bacteria | 2166 |
| 306 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 307 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 308 | Ga0209147_100032 | 3300025229 | Bacteria | 350006 |
| 309 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 310 | Ga0209563_100150 | 3300025230 | Bacteria | 65666 |
| 311 | Ga0209563_105627 | 3300025230 | Bacteria | 2243 |
| 312 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 313 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 314 | Ga0209258_100050 | 3300025242 | Bacteria | 350006 |
| 315 | Ga0209258_100124 | 3300025242 | Bacteria | 178883 |
| 316 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 317 | Ga0209258_100232 | 3300025242 | Bacteria | 104244 |
| 318 | Ga0209258_100401 | 3300025242 | Bacteria | 54149 |
| 319 | Ga0209258_100991 | 3300025242 | Bacteria | 13111 |
| 320 | Ga0207425_1000014 | 3300025245 | Bacteria | 481113 |
| 321 | Ga0207425_1000036 | 3300025245 | Bacteria | 225783 |
| 322 | Ga0207425_1000119 | 3300025245 | Bacteria | 74008 |
| 323 | Ga0207425_1000269 | 3300025245 | Bacteria | 38302 |
| 324 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 325 | Ga0209646_1000105 | 3300025246 | Bacteria | 163453 |
| 326 | Ga0209646_1000161 | 3300025246 | Bacteria | 91356 |
| 327 | Ga0209646_1000546 | 3300025246 | Bacteria | 16100 |
| 328 | Ga0209646_1015973 | 3300025246 | Bacteria | 1117 |
| 329 | Ga0209026_1000061 | 3300025250 | Bacteria | 219572 |
| 330 | Ga0209026_1000173 | 3300025250 | Bacteria | 98585 |
| 331 | Ga0209026_1000590 | 3300025250 | Bacteria | 23667 |
| 332 | Ga0209026_1001604 | 3300025250 | Bacteria | 9688 |
| 333 | Ga0209026_1002727 | 3300025250 | Bacteria | 6341 |
| 334 | Ga0209026_1003847 | 3300025250 | Bacteria | 4736 |
| 335 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 336 | Ga0209677_105461 | 3300025253 | Bacteria | 3311 |
| 337 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 338 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 339 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 340 | Ga0209148_1000060 | 3300025254 | Bacteria | 350006 |
| 341 | Ga0209148_1000206 | 3300025254 | Bacteria | 104244 |
| 342 | Ga0209148_1009855 | 3300025254 | Bacteria | 1838 |
| 343 | Ga0209759_1000041 | 3300025256 | Bacteria | 252893 |
| 344 | Ga0209759_1000169 | 3300025256 | Bacteria | 110110 |
| 345 | Ga0209759_1000426 | 3300025256 | Bacteria | 51309 |
| 346 | Ga0209759_1000865 | 3300025256 | Bacteria | 23443 |
| 347 | Ga0209759_1000893 | 3300025256 | Bacteria | 22416 |
| 348 | Ga0209759_1001528 | 3300025256 | Bacteria | 12710 |
| 349 | Ga0209759_1002160 | 3300025256 | Bacteria | 9020 |
| 350 | Ga0209759_1008283 | 3300025256 | Bacteria | 3254 |
| 351 | Ga0209759_1010122 | 3300025256 | Bacteria | 2787 |
| 352 | Ga0209129_1000017 | 3300025258 | Bacteria | 480935 |
| 353 | Ga0209129_1000538 | 3300025258 | Bacteria | 26434 |
| 354 | Ga0209129_1001239 | 3300025258 | Bacteria | 14649 |
| 355 | Ga0209129_1021217 | 3300025258 | Bacteria | 1195 |
| 356 | Ga0209233_1005033 | 3300025261 | Bacteria | 4431 |
| 357 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 358 | Ga0209565_1000025 | 3300025263 | Bacteria | 377969 |
| 359 | Ga0209565_1000741 | 3300025263 | Bacteria | 19347 |
| 360 | Ga0209565_1001718 | 3300025263 | Bacteria | 8987 |
| 361 | Ga0209565_1005817 | 3300025263 | Bacteria | 3539 |
| 362 | Ga0209565_1009678 | 3300025263 | Bacteria | 2429 |
| 363 | Ga0209565_1018473 | 3300025263 | Bacteria | 1507 |
| 364 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 365 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 366 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 367 | Ga0209455_1000055 | 3300025272 | Bacteria | 350006 |
| 368 | Ga0209455_1000111 | 3300025272 | Bacteria | 188820 |
| 369 | Ga0209455_1000114 | 3300025272 | Bacteria | 178883 |
| 370 | Ga0209455_1000179 | 3300025272 | Bacteria | 104244 |
| 371 | Ga0209455_1014013 | 3300025272 | Bacteria | 1833 |
| 372 | Ga0209673_1000149 | 3300025273 | Bacteria | 148659 |
| 373 | Ga0209673_1000221 | 3300025273 | Bacteria | 112739 |
| 374 | Ga0209673_1000986 | 3300025273 | Bacteria | 34808 |
| 375 | Ga0209673_1012476 | 3300025273 | Bacteria | 3420 |
| 376 | Ga0209130_1000379 | 3300025284 | Bacteria | 49962 |
| 377 | Ga0209130_1005218 | 3300025284 | Bacteria | 4592 |
| 378 | Ga0209130_1009348 | 3300025284 | Bacteria | 2803 |
| 379 | Ga0209675_1000017 | 3300025291 | Bacteria | 378002 |
| 380 | Ga0209675_1000061 | 3300025291 | Bacteria | 181096 |
| 381 | Ga0209675_1000856 | 3300025291 | Bacteria | 19729 |
| 382 | Ga0209675_1010031 | 3300025291 | Bacteria | 3277 |
| 383 | Ga0209675_1036130 | 3300025291 | Bacteria | 1121 |
| 384 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 385 | Ga0209676_1000437 | 3300025292 | Bacteria | 71544 |
| 386 | Ga0209676_1022664 | 3300025292 | Bacteria | 2075 |
| 387 | Ga0209025_1001820 | 3300025294 | Bacteria | 25104 |
| 388 | Ga0209025_1012575 | 3300025294 | Bacteria | 5412 |
| 389 | Ga0209025_1023855 | 3300025294 | Bacteria | 3180 |
| 390 | Ga0209025_1025801 | 3300025294 | Bacteria | 2976 |
| 391 | Ga0209025_1029526 | 3300025294 | Bacteria | 2650 |
| 392 | Ga0209564_1000299 | 3300025295 | Bacteria | 99740 |
| 393 | Ga0209564_1000934 | 3300025295 | Bacteria | 37894 |
| 394 | Ga0209564_1002212 | 3300025295 | Bacteria | 16212 |
| 395 | Ga0209564_1033912 | 3300025295 | Bacteria | 1507 |
| 396 | Ga0209758_1000038 | 3300025297 | Bacteria | 433771 |
| 397 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 398 | Ga0209758_1000221 | 3300025297 | Bacteria | 123812 |
| 399 | Ga0209758_1000483 | 3300025297 | Bacteria | 65467 |
| 400 | Ga0209758_1002033 | 3300025297 | Bacteria | 21722 |
| 401 | Ga0209758_1005840 | 3300025297 | Bacteria | 9191 |
| 402 | Ga0209758_1013005 | 3300025297 | Bacteria | 4590 |
| 403 | Ga0209758_1020327 | 3300025297 | Bacteria | 3147 |
| 404 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 405 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 406 | Ga0209050_1000089 | 3300025298 | Bacteria | 256212 |
| 407 | Ga0209050_1000723 | 3300025298 | Bacteria | 48329 |
| 408 | Ga0209050_1001052 | 3300025298 | Bacteria | 33980 |
| 409 | Ga0209050_1003969 | 3300025298 | Bacteria | 10435 |
| 410 | Ga0209050_1034769 | 3300025298 | Bacteria | 1501 |
| 411 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 412 | Ga0209256_1000138 | 3300025299 | Bacteria | 156076 |
| 413 | Ga0209256_1026782 | 3300025299 | Bacteria | 1654 |
| 414 | Ga0207426_1002343 | 3300025302 | Bacteria | 12374 |
| 415 | Ga0207426_1004319 | 3300025302 | Bacteria | 7003 |
| 416 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 417 | Ga0209051_1000312 | 3300025303 | Bacteria | 75251 |
| 418 | Ga0209051_1006484 | 3300025303 | Bacteria | 6583 |
| 419 | Ga0209051_1049583 | 3300025303 | Unclassified | 1413 |
| 420 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 421 | Ga0209257_1000053 | 3300025304 | Bacteria | 425160 |
| 422 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 423 | Ga0209257_1000504 | 3300025304 | Bacteria | 68999 |
| 424 | Ga0209257_1000669 | 3300025304 | Bacteria | 53655 |
| 425 | Ga0209257_1001206 | 3300025304 | Bacteria | 32484 |
| 426 | Ga0209257_1005453 | 3300025304 | Bacteria | 8928 |
| 427 | Ga0209257_1007376 | 3300025304 | Bacteria | 6660 |
| 428 | Ga0207656_10012230 | 3300025321 | Bacteria | 3260 |
| 429 | Ga0207655_1027498 | 3300025728 | Bacteria | 2708 |
| 430 | Ga0207655_1052667 | 3300025728 | Bacteria | 1635 |
| 431 | Ga0207710_10015889 | 3300025900 | Bacteria | 3184 |
| 432 | Ga0207680_10010971 | 3300025903 | Bacteria | 4557 |
| 433 | Ga0207647_10000504 | 3300025904 | Bacteria | 31238 |
| 434 | Ga0207647_10005351 | 3300025904 | Bacteria | 9430 |
| 435 | Ga0207647_10055928 | 3300025904 | Bacteria | 2423 |
| 436 | Ga0207647_10104630 | 3300025904 | Bacteria | 1677 |
| 437 | Ga0207654_10131677 | 3300025911 | Bacteria | 1584 |
| 438 | Ga0207695_10000372 | 3300025913 | Bacteria | 101840 |
| 439 | Ga0207695_10000664 | 3300025913 | Bacteria | 67787 |
| 440 | Ga0207695_10001246 | 3300025913 | Bacteria | 43517 |
| 441 | Ga0207695_10002167 | 3300025913 | Bacteria | 29675 |
| 442 | Ga0207695_10003529 | 3300025913 | Bacteria | 21909 |
| 443 | Ga0207695_10007941 | 3300025913 | Bacteria | 13392 |
| 444 | Ga0207695_10095287 | 3300025913 | Bacteria | 2981 |
| 445 | Ga0207695_10185980 | 3300025913 | Bacteria | 1996 |
| 446 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 447 | Ga0207671_10002068 | 3300025914 | Bacteria | 21960 |
| 448 | Ga0207671_10005943 | 3300025914 | Bacteria | 11059 |
| 449 | Ga0207671_10021681 | 3300025914 | Bacteria | 4869 |
| 450 | Ga0207671_10291441 | 3300025914 | Bacteria | 1288 |
| 451 | Ga0207671_10340845 | 3300025914 | Bacteria | 1188 |
| 452 | Ga0207662_10170889 | 3300025918 | Bacteria | 1394 |
| 453 | Ga0207657_10183638 | 3300025919 | Bacteria | 1690 |
| 454 | Ga0207657_10353105 | 3300025919 | Bacteria | 1159 |
| 455 | Ga0207649_10000191 | 3300025920 | Bacteria | 50371 |
| 456 | Ga0207649_10055829 | 3300025920 | Bacteria | 2464 |
| 457 | Ga0207649_10131067 | 3300025920 | Bacteria | 1703 |
| 458 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 459 | Ga0207694_10000364 | 3300025924 | Bacteria | 42625 |
| 460 | Ga0207694_10015720 | 3300025924 | Bacteria | 5709 |
| 461 | Ga0207694_10027336 | 3300025924 | Bacteria | 4344 |
| 462 | Ga0207694_10202457 | 3300025924 | Bacteria | 1615 |
| 463 | Ga0207687_10049240 | 3300025927 | Bacteria | 2929 |
| 464 | Ga0207664_10117273 | 3300025929 | Bacteria | 2223 |
| 465 | Ga0207690_10003114 | 3300025932 | Bacteria | 9991 |
| 466 | Ga0207706_10016628 | 3300025933 | Bacteria | 6640 |
| 467 | Ga0207689_10048662 | 3300025942 | Bacteria | 3498 |
| 468 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 469 | Ga0207679_10069409 | 3300025945 | Bacteria | 2652 |
| 470 | Ga0207667_10000198 | 3300025949 | Bacteria | 87446 |
| 471 | Ga0207667_10026299 | 3300025949 | Bacteria | 6360 |
| 472 | Ga0207667_10069528 | 3300025949 | Bacteria | 3664 |
| 473 | Ga0207712_10135148 | 3300025961 | Bacteria | 1884 |
| 474 | Ga0207640_10000138 | 3300025981 | Bacteria | 53518 |
| 475 | Ga0207640_10001942 | 3300025981 | Bacteria | 11133 |
| 476 | Ga0207640_10008907 | 3300025981 | Bacteria | 5593 |
| 477 | Ga0207640_10036039 | 3300025981 | Bacteria | 3102 |
| 478 | Ga0207640_10042659 | 3300025981 | Bacteria | 2894 |
| 479 | Ga0207658_10152568 | 3300025986 | Bacteria | 1884 |
| 480 | Ga0207658_10510285 | 3300025986 | Bacteria | 1072 |
| 481 | Ga0207703_10600380 | 3300026035 | Bacteria | 1041 |
| 482 | Ga0207639_10002600 | 3300026041 | Bacteria | 12121 |
| 483 | Ga0207639_10051425 | 3300026041 | Bacteria | 3134 |
| 484 | Ga0207639_10053382 | 3300026041 | Bacteria | 3084 |
| 485 | Ga0207639_10121679 | 3300026041 | Bacteria | 2145 |
| 486 | Ga0207678_10000015 | 3300026067 | Bacteria | 138937 |
| 487 | Ga0207678_10005311 | 3300026067 | Bacteria | 11535 |
| 488 | Ga0207702_10000308 | 3300026078 | Bacteria | 55913 |
| 489 | Ga0207702_10000864 | 3300026078 | Bacteria | 31591 |
| 490 | Ga0207702_10001120 | 3300026078 | Bacteria | 27360 |
| 491 | Ga0207702_10032104 | 3300026078 | Bacteria | 4381 |
| 492 | Ga0207702_10133825 | 3300026078 | Bacteria | 2234 |
| 493 | Ga0207702_10188207 | 3300026078 | Bacteria | 1905 |
| 494 | Ga0207641_10341276 | 3300026088 | Bacteria | 1425 |
| 495 | Ga0207674_10000623 | 3300026116 | Bacteria | 46466 |
| 496 | Ga0207674_10165891 | 3300026116 | Bacteria | 2163 |
| 497 | Ga0207674_10270670 | 3300026116 | Bacteria | 1646 |
| 498 | Ga0207674_10276291 | 3300026116 | Bacteria | 1628 |
| 499 | Ga0207674_10466978 | 3300026116 | Bacteria | 1220 |
| 500 | Ga0207698_10027182 | 3300026142 | Bacteria | 4059 |
| 501 | Ga0207698_10041658 | 3300026142 | Bacteria | 3424 |
| 502 | Ga0207698_10085970 | 3300026142 | Bacteria | 2556 |
| 503 | Ga0207698_10093021 | 3300026142 | Bacteria | 2474 |
| 504 | Ga0209281_1012323 | 3300027111 | Bacteria | 1881 |
| 505 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 506 | Ga0209371_1000067 | 3300027312 | Bacteria | 210294 |
| 507 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 508 | Ga0209282_1005617 | 3300027666 | Bacteria | 7718 |
| 509 | Ga0209588_1001412 | 3300027671 | Bacteria | 6261 |
| 510 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 511 | Ga0268265_10076637 | 3300028380 | Bacteria | 2623 |
| 512 | Ga0268264_10053834 | 3300028381 | Bacteria | 3359 |
| 513 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 514 | Ga0268256_1000078 | 3300030500 | Bacteria | 176504 |
| 515 | Ga0307511_10000082 | 3300030521 | Bacteria | 80315 |
| 516 | Ga0265332_10039573 | 3300031238 | Bacteria | 2042 |
| 517 | Ga0307513_10062358 | 3300031456 | Bacteria | 3941 |
| 518 | Ga0307513_10316342 | 3300031456 | Bacteria | 1321 |
| 519 | Ga0307408_100000127 | 3300031548 | Bacteria | 84326 |
| 520 | Ga0307408_100001493 | 3300031548 | Bacteria | 17356 |
| 521 | Ga0307408_100001544 | 3300031548 | Bacteria | 17060 |
| 522 | Ga0307408_100009312 | 3300031548 | Bacteria | 6474 |
| 523 | Ga0307408_100064846 | 3300031548 | Bacteria | 2677 |
| 524 | Ga0307408_100315282 | 3300031548 | Bacteria | 1315 |
| 525 | Ga0265314_10091991 | 3300031711 | Bacteria | 1973 |
| 526 | Ga0307405_10293315 | 3300031731 | Bacteria | 1230 |
| 527 | Ga0307406_10003366 | 3300031901 | Bacteria | 8712 |
| 528 | Ga0307412_10000376 | 3300031911 | Bacteria | 27824 |
| 529 | Ga0307411_10029693 | 3300032005 | Bacteria | 3342 |
| 530 | Ga0307411_10586479 | 3300032005 | Bacteria | 956 |
| 531 | Ga0307507_10200140 | 3300033179 | Bacteria | 1383 |
| 532 | Ga0373950_0003560 | 3300034818 | Bacteria | 2234 |
| 533 | Ga0373926_0004635 | 3300035083 | Bacteria | 4515 |
| 534 | Ga0373949_0010993 | 3300035090 | Unclassified | 1990 |
| 535 | Ga0373936_0005893 | 3300035113 | Bacteria | 4613 |
| 536 | Ga0373939_0002890 | 3300035114 | Bacteria | 4036 |
| 537 | Ga0373945_0002958 | 3300035116 | Bacteria | 5340 |
| 538 | Ga0373960_0003848 | 3300035121 | Bacteria | 3414 |
| 539 | Ga0373943_0000070 | 3300035170 | Bacteria | 36396 |
| 540 | Ga0373946_0006989 | 3300035171 | Bacteria | 4113 |
| 541 | Ga0373961_0016276 | 3300035241 | Bacteria | 1914 |
| 542 | Ga0373962_0018013 | 3300035242 | Bacteria | 1834 |
| 543 | Ga0373931_0000340 | 3300035691 | Bacteria | 19340 |
| 544 | Ga0373935_0016883 | 3300035692 | Bacteria | 4420 |
| 545 | Ga0373927_0020709 | 3300035695 | Bacteria | 4312 |
| 546 | Ga0373947_0001458 | 3300035725 | Bacteria | 14538 |
| 547 | Ga0373925_0004088 | 3300037068 | Bacteria | 11075 |
| 548 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 549 | Ga0395899_0000153 | 3300037312 | Bacteria | 105214 |
| 550 | Ga0395899_0000670 | 3300037312 | Bacteria | 34678 |
| 551 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 552 | Ga0395900_0000166 | 3300037418 | Bacteria | 107636 |
| 553 | Ga0395900_0000858 | 3300037418 | Bacteria | 40064 |
| 554 | Ga0395900_0107346 | 3300037418 | Bacteria | 2868 |
| 555 | Ga0395900_0258410 | 3300037418 | Bacteria | 1740 |
| 556 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 557 | Ga0395898_0000637 | 3300037466 | Bacteria | 64022 |
| 558 | Ga0395898_0024815 | 3300037466 | Bacteria | 6044 |
| 559 | Ga0395898_0031953 | 3300037466 | Bacteria | 5256 |
| 560 | Ga0395898_0083591 | 3300037466 | Bacteria | 3077 |
| 561 | Ga0395905_0000989 | 3300037471 | Bacteria | 36379 |
| 562 | Ga0395905_0001102 | 3300037471 | Bacteria | 33960 |
| 563 | Ga0395905_0056648 | 3300037471 | Bacteria | 3666 |
| 564 | Ga0395905_0077914 | 3300037471 | Bacteria | 3106 |
| 565 | Ga0395905_0235481 | 3300037471 | Bacteria | 1712 |
| 566 | Ga0395901_0001090 | 3300038443 | Bacteria | 28972 |
| 567 | Ga0395901_0043521 | 3300038443 | Bacteria | 4657 |
| 568 | Ga0436361_0133284 | 3300039447 | Bacteria | 12809 |
| 569 | Ga0439436_0032713 | 3300041404 | Bacteria | 1507 |
| 570 | Ga0439436_0056397 | 3300041404 | Bacteria | 1103 |
| 571 | Ga0439447_010813 | 3300041407 | Bacteria | 2693 |
| 572 | Ga0439461_0005688 | 3300041410 | Bacteria | 2139 |
| 573 | Ga0439466_0009691 | 3300041411 | Bacteria | 3595 |
| 574 | Ga0439442_032544 | 3300042002 | Bacteria | 1089 |
| 575 | Ga0439448_0104069 | 3300042005 | Bacteria | 966 |
| 576 | Ga0450923_010690 | 3300042125 | Bacteria | 1635 |
| 577 | Ga0450898_042412 | 3300042134 | Bacteria | 864 |
| 578 | Ga0450906_010839 | 3300042145 | Bacteria | 1714 |
| 579 | Ga0450907_010393 | 3300042146 | Bacteria | 1545 |
| 580 | Ga0439446_0000114 | 3300042156 | Bacteria | 13903 |
| 581 | Ga0450908_004385 | 3300042184 | Bacteria | 2721 |
| 582 | Ga0450909_007521 | 3300042185 | Bacteria | 1578 |
| 583 | Ga0439434_0015648 | 3300042435 | Bacteria | 2262 |
| 584 | Ga0450918_001884 | 3300042531 | Bacteria | 4058 |
| 585 | Ga0451577_0005033 | 3300042876 | Bacteria | 13666 |
| 586 | Ga0451577_0046868 | 3300042876 | Bacteria | 3865 |
| 587 | Ga0451577_0057843 | 3300042876 | Bacteria | 3455 |
| 588 | Ga0451577_0222431 | 3300042876 | Unclassified | 1706 |
| 589 | Ga0453683_0032497 | 3300044673 | Bacteria | 3293 |
| 590 | Ga0453683_0116617 | 3300044673 | Bacteria | 1680 |
| 591 | Ga0453683_0148117 | 3300044673 | Unclassified | 1482 |
| 592 | Ga0466965_0017603 | 3300044683 | Bacteria | 3418 |
| 593 | Ga0466963_0088412 | 3300044694 | Bacteria | 2108 |
| 594 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 595 | Ga0453684_0017510 | 3300044712 | Bacteria | 11094 |
| 596 | Ga0453684_0109875 | 3300044712 | Bacteria | 3352 |
| 597 | Ga0453684_0270615 | 3300044712 | Unclassified | 1942 |
| 598 | Ga0453684_0286578 | 3300044712 | Bacteria | 1876 |
| 599 | Ga0466968_0015964 | 3300044735 | Bacteria | 2984 |
| 600 | Ga0451576_0000787 | 3300045051 | Bacteria | 62334 |
| 601 | Ga0451576_0008247 | 3300045051 | Bacteria | 12251 |
| 602 | Ga0451576_0015427 | 3300045051 | Bacteria | 8464 |
| 603 | Ga0451576_0184896 | 3300045051 | Bacteria | 2176 |
| 604 | Ga0451576_0244417 | 3300045051 | Bacteria | 1875 |
| 605 | Ga0451576_0325938 | 3300045051 | Unclassified | 1607 |
| 606 | Ga0495617_013166 | 3300046452 | Bacteria | 2817 |
| 607 | Ga0495592_0009846 | 3300046454 | Bacteria | 7196 |
| 608 | Ga0495638_0003135 | 3300046460 | Bacteria | 13084 |
| 609 | Ga0495651_0002288 | 3300046462 | Bacteria | 14778 |
| 610 | Ga0495651_0093047 | 3300046462 | Bacteria | 2257 |
| 611 | Ga0495651_0143381 | 3300046462 | Bacteria | 1729 |
| 612 | Ga0495653_0003206 | 3300046463 | Bacteria | 13102 |
| 613 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 614 | Ga0495580_0020320 | 3300046472 | Bacteria | 4917 |
| 615 | Ga0495605_0008558 | 3300046474 | Bacteria | 5783 |
| 616 | Ga0495662_0018914 | 3300046476 | Bacteria | 3334 |
| 617 | Ga0495584_0000016 | 3300046491 | Bacteria | 156560 |
| 618 | Ga0495584_0043987 | 3300046491 | Bacteria | 2254 |
| 619 | Ga0495584_0092751 | 3300046491 | Bacteria | 1524 |
| 620 | Ga0495607_0000747 | 3300046501 | Bacteria | 31132 |
| 621 | Ga0495607_0018267 | 3300046501 | Bacteria | 4474 |
| 622 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 623 | Ga0495583_0000633 | 3300046506 | Bacteria | 46837 |
| 624 | Ga0495583_0000982 | 3300046506 | Bacteria | 32675 |
| 625 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 626 | Ga0495608_0006352 | 3300046511 | Bacteria | 8388 |
| 627 | Ga0495610_0002725 | 3300046512 | Bacteria | 14529 |
| 628 | Ga0495616_0013136 | 3300046513 | Bacteria | 4681 |
| 629 | Ga0495628_0101498 | 3300046516 | Bacteria | 2220 |
| 630 | Ga0495643_0000289 | 3300046522 | Bacteria | 71822 |
| 631 | Ga0495643_0172733 | 3300046522 | Bacteria | 1056 |
| 632 | Ga0495644_0004097 | 3300046523 | Bacteria | 5737 |
| 633 | Ga0495648_0000245 | 3300046524 | Bacteria | 61457 |
| 634 | Ga0495642_0113989 | 3300046528 | Bacteria | 1157 |
| 635 | Ga0495652_0078832 | 3300046529 | Bacteria | 2725 |
| 636 | Ga0495665_0013029 | 3300046531 | Bacteria | 4503 |
| 637 | Ga0495609_0000072 | 3300046538 | Bacteria | 125273 |
| 638 | Ga0495609_0000157 | 3300046538 | Bacteria | 70102 |
| 639 | Ga0495597_0024457 | 3300046542 | Bacteria | 2787 |
| 640 | Ga0495622_0032528 | 3300046557 | Bacteria | 2435 |
| 641 | Ga0495633_0012382 | 3300046558 | Bacteria | 4539 |
| 642 | Ga0495633_0015145 | 3300046558 | Bacteria | 4006 |
| 643 | Ga0495668_0073258 | 3300046616 | Bacteria | 1881 |
| 644 | Ga0495611_0009785 | 3300046648 | Bacteria | 4053 |
| 645 | Ga0495625_0007610 | 3300046660 | Bacteria | 9405 |
| 646 | Ga0495659_0000215 | 3300046664 | Bacteria | 24812 |
| 647 | Ga0495659_0073650 | 3300046664 | Bacteria | 1284 |
| 648 | Ga0495661_0020688 | 3300046665 | Bacteria | 4293 |
| 649 | Ga0495661_0070233 | 3300046665 | Bacteria | 2050 |
| 650 | Ga0495599_0015227 | 3300046678 | Bacteria | 4769 |
| 651 | Ga0495623_0034769 | 3300046679 | Bacteria | 3231 |
| 652 | Ga0495646_0136548 | 3300046680 | Bacteria | 1375 |
| 653 | Ga0495669_0013365 | 3300046684 | Bacteria | 3496 |
| 654 | Ga0495670_0017473 | 3300046691 | Bacteria | 3529 |
| 655 | Ga0495671_0008870 | 3300046692 | Bacteria | 5648 |
| 656 | Ga0495671_0018296 | 3300046692 | Bacteria | 3720 |
| 657 | Ga0495649_0011319 | 3300046694 | Bacteria | 5237 |
| 658 | Ga0495600_0083235 | 3300046809 | Bacteria | 2088 |
| 659 | Ga0495604_0053502 | 3300047317 | Bacteria | 3119 |
| 660 | Ga0495636_0000137 | 3300047318 | Bacteria | 29284 |
| 661 | Ga0495636_0000276 | 3300047318 | Bacteria | 20170 |
| 662 | Ga0495674_0081403 | 3300047319 | Bacteria | 2777 |
| 663 | Ga0495672_0000291 | 3300047320 | Bacteria | 69062 |
| 664 | Ga0495672_0028219 | 3300047320 | Bacteria | 3553 |
| 665 | Ga0495683_0001436 | 3300047323 | Bacteria | 15674 |
| 666 | Ga0495683_0099284 | 3300047323 | Bacteria | 1401 |
| 667 | Ga0495687_000156 | 3300047443 | Bacteria | 103711 |
| 668 | Ga0495687_001091 | 3300047443 | Bacteria | 26564 |
| 669 | Ga0495677_0028309 | 3300047445 | Bacteria | 2034 |
| 670 | Ga0495677_0044094 | 3300047445 | Bacteria | 1635 |
| 671 | Ga0495685_000022 | 3300047447 | Bacteria | 71800 |
| 672 | Ga0495673_0022746 | 3300047469 | Bacteria | 3066 |
| 673 | Ga0495684_0003295 | 3300047471 | Bacteria | 12680 |
| 674 | Ga0495602_0024840 | 3300048088 | Bacteria | 5808 |
| 675 | Ga0495602_0155730 | 3300048088 | Bacteria | 1789 |
| 676 | Ga0496101_0100597 | 3300048904 | Bacteria | 2163 |
| 677 | Ga0496104_0009028 | 3300048907 | Bacteria | 8864 |
| 678 | Ga0496107_0039327 | 3300048910 | Bacteria | 3393 |
| 679 | Ga0496113_0096118 | 3300048916 | Bacteria | 2290 |
| 680 | Ga0496116_0017933 | 3300048919 | Bacteria | 5474 |
| 681 | Ga0496116_0019335 | 3300048919 | Bacteria | 5216 |
| 682 | Ga0496116_0127284 | 3300048919 | Bacteria | 1460 |
| 683 | Ga0496117_0000996 | 3300048920 | Bacteria | 43337 |
| 684 | Ga0496117_0008586 | 3300048920 | Bacteria | 9682 |
| 685 | Ga0496117_0022877 | 3300048920 | Bacteria | 5004 |
| 686 | Ga0496117_0167036 | 3300048920 | Bacteria | 1282 |
| 687 | Ga0496118_0006657 | 3300048921 | Bacteria | 12608 |
| 688 | Ga0496118_0016297 | 3300048921 | Bacteria | 6823 |
| 689 | Ga0496118_0052096 | 3300048921 | Bacteria | 3125 |
| 690 | Ga0496118_0086174 | 3300048921 | Bacteria | 2183 |
| 691 | Ga0496118_0121881 | 3300048921 | Bacteria | 1697 |
| 692 | Ga0496119_0186176 | 3300048922 | Bacteria | 1085 |
| 693 | Ga0496121_0007798 | 3300048924 | Bacteria | 12818 |
| 694 | Ga0496121_0029198 | 3300048924 | Bacteria | 5109 |
| 695 | Ga0496124_0016240 | 3300048927 | Bacteria | 7092 |
| 696 | Ga0496125_0000338 | 3300048928 | Bacteria | 89749 |
| 697 | Ga0496125_0059624 | 3300048928 | Bacteria | 3074 |
| 698 | Ga0496125_0074716 | 3300048928 | Bacteria | 2627 |
| 699 | Ga0496125_0128172 | 3300048928 | Bacteria | 1793 |
| 700 | Ga0495678_001681 | 3300049459 | Bacteria | 16787 |
| 701 | Ga0495682_0002722 | 3300049460 | Bacteria | 8200 |
| 702 | Ga0495682_0026192 | 3300049460 | Bacteria | 2167 |
| 703 | Ga0501297_001698 | 3300049520 | Bacteria | 2057 |
| 704 | Ga0501300_005523 | 3300049523 | Bacteria | 1861 |
| 705 | Ga0501222_004083 | 3300049662 | Bacteria | 1980 |
| 706 | Ga0501222_004818 | 3300049662 | Bacteria | 1834 |
| 707 | Ga0501223_003578 | 3300049663 | Bacteria | 3362 |
| 708 | Ga0501223_005650 | 3300049663 | Bacteria | 2618 |
| 709 | Ga0501227_012221 | 3300049665 | Bacteria | 1878 |
| 710 | Ga0501233_010399 | 3300049668 | Bacteria | 1832 |
| 711 | Ga0501235_004673 | 3300049669 | Bacteria | 2961 |
| 712 | Ga0501255_004054 | 3300049684 | Bacteria | 1395 |
| 713 | Ga0501221_001071 | 3300049704 | Bacteria | 4496 |
| 714 | Ga0501229_000091 | 3300049706 | Bacteria | 9342 |
| 715 | Ga0501262_003913 | 3300049759 | Bacteria | 1717 |
| 716 | Ga0501266_000886 | 3300049763 | Bacteria | 3888 |
| 717 | Ga0501272_000534 | 3300049769 | Bacteria | 3372 |
| 718 | Ga0501279_001288 | 3300049775 | Bacteria | 3301 |
| 719 | Ga0501280_000143 | 3300049776 | Bacteria | 18608 |
| 720 | Ga0501282_001025 | 3300049778 | Bacteria | 3163 |
| 721 | Ga0501282_006400 | 3300049778 | Bacteria | 1259 |
| 722 | nmdc:mga03683_57378_c1 | 3300050489 | Bacteria | 1639 |
| 723 | nmdc:mga00v17_213122_c1 | 3300050491 | Bacteria | 1250 |
| 724 | nmdc:mga00v17_46933_c1 | 3300050491 | Bacteria | 2615 |
| 725 | nmdc:mga0k408_151128_c1 | 3300050493 | Bacteria | 1383 |
| 726 | nmdc:mga0k408_15379_c1 | 3300050493 | Bacteria | 4231 |
| 727 | nmdc:mga0k408_184593_c1 | 3300050493 | Bacteria | 1244 |
| 728 | nmdc:mga0k408_30100_c1 | 3300050493 | Bacteria | 3093 |
| 729 | nmdc:mga0k408_3828_c1 | 3300050493 | Bacteria | 7979 |
| 730 | nmdc:mga0k408_74831_c1 | 3300050493 | Bacteria | 1367 |
| 731 | nmdc:mga07m45_11798_c1 | 3300050496 | Bacteria | 4600 |
| 732 | nmdc:mga07m45_1908_c1 | 3300050496 | Bacteria | 9620 |
| 733 | nmdc:mga07m45_212851_c1 | 3300050496 | Bacteria | 1124 |
| 734 | nmdc:mga07m45_22004_c1 | 3300050496 | Bacteria | 3479 |
| 735 | nmdc:mga07m45_4672_c1 | 3300050496 | Bacteria | 6722 |
| 736 | nmdc:mga07m45_86078_c1 | 3300050496 | Bacteria | 1798 |
| 737 | nmdc:mga07m45_94519_c1 | 3300050496 | Bacteria | 1714 |
| 738 | nmdc:mga05p37_51053_c1 | 3300050507 | Bacteria | 5087 |
| 739 | nmdc:mga05p37_80836_c1 | 3300050507 | Bacteria | 4003 |
| 740 | nmdc:mga0n895_378600_c1 | 3300050512 | Unclassified | 1432 |
| 741 | nmdc:mga0a205_553231_c1 | 3300050515 | Unclassified | 1006 |
| 742 | Ga0500644_0001588 | 3300053088 | Bacteria | 5947 |
| 743 | Ga0500651_0011712 | 3300053093 | Bacteria | 5297 |
| 744 | Ga0500566_0106460 | 3300053094 | Bacteria | 1530 |
| 745 | Ga0500650_0020046 | 3300053098 | Bacteria | 2929 |
| 746 | Ga0500556_0195544 | 3300053104 | Bacteria | 799 |
| 747 | Ga0500593_000196 | 3300053117 | Bacteria | 24504 |
| 748 | Ga0500595_004466 | 3300053119 | Bacteria | 6270 |
| 749 | Ga0500658_0004895 | 3300053134 | Bacteria | 4993 |
| 750 | Ga0500619_006744 | 3300053154 | Bacteria | 2668 |
| 751 | Ga0500620_000108 | 3300053155 | Bacteria | 16359 |
| 752 | Ga0500634_0000067 | 3300053161 | Bacteria | 43218 |
| 753 | 2509368617 | 2509276018 | Bacteria | 6910194 |
| 754 | 2510252018 | 2510065045 | Bacteria | 7761063 |
| 755 | 2511244945 | 2511231002 | Bacteria | 5042903 |
| 756 | 2512932424 | 2512875016 | Bacteria | 6529530 |
| 757 | 2512960441 | 2512875024 | Bacteria | 7195110 |
| 758 | 2513230904 | 2513020051 | Bacteria | 6053213 |
| 759 | 2513912089 | 2513237144 | Bacteria | 7530820 |
| 760 | 2514590896 | 2513237351 | Bacteria | 6968952 |
| 761 | 2515692237 | 2515154123 | Bacteria | 6387382 |
| 762 | 2516024626 | 2515154189 | Bacteria | 9629850 |
| 763 | 2527078179 | 2526164713 | Bacteria | 6780608 |
| 764 | 2563056007 | 2562617112 | Bacteria | 10918404 |
| 765 | 2587760172 | 2585428062 | Bacteria | 6842168 |
| 766 | 2597811883 | 2597489875 | Bacteria | 7010078 |
| 767 | 2599446324 | 2599185178 | Bacteria | 5365746 |
| 768 | 2599745033 | 2599185240 | Bacteria | 7968121 |
| 769 | 2600206786 | 2599185355 | Bacteria | 7968906 |
| 770 | 2643786894 | 2643221554 | Bacteria | 6603920 |
| 771 | 2644160189 | 2643221628 | Bacteria | 5745828 |
| 772 | 2644244395 | 2643221644 | Bacteria | 6865017 |
| 773 | 2644329641 | 2643221658 | Bacteria | 6064537 |
| 774 | 2644398557 | 2643221672 | Bacteria | 6322190 |
| 775 | 2676743239 | 2675903129 | Bacteria | 7964495 |
| 776 | 2713472209 | 2711768613 | Bacteria | 11048459 |
| 777 | 2756671665 | 2756170246 | Bacteria | 7451806 |
| 778 | 2774388028 | 2773857761 | Bacteria | 3837365 |
| 779 | 2792834467 | 2791355137 | Bacteria | 9654227 |
| 780 | 2809130814 | 2808606415 | Bacteria | 4576710 |
| 781 | 2809150851 | 2808606419 | Bacteria | 4576925 |
| 782 | 2812366748 | 2811994881 | Bacteria | 6298475 |
| 783 | 2819540944 | 2818991436 | Bacteria | 5376622 |
| 784 | 2841736759 | 2841734538 | Bacteria | 6784580 |
| 785 | 2844008418 | 2844002411 | Bacteria | 7168230 |
| 786 | 2844010685 | 2844009547 | Bacteria | 6728125 |
| 787 | 2852622372 | 2852618963 | Bacteria | 4577824 |
| 788 | 2854602087 | 2854601825 | Bacteria | 4797592 |
| 789 | 2856355948 | 2856349417 | Bacteria | 6230045 |
| 790 | 2856364264 | 2856356410 | Bacteria | 6297484 |
| 791 | 2856368154 | 2856364286 | Bacteria | 6939991 |
| 792 | 2869176953 | 2869169390 | Bacteria | 6659796 |
| 793 | 2869240227 | 2869234852 | Bacteria | 6654993 |
| 794 | 2869242771 | 2869242130 | Bacteria | 6609239 |
| 795 | 2869254671 | 2869249662 | Bacteria | 6868783 |
| 796 | 2869263195 | 2869256925 | Bacteria | 6981691 |
| 797 | 2869265225 | 2869264136 | Bacteria | 6880765 |
| 798 | 2869290227 | 2869285874 | Bacteria | 6901219 |
| 799 | 2871432511 | 2871429161 | Bacteria | 6547891 |
| 800 | 2871442963 | 2871435913 | Bacteria | 6880295 |
| 801 | 2871453692 | 2871451962 | Bacteria | 7336357 |
| 802 | 2871466228 | 2871459585 | Bacteria | 6866887 |
| 803 | 2871478237 | 2871474448 | Bacteria | 6806570 |
| 804 | 2871485209 | 2871481445 | Bacteria | 6700002 |
| 805 | 2871493117 | 2871488783 | Bacteria | 6929816 |
| 806 | 2874109573 | 2874109183 | Bacteria | 6517025 |
| 807 | 2874118128 | 2874116593 | Bacteria | 6674494 |
| 808 | 2874126382 | 2874123672 | Bacteria | 7238285 |
| 809 | 2874134887 | 2874131515 | Bacteria | 6820270 |
| 810 | 2874152478 | 2874146452 | Bacteria | 7533118 |
| 811 | 2874159878 | 2874155637 | Bacteria | 6724144 |
| 812 | 2874223974 | 2874220319 | Bacteria | 4594709 |
| 813 | 2876389843 | 2876386047 | Bacteria | 6698674 |
| 814 | 2876418394 | 2876413966 | Bacteria | 6831344 |
| 815 | 2878735856 | 2878730984 | Bacteria | 6380721 |
| 816 | 2878750125 | 2878745973 | Bacteria | 6867388 |
| 817 | 2878757162 | 2878753008 | Bacteria | 6922523 |
| 818 | 2878784206 | 2878781027 | Bacteria | 6834456 |
| 819 | 2881157993 | 2881155292 | Bacteria | 6461656 |
| 820 | 2881848546 | 2881845957 | Bacteria | 6611900 |
| 821 | 2881867698 | 2881861095 | Bacteria | 7128710 |
| 822 | 2882915352 | 2882912400 | Bacteria | 6801539 |
| 823 | 2885311367 | 2885305155 | Bacteria | 7348390 |
| 824 | 2885316408 | 2885312484 | Bacteria | 6415165 |
| 825 | 2885332892 | 2885326080 | Bacteria | 7134805 |
| 826 | 2888344742 | 2888343758 | Bacteria | 6611049 |
| 827 | 2889012980 | 2889010040 | Bacteria | 6749192 |
| 828 | 2889795089 | 2889790730 | Bacteria | 5689708 |
| 829 | 2889918184 | 2889914905 | Bacteria | 5702301 |
| 830 | 2900581743 | 2900577576 | Bacteria | 5438534 |
| 831 | 2903497814 | 2903492973 | Bacteria | 13473544 |
| 832 | 2903500889 | 2903492973 | Bacteria | 13473544 |
| 833 | 2903520455 | 2903513507 | Bacteria | 6344008 |
| 834 | 2904616653 | 2904615490 | Bacteria | 10047340 |
| 835 | 2906312483 | 2906308376 | Bacteria | 6841989 |
| 836 | 2906325192 | 2906321335 | Bacteria | 6579571 |
| 837 | 2906370532 | 2906363423 | Bacteria | 6856682 |
| 838 | 2906375097 | 2906370794 | Bacteria | 6881062 |
| 839 | 2906395456 | 2906393657 | Bacteria | 6790866 |
| 840 | 2906406269 | 2906401398 | Bacteria | 6693206 |
| 841 | 2906430594 | 2906427513 | Bacteria | 6375796 |
| 842 | 2919090083 | 2919089067 | Bacteria | 4560942 |
| 843 | 2919182584 | 2919182534 | Bacteria | 3907101 |
| 844 | 2919454086 | 2919450847 | Bacteria | 5631160 |
| 845 | 2919479517 | 2919476304 | Bacteria | 5888696 |
| 846 | 2919498258 | 2919497567 | Bacteria | 4408621 |
| 847 | 2921654770 | 2921643360 | Bacteria | 11448031 |
| 848 | 2922132618 | 2922130491 | Bacteria | 7173936 |
| 849 | 2922158163 | 2922151315 | Bacteria | 6902399 |
| 850 | 2923520782 | 2923519811 | Bacteria | 6298479 |
| 851 | 2924741686 | 2924741084 | Bacteria | 6661321 |
| 852 | 2924760645 | 2924754689 | Bacteria | 6774424 |
| 853 | 2928059468 | 2928058823 | Bacteria | 5520022 |
| 854 | 2928069609 | 2928064002 | Bacteria | 7419480 |
| 855 | 2928498052 | 2928496128 | Bacteria | 4631123 |
| 856 | 2937819372 | 2937813078 | Bacteria | 7783518 |
| 857 | 2937828198 | 2937822353 | Bacteria | 7290551 |
| 858 | 2937839190 | 2937836603 | Bacteria | 6811263 |
| 859 | 2937847901 | 2937843397 | Bacteria | 5256375 |
| 860 | 2937864669 | 2937861824 | Bacteria | 6660327 |
| 861 | 2937871290 | 2937868953 | Bacteria | 6639878 |
| 862 | 2958044555 | 2958041894 | Bacteria | 13082850 |
| 863 | 2958069129 | 2958064165 | Bacteria | 7158582 |
| 864 | 2958073027 | 2958071322 | Bacteria | 6815895 |
| 865 | 2958092815 | 2958092219 | Bacteria | 6861151 |
| 866 | 2958114623 | 2958108152 | Bacteria | 6681128 |
| 867 | 2958126100 | 2958122699 | Bacteria | 7280457 |
| 868 | 2958134615 | 2958130278 | Bacteria | 6897202 |
| 869 | 2958143241 | 2958137437 | Bacteria | 6050276 |
| 870 | 2958164871 | 2958158011 | Bacteria | 6058449 |
| 871 | 2958181096 | 2958179912 | Bacteria | 6874908 |
| 872 | 2961050738 | 2961047084 | Bacteria | 4594415 |
| 873 | 2961078932 | 2961077736 | Bacteria | 7079850 |
| 874 | 2961139120 | 2961136820 | Bacteria | 6775228 |
| 875 | 2961175509 | 2961170736 | Bacteria | 7072258 |
| 876 | 2961185689 | 2961183825 | Bacteria | 6688536 |
| 877 | 2965030090 | 2965025482 | Bacteria | 6532201 |
| 878 | 2965034436 | 2965032056 | Bacteria | 6887443 |
| 879 | 2965042940 | 2965040258 | Bacteria | 6855979 |
| 880 | 2965053411 | 2965047637 | Bacteria | 6623551 |
| 881 | 2965092526 | 2965089291 | Bacteria | 6866420 |
| 882 | 2965107146 | 2965102966 | Bacteria | 6800987 |
| 883 | 2965116418 | 2965110997 | Bacteria | 6693150 |
| 884 | 2967999489 | 2967996073 | Bacteria | 6787468 |
| 885 | 2968007847 | 2968003550 | Bacteria | 6929263 |
| 886 | 2968142356 | 2968138860 | Bacteria | 6605449 |
| 887 | 2970492479 | 2970489779 | Bacteria | 6517260 |
| 888 | 2970508097 | 2970503327 | Bacteria | 7099517 |
| 889 | 2970518040 | 2970510686 | Bacteria | 7006402 |
| 890 | 2970526474 | 2970524798 | Bacteria | 6840927 |
| 891 | 2970536366 | 2970532167 | Bacteria | 6553173 |
| 892 | 2970540597 | 2970540015 | Bacteria | 6977556 |
| 893 | 2970550209 | 2970547951 | Bacteria | 6931819 |
| 894 | 2970621166 | 2970619444 | Bacteria | 6986144 |
| 895 | 2970628347 | 2970627176 | Bacteria | 6680862 |
| 896 | 2974322216 | 2974320154 | Bacteria | 4571377 |
| 897 | 2977826321 | 2977821940 | Bacteria | 6906439 |
| 898 | 2977832198 | 2977828996 | Bacteria | 7007971 |
| 899 | 2977848271 | 2977843712 | Bacteria | 6753583 |
| 900 | 2977856038 | 2977851361 | Bacteria | 6694324 |
| 901 | 2977873449 | 2977872689 | Bacteria | 7270173 |
| 902 | 2977904044 | 2977898635 | Bacteria | 6675551 |
| 903 | 2977913130 | 2977907340 | Bacteria | 6577984 |
| 904 | 2977920812 | 2977915119 | Bacteria | 6829656 |
| 905 | 2977938272 | 2977935797 | Bacteria | 6252826 |
| 906 | 2977950746 | 2977950692 | Bacteria | 6893264 |
| 907 | 2977961403 | 2977957713 | Bacteria | 6877875 |
| 908 | 2979767908 | 2979764755 | Bacteria | 6610066 |
| 909 | 2979777015 | 2979772303 | Bacteria | 6618277 |
| 910 | 2979798857 | 2979793036 | Bacteria | 6808957 |
| 911 | 2979813281 | 2979808191 | Bacteria | 7179355 |
| 912 | 2987645556 | 2987645492 | Bacteria | 6117018 |
| 913 | 2987658657 | 2987652177 | Bacteria | 6969023 |
| 914 | 2987679394 | 2987673487 | Bacteria | 6884027 |
| 915 | 2996390474 | 2996386984 | Bacteria | 6978667 |
| 916 | 3000140031 | 3000135777 | Bacteria | 6891109 |
| 917 | 3004197914 | 3004195979 | Bacteria | 6776956 |
| 918 | 3004239349 | 3004232784 | Bacteria | 6662140 |
| 919 | 3004242497 | 3004239961 | Bacteria | 6892290 |
| 920 | 3004253408 | 3004248173 | Bacteria | 6563236 |
| 921 | 3004269305 | 3004268573 | Bacteria | 7043476 |
| 922 | 3004335571 | 3004334049 | Bacteria | 8449246 |
| 923 | 642418605 | 641736154 | Bacteria | 7689995 |
| 924 | 642595320 | 642555112 | Bacteria | 8676562 |
| 925 | 649870440 | 649633066 | Bacteria | 6690028 |
| 926 | 8004303096 | 8004300914 | Bacteria | 6132239 |
| 927 | 8004316201 | 8004312739 | Bacteria | 7444653 |
| 928 | 8004364799 | 8004361976 | Bacteria | 6858373 |
| 929 | 8004378737 | 8004374579 | Bacteria | 6898112 |
| 930 | 8004392433 | 8004387939 | Bacteria | 7049250 |
| 931 | 8004633272 | 8004633249 | Bacteria | 6723080 |
| 932 | 8004696082 | 8004695233 | Bacteria | 6731676 |
| 933 | 8004718742 | 8004714634 | Bacteria | 6776161 |
| 934 | 8004729012 | 8004727605 | Bacteria | 6643904 |
| 935 | 8020941353 | 8020938398 | Bacteria | 7472757 |
| 936 | 8020956690 | 8020953355 | Bacteria | 7439080 |
| 937 | 8055271088 | 8055266321 | Bacteria | 7999742 |
| 938 | 8055306920 | 8055301274 | Bacteria | 8587385 |
| 939 | Ga0105238_10012593 | |||
| 940 | JGI24740J21852_10000061 | |||
| 941 | JGI24740J21852_10000399 | |||
| 942 | JGI24740J21852_10002819 | |||
| 943 | JGI24739J22299_10000076 | |||
| 944 | JGI24739J22299_10002903 | |||
| 945 | JGI24739J22299_10003435 | |||
| 946 | JGI24739J22299_10020345 | |||
| 947 | JGI24737J22298_10000304 | |||
| 948 | JGI24735J21928_10000201 | |||
| 949 | JGI24735J21928_10000454 | |||
| 950 | JGI24735J21928_10014636 | |||
| 951 | JGI25155J39150_1000039 | |||
| 952 | JGI25156J39149_1000096 | |||
| 953 | JGI25156J39149_1009783 | |||
| 954 | JGI25156J39149_1011488 | |||
| 955 | JGI25154J39366_1000077 | |||
| 956 | JGI25154J39366_1000148 | |||
| 957 | JGI25154J39366_1000725 | |||
| 958 | JGI25154J39366_1004071 | |||
| 959 | JGI25154J39366_1010875 | |||
| 960 | JGI25158J39367_1001215 | |||
| 961 | JGI25157J39369_1000065 | |||
| 962 | JGI25157J39369_1000573 | |||
| 963 | JGI25157J39369_1001461 | |||
| 964 | JGI25152J39213_1000003 | |||
| 965 | JGI25150J39212_1000035 | |||
| 966 | JGI25150J39212_1000446 | |||
| 967 | JGI25150J39212_1003091 | |||
| 968 | JGI25150J39212_1010085 | |||
| 969 | JGI25150J39212_1016234 | |||
| 970 | JGI25159J45721_1001030 | |||
| 971 | JGI25151J46595_10003534 | |||
| 972 | JGI25153J46596_10000046 | |||
| 973 | JGI25153J46596_10010646 | |||
| 974 | JGI25153J46596_10022613 | |||
| 975 | rootH1_10178903 | |||
| 976 | rootH1_10183483 | |||
| 977 | JGI25160J50197_1034153 | |||
| 978 | Ga0006562J51391_1055123 | |||
| 979 | Ga0006562J51391_1055124 | |||
| 980 | Ga0055538_1003839 | |||
| 981 | Ga0055539_1000059 | |||
| 982 | Ga0055539_1000692 | |||
| 983 | Ga0055533_1000664 | |||
| 984 | Ga0055533_1000803 | |||
| 985 | Ga0055532_1000005 | |||
| 986 | Ga0055532_1000025 | |||
| 987 | Ga0055532_1001236 | |||
| 988 | Ga0055525_1000207 | |||
| 989 | Ga0055525_1000447 | |||
| 990 | Ga0055527_1000108 | |||
| 991 | Ga0055527_1000336 | |||
| 992 | Ga0055527_1000901 | |||
| 993 | Ga0055527_1003809 | |||
| 994 | Ga0055535_1000019 | |||
| 995 | Ga0055535_1000080 | |||
| 996 | Ga0055535_1000712 | |||
| 997 | Ga0055535_1000899 | |||
| 998 | Ga0055535_1002175 | |||
| 999 | Ga0055535_1002380 | |||
| 1000 | Ga0055535_1012321 | |||
| 1001 | Ga0055542_1000577 | |||
| 1002 | Ga0055542_1000764 | |||
| 1003 | Ga0055542_1000773 | |||
| 1004 | Ga0055542_1000898 | |||
| 1005 | Ga0055542_1002053 | |||
| 1006 | Ga0055529_1000035 | |||
| 1007 | Ga0055529_1000064 | |||
| 1008 | Ga0055529_1000172 | |||
| 1009 | Ga0055529_1000613 | |||
| 1010 | Ga0055529_1000665 | |||
| 1011 | Ga0055529_1000686 | |||
| 1012 | Ga0055526_1000089 | |||
| 1013 | Ga0055526_1001925 | |||
| 1014 | Ga0055537_1000046 | |||
| 1015 | Ga0055537_1000064 | |||
| 1016 | Ga0055537_1004523 | |||
| 1017 | Ga0055537_1015409 | |||
| 1018 | Ga0055524_1000012 | |||
| 1019 | Ga0055524_1002020 | |||
| 1020 | Ga0055524_1008763 | |||
| 1021 | Ga0055524_1035429 | |||
| 1022 | Ga0055536_1003378 | |||
| 1023 | Ga0055536_1005290 | |||
| 1024 | Ga0055534_1000094 | |||
| 1025 | Ga0055534_1000446 | |||
| 1026 | Ga0055534_1007964 | |||
| 1027 | Ga0055528_1000142 | |||
| 1028 | Ga0055528_1000250 | |||
| 1029 | Ga0055528_1001134 | |||
| 1030 | Ga0055528_1015750 | |||
| 1031 | Ga0055528_1024132 | |||
| 1032 | Ga0055530_10000015 | |||
| 1033 | Ga0055530_10002108 | |||
| 1034 | Ga0055530_10003589 | |||
| 1035 | Ga0055530_10004951 | |||
| 1036 | Ga0055530_10004954 | |||
| 1037 | Ga0055540_1000039 | |||
| 1038 | Ga0055540_1001343 | |||
| 1039 | Ga0055531_10001229 | |||
| 1040 | Ga0055531_10002703 | |||
| 1041 | Ga0055531_10003176 | |||
| 1042 | Ga0055531_10016754 | |||
| 1043 | Ga0055531_10025689 | |||
| 1044 | Ga0055531_10028559 | |||
| 1045 | Ga0055541_1001078 | |||
| 1046 | Ga0055541_1005811 | |||
| 1047 | Ga0055541_1007353 | |||
| 1048 | Ga0058692_1000035 | |||
| 1049 | Ga0065165_1019916 | |||
| 1050 | Ga0065165_1052000 | |||
| 1051 | Ga0065704_10004493 | |||
| 1052 | Ga0065707_10236624 | |||
| 1053 | Ga0070658_10099137 | |||
| 1054 | Ga0070690_100063390 | |||
| 1055 | Ga0070682_100092374 | |||
| 1056 | Ga0070660_100180758 | |||
| 1057 | Ga0070660_100244152 | |||
| 1058 | Ga0070661_100000192 | |||
| 1059 | Ga0070661_100289858 | |||
| 1060 | Ga0070661_100335551 | |||
| 1061 | Ga0070673_100527205 | |||
| 1062 | Ga0070659_100016932 | |||
| 1063 | Ga0070667_100281583 | |||
| 1064 | Ga0070714_100007578 | |||
| 1065 | Ga0070713_100047670 | |||
| 1066 | Ga0070708_100259188 | |||
| 1067 | Ga0070663_100000009 | |||
| 1068 | Ga0070663_100002493 | |||
| 1069 | Ga0070678_100173468 | |||
| 1070 | Ga0070706_100689778 | |||
| 1071 | Ga0070707_100000050 | |||
| 1072 | Ga0070707_100013883 | |||
| 1073 | Ga0068853_100005429 | |||
| 1074 | Ga0068853_100044371 | |||
| 1075 | Ga0068853_100047285 | |||
| 1076 | Ga0068853_100080874 | |||
| 1077 | Ga0068853_100169119 | |||
| 1078 | Ga0068853_100243994 | |||
| 1079 | Ga0070696_100003577 | |||
| 1080 | Ga0070693_100003915 | |||
| 1081 | Ga0070665_100000220 | |||
| 1082 | Ga0068855_100048863 | |||
| 1083 | Ga0068855_100256025 | |||
| 1084 | Ga0068855_100266042 | |||
| 1085 | Ga0068855_100337859 | |||
| 1086 | Ga0068855_100391040 | |||
| 1087 | Ga0070664_100000200 | |||
| 1088 | Ga0068857_100000118 | |||
| 1089 | Ga0068857_100000300 | |||
| 1090 | Ga0068857_100033961 | |||
| 1091 | Ga0068857_100240893 | |||
| 1092 | Ga0068857_100258624 | |||
| 1093 | Ga0068854_100000017 | |||
| 1094 | Ga0068854_100002114 | |||
| 1095 | Ga0068854_100026322 | |||
| 1096 | Ga0068854_100036364 | |||
| 1097 | Ga0068854_100086608 | |||
| 1098 | Ga0068856_100000069 | |||
| 1099 | Ga0068856_100008554 | |||
| 1100 | Ga0068856_100057987 | |||
| 1101 | Ga0068856_100125992 | |||
| 1102 | Ga0068856_100130944 | |||
| 1103 | Ga0068856_100164875 | |||
| 1104 | Ga0068856_100232050 | |||
| 1105 | Ga0068852_100010857 | |||
| 1106 | Ga0068852_100019054 | |||
| 1107 | Ga0068852_100055638 | |||
| 1108 | Ga0068864_100020667 | |||
| 1109 | Ga0068861_100316122 | |||
| 1110 | Ga0068851_10009946 | |||
| 1111 | Ga0068863_100326424 | |||
| 1112 | Ga0068858_100082199 | |||
| 1113 | Ga0068860_100176728 | |||
| 1114 | Ga0068860_100365447 | |||
| 1115 | Ga0081455_10003754 | |||
| 1116 | Ga0075368_10056409 | |||
| 1117 | Ga0075363_100009812 | |||
| 1118 | Ga0075364_10010108 | |||
| 1119 | Ga0075364_10016634 | |||
| 1120 | Ga0075364_10077748 | |||
| 1121 | Ga0075362_10005736 | |||
| 1122 | Ga0075362_10052084 | |||
| 1123 | Ga0075367_10086159 | |||
| 1124 | Ga0075367_10236545 | |||
| 1125 | Ga0075366_10031852 | |||
| 1126 | Ga0075366_10159414 | |||
| 1127 | Ga0075366_10244640 | |||
| 1128 | Ga0097621_100111794 | |||
| 1129 | Ga0075370_10000478 | |||
| 1130 | Ga0075370_10001797 | |||
| 1131 | Ga0075370_10002208 | |||
| 1132 | Ga0075370_10061400 | |||
| 1133 | Ga0075370_10089556 | |||
| 1134 | Ga0075370_10100854 | |||
| 1135 | Ga0075370_10118051 | |||
| 1136 | Ga0075370_10181617 | |||
| 1137 | Ga0075433_10033333 | |||
| 1138 | Ga0075434_100380900 | |||
| 1139 | Ga0099826_10000002 | |||
| 1140 | Ga0099826_10123691 | |||
| 1141 | Ga0099794_10041823 | |||
| 1142 | Ga0105244_10002796 | |||
| 1143 | Ga0105244_10014339 | |||
| 1144 | Ga0105240_10001373 | |||
| 1145 | Ga0105240_10007869 | |||
| 1146 | Ga0105240_10015313 | |||
| 1147 | Ga0105240_10101731 | |||
| 1148 | Ga0105240_10185957 | |||
| 1149 | Ga0105240_10236925 | |||
| 1150 | Ga0105240_10491616 | |||
| 1151 | Ga0105245_10054669 | |||
| 1152 | Ga0105245_10080505 | |||
| 1153 | Ga0105247_10059139 | |||
| 1154 | Ga0114129_10034549 | |||
| 1155 | Ga0114129_10450022 | |||
| 1156 | Ga0105243_10001884 | |||
| 1157 | Ga0105243_10080551 | |||
| 1158 | Ga0105241_10092987 | |||
| 1159 | Ga0105248_10383016 | |||
| 1160 | Ga0105237_10000063 | |||
| 1161 | Ga0105237_10002287 | |||
| 1162 | Ga0105237_10008414 | |||
| 1163 | Ga0105237_10257281 | |||
| 1164 | Ga0105237_10302147 | |||
| 1165 | Ga0105238_10003995 | |||
| 1166 | Ga0105238_10009539 | |||
| 1167 | Ga0105238_10154003 | |||
| 1168 | Ga0105238_10283280 | |||
| 1169 | Ga0105249_10031041 | |||
| 1170 | Ga0105239_10001649 | |||
| 1171 | Ga0105239_10089272 | |||
| 1172 | Ga0105239_10091015 | |||
| 1173 | Ga0105239_10186106 | |||
| 1174 | Ga0105239_10228300 | |||
| 1175 | Ga0105239_10309436 | |||
| 1176 | Ga0105246_10043190 | |||
| 1177 | Ga0105246_10044367 | |||
| 1178 | Ga0105246_10235199 | |||
| 1179 | Ga0157319_1000008 | |||
| 1180 | Ga0157314_1000500 | |||
| 1181 | Ga0157373_10021453 | |||
| 1182 | Ga0157373_10036397 | |||
| 1183 | Ga0157373_10167305 | |||
| 1184 | Ga0157373_10486471 | |||
| 1185 | Ga0157371_10000033 | |||
| 1186 | Ga0157370_10000010 | |||
| 1187 | Ga0157370_10050072 | |||
| 1188 | Ga0157370_10171700 | |||
| 1189 | Ga0157370_10439286 | |||
| 1190 | Ga0157369_10011384 | |||
| 1191 | Ga0157369_10067951 | |||
| 1192 | Ga0157369_10076620 | |||
| 1193 | Ga0157374_10657418 | |||
| 1194 | Ga0157372_10000176 | |||
| 1195 | Ga0157372_10008352 | |||
| 1196 | Ga0157372_10284402 | |||
| 1197 | Ga0157372_10748345 | |||
| 1198 | Ga0157372_10811878 | |||
| 1199 | Ga0157375_10735423 | |||
| 1200 | Ga0157380_10492263 | |||
| 1201 | Ga0182008_10000920 | |||
| 1202 | Ga0182008_10007295 | |||
| 1203 | Ga0182008_10027139 | |||
| 1204 | Ga0182008_10142036 | |||
| 1205 | Ga0157379_10028052 | |||
| 1206 | Ga0157376_10345446 | |||
| 1207 | Ga0182006_1000019 | |||
| 1208 | Ga0182006_1000198 | |||
| 1209 | Ga0182006_1000675 | |||
| 1210 | Ga0182006_1007099 | |||
| 1211 | Ga0182006_1013260 | |||
| 1212 | Ga0182006_1018614 | |||
| 1213 | Ga0182006_1042845 | |||
| 1214 | Ga0182006_1045281 | |||
| 1215 | Ga0182007_10000671 | |||
| 1216 | Ga0182007_10006301 | |||
| 1217 | Ga0182007_10015627 | |||
| 1218 | Ga0182007_10026923 | |||
| 1219 | Ga0182005_1000005 | |||
| 1220 | Ga0182005_1000902 | |||
| 1221 | Ga0163161_10002721 | |||
| 1222 | Ga0154015_1514660 | |||
| 1223 | Ga0209435_100043 | |||
| 1224 | Ga0209435_100050 | |||
| 1225 | Ga0209435_100092 | |||
| 1226 | Ga0209436_102805 | |||
| 1227 | Ga0209784_100008 | |||
| 1228 | Ga0209784_100172 | |||
| 1229 | Ga0209784_101451 | |||
| 1230 | Ga0209566_100006 | |||
| 1231 | Ga0209566_100194 | |||
| 1232 | Ga0209566_101022 | |||
| 1233 | Ga0209674_100045 | |||
| 1234 | Ga0209674_100049 | |||
| 1235 | Ga0209674_100114 | |||
| 1236 | Ga0209674_100283 | |||
| 1237 | Ga0209674_103302 | |||
| 1238 | Ga0209672_100025 | |||
| 1239 | Ga0209672_100058 | |||
| 1240 | Ga0209672_100100 | |||
| 1241 | Ga0209672_100103 | |||
| 1242 | Ga0209672_100260 | |||
| 1243 | Ga0209672_105493 | |||
| 1244 | Ga0209147_100005 | |||
| 1245 | Ga0209147_100011 | |||
| 1246 | Ga0209147_100032 | |||
| 1247 | Ga0209563_100016 | |||
| 1248 | Ga0209563_100150 | |||
| 1249 | Ga0209563_105627 | |||
| 1250 | Ga0209258_100007 | |||
| 1251 | Ga0209258_100024 | |||
| 1252 | Ga0209258_100050 | |||
| 1253 | Ga0209258_100124 | |||
| 1254 | Ga0209258_100164 | |||
| 1255 | Ga0209258_100232 | |||
| 1256 | Ga0209258_100401 | |||
| 1257 | Ga0209258_100991 | |||
| 1258 | Ga0207425_1000014 | |||
| 1259 | Ga0207425_1000036 | |||
| 1260 | Ga0207425_1000119 | |||
| 1261 | Ga0207425_1000269 | |||
| 1262 | Ga0209646_1000027 | |||
| 1263 | Ga0209646_1000105 | |||
| 1264 | Ga0209646_1000161 | |||
| 1265 | Ga0209646_1000546 | |||
| 1266 | Ga0209646_1015973 | |||
| 1267 | Ga0209026_1000061 | |||
| 1268 | Ga0209026_1000173 | |||
| 1269 | Ga0209026_1000590 | |||
| 1270 | Ga0209026_1001604 | |||
| 1271 | Ga0209026_1002727 | |||
| 1272 | Ga0209026_1003847 | |||
| 1273 | Ga0209677_100008 | |||
| 1274 | Ga0209677_105461 | |||
| 1275 | Ga0209148_1000009 | |||
| 1276 | Ga0209148_1000019 | |||
| 1277 | Ga0209148_1000039 | |||
| 1278 | Ga0209148_1000060 | |||
| 1279 | Ga0209148_1000206 | |||
| 1280 | Ga0209148_1009855 | |||
| 1281 | Ga0209759_1000041 | |||
| 1282 | Ga0209759_1000169 | |||
| 1283 | Ga0209759_1000426 | |||
| 1284 | Ga0209759_1000865 | |||
| 1285 | Ga0209759_1000893 | |||
| 1286 | Ga0209759_1001528 | |||
| 1287 | Ga0209759_1002160 | |||
| 1288 | Ga0209759_1008283 | |||
| 1289 | Ga0209759_1010122 | |||
| 1290 | Ga0209129_1000017 | |||
| 1291 | Ga0209129_1000538 | |||
| 1292 | Ga0209129_1001239 | |||
| 1293 | Ga0209129_1021217 | |||
| 1294 | Ga0209233_1005033 | |||
| 1295 | Ga0209565_1000004 | |||
| 1296 | Ga0209565_1000025 | |||
| 1297 | Ga0209565_1000741 | |||
| 1298 | Ga0209565_1001718 | |||
| 1299 | Ga0209565_1005817 | |||
| 1300 | Ga0209565_1009678 | |||
| 1301 | Ga0209565_1018473 | |||
| 1302 | Ga0209455_1000011 | |||
| 1303 | Ga0209455_1000029 | |||
| 1304 | Ga0209455_1000034 | |||
| 1305 | Ga0209455_1000055 | |||
| 1306 | Ga0209455_1000111 | |||
| 1307 | Ga0209455_1000114 | |||
| 1308 | Ga0209455_1000179 | |||
| 1309 | Ga0209455_1014013 | |||
| 1310 | Ga0209673_1000149 | |||
| 1311 | Ga0209673_1000221 | |||
| 1312 | Ga0209673_1000986 | |||
| 1313 | Ga0209673_1012476 | |||
| 1314 | Ga0209130_1000379 | |||
| 1315 | Ga0209130_1005218 | |||
| 1316 | Ga0209130_1009348 | |||
| 1317 | Ga0209675_1000017 | |||
| 1318 | Ga0209675_1000061 | |||
| 1319 | Ga0209675_1000856 | |||
| 1320 | Ga0209675_1010031 | |||
| 1321 | Ga0209675_1036130 | |||
| 1322 | Ga0209676_1000007 | |||
| 1323 | Ga0209676_1000437 | |||
| 1324 | Ga0209676_1022664 | |||
| 1325 | Ga0209025_1001820 | |||
| 1326 | Ga0209025_1012575 | |||
| 1327 | Ga0209025_1023855 | |||
| 1328 | Ga0209025_1025801 | |||
| 1329 | Ga0209025_1029526 | |||
| 1330 | Ga0209564_1000299 | |||
| 1331 | Ga0209564_1000934 | |||
| 1332 | Ga0209564_1002212 | |||
| 1333 | Ga0209564_1033912 | |||
| 1334 | Ga0209758_1000038 | |||
| 1335 | Ga0209758_1000124 | |||
| 1336 | Ga0209758_1000221 | |||
| 1337 | Ga0209758_1000483 | |||
| 1338 | Ga0209758_1002033 | |||
| 1339 | Ga0209758_1005840 | |||
| 1340 | Ga0209758_1013005 | |||
| 1341 | Ga0209758_1020327 | |||
| 1342 | Ga0209050_1000003 | |||
| 1343 | Ga0209050_1000040 | |||
| 1344 | Ga0209050_1000089 | |||
| 1345 | Ga0209050_1000723 | |||
| 1346 | Ga0209050_1001052 | |||
| 1347 | Ga0209050_1003969 | |||
| 1348 | Ga0209050_1034769 | |||
| 1349 | Ga0209256_1000001 | |||
| 1350 | Ga0209256_1000138 | |||
| 1351 | Ga0209256_1026782 | |||
| 1352 | Ga0207426_1002343 | |||
| 1353 | Ga0207426_1004319 | |||
| 1354 | Ga0209051_1000003 | |||
| 1355 | Ga0209051_1000312 | |||
| 1356 | Ga0209051_1006484 | |||
| 1357 | Ga0209051_1049583 | |||
| 1358 | Ga0209257_1000018 | |||
| 1359 | Ga0209257_1000053 | |||
| 1360 | Ga0209257_1000054 | |||
| 1361 | Ga0209257_1000504 | |||
| 1362 | Ga0209257_1000669 | |||
| 1363 | Ga0209257_1001206 | |||
| 1364 | Ga0209257_1005453 | |||
| 1365 | Ga0209257_1007376 | |||
| 1366 | Ga0207656_10012230 | |||
| 1367 | Ga0207655_1027498 | |||
| 1368 | Ga0207655_1052667 | |||
| 1369 | Ga0207710_10015889 | |||
| 1370 | Ga0207680_10010971 | |||
| 1371 | Ga0207647_10000504 | |||
| 1372 | Ga0207647_10005351 | |||
| 1373 | Ga0207647_10055928 | |||
| 1374 | Ga0207647_10104630 | |||
| 1375 | Ga0207654_10131677 | |||
| 1376 | Ga0207695_10000372 | |||
| 1377 | Ga0207695_10000664 | |||
| 1378 | Ga0207695_10001246 | |||
| 1379 | Ga0207695_10002167 | |||
| 1380 | Ga0207695_10003529 | |||
| 1381 | Ga0207695_10007941 | |||
| 1382 | Ga0207695_10095287 | |||
| 1383 | Ga0207695_10185980 | |||
| 1384 | Ga0207671_10000021 | |||
| 1385 | Ga0207671_10002068 | |||
| 1386 | Ga0207671_10005943 | |||
| 1387 | Ga0207671_10021681 | |||
| 1388 | Ga0207671_10291441 | |||
| 1389 | Ga0207671_10340845 | |||
| 1390 | Ga0207662_10170889 | |||
| 1391 | Ga0207657_10183638 | |||
| 1392 | Ga0207657_10353105 | |||
| 1393 | Ga0207649_10000191 | |||
| 1394 | Ga0207649_10055829 | |||
| 1395 | Ga0207649_10131067 | |||
| 1396 | Ga0207646_10000037 | |||
| 1397 | Ga0207694_10000364 | |||
| 1398 | Ga0207694_10015720 | |||
| 1399 | Ga0207694_10027336 | |||
| 1400 | Ga0207694_10202457 | |||
| 1401 | Ga0207687_10049240 | |||
| 1402 | Ga0207664_10117273 | |||
| 1403 | Ga0207690_10003114 | |||
| 1404 | Ga0207706_10016628 | |||
| 1405 | Ga0207689_10048662 | |||
| 1406 | Ga0207679_10000002 | |||
| 1407 | Ga0207679_10069409 | |||
| 1408 | Ga0207667_10000198 | |||
| 1409 | Ga0207667_10026299 | |||
| 1410 | Ga0207667_10069528 | |||
| 1411 | Ga0207712_10135148 | |||
| 1412 | Ga0207640_10000138 | |||
| 1413 | Ga0207640_10001942 | |||
| 1414 | Ga0207640_10008907 | |||
| 1415 | Ga0207640_10036039 | |||
| 1416 | Ga0207640_10042659 | |||
| 1417 | Ga0207658_10152568 | |||
| 1418 | Ga0207658_10510285 | |||
| 1419 | Ga0207703_10600380 | |||
| 1420 | Ga0207639_10002600 | |||
| 1421 | Ga0207639_10051425 | |||
| 1422 | Ga0207639_10053382 | |||
| 1423 | Ga0207639_10121679 | |||
| 1424 | Ga0207678_10000015 | |||
| 1425 | Ga0207678_10005311 | |||
| 1426 | Ga0207702_10000308 | |||
| 1427 | Ga0207702_10000864 | |||
| 1428 | Ga0207702_10001120 | |||
| 1429 | Ga0207702_10032104 | |||
| 1430 | Ga0207702_10133825 | |||
| 1431 | Ga0207702_10188207 | |||
| 1432 | Ga0207641_10341276 | |||
| 1433 | Ga0207674_10000623 | |||
| 1434 | Ga0207674_10165891 | |||
| 1435 | Ga0207674_10270670 | |||
| 1436 | Ga0207674_10276291 | |||
| 1437 | Ga0207674_10466978 | |||
| 1438 | Ga0207698_10027182 | |||
| 1439 | Ga0207698_10041658 | |||
| 1440 | Ga0207698_10085970 | |||
| 1441 | Ga0207698_10093021 | |||
| 1442 | Ga0209281_1012323 | |||
| 1443 | Ga0209371_1000043 | |||
| 1444 | Ga0209371_1000067 | |||
| 1445 | Ga0209282_1000001 | |||
| 1446 | Ga0209282_1005617 | |||
| 1447 | Ga0209588_1001412 | |||
| 1448 | Ga0268266_10000008 | |||
| 1449 | Ga0268265_10076637 | |||
| 1450 | Ga0268264_10053834 | |||
| 1451 | Ga0268256_1000044 | |||
| 1452 | Ga0268256_1000078 | |||
| 1453 | Ga0307511_10000082 | |||
| 1454 | Ga0265332_10039573 | |||
| 1455 | Ga0307513_10062358 | |||
| 1456 | Ga0307513_10316342 | |||
| 1457 | Ga0307408_100000127 | |||
| 1458 | Ga0307408_100001493 | |||
| 1459 | Ga0307408_100001544 | |||
| 1460 | Ga0307408_100009312 | |||
| 1461 | Ga0307408_100064846 | |||
| 1462 | Ga0307408_100315282 | |||
| 1463 | Ga0265314_10091991 | |||
| 1464 | Ga0307405_10293315 | |||
| 1465 | Ga0307406_10003366 | |||
| 1466 | Ga0307412_10000376 | |||
| 1467 | Ga0307411_10029693 | |||
| 1468 | Ga0307411_10586479 | |||
| 1469 | Ga0307507_10200140 | |||
| 1470 | Ga0373950_0003560 | |||
| 1471 | Ga0373926_0004635 | |||
| 1472 | Ga0373949_0010993 | |||
| 1473 | Ga0373936_0005893 | |||
| 1474 | Ga0373939_0002890 | |||
| 1475 | Ga0373945_0002958 | |||
| 1476 | Ga0373960_0003848 | |||
| 1477 | Ga0373943_0000070 | |||
| 1478 | Ga0373946_0006989 | |||
| 1479 | Ga0373961_0016276 | |||
| 1480 | Ga0373962_0018013 | |||
| 1481 | Ga0373931_0000340 | |||
| 1482 | Ga0373935_0016883 | |||
| 1483 | Ga0373927_0020709 | |||
| 1484 | Ga0373947_0001458 | |||
| 1485 | Ga0373925_0004088 | |||
| 1486 | Ga0395899_0000023 | |||
| 1487 | Ga0395899_0000153 | |||
| 1488 | Ga0395899_0000670 | |||
| 1489 | Ga0395900_0000019 | |||
| 1490 | Ga0395900_0000166 | |||
| 1491 | Ga0395900_0000858 | |||
| 1492 | Ga0395900_0107346 | |||
| 1493 | Ga0395900_0258410 | |||
| 1494 | Ga0395898_0000016 | |||
| 1495 | Ga0395898_0000637 | |||
| 1496 | Ga0395898_0024815 | |||
| 1497 | Ga0395898_0031953 | |||
| 1498 | Ga0395898_0083591 | |||
| 1499 | Ga0395905_0000989 | |||
| 1500 | Ga0395905_0001102 | |||
| 1501 | Ga0395905_0056648 | |||
| 1502 | Ga0395905_0077914 | |||
| 1503 | Ga0395905_0235481 | |||
| 1504 | Ga0395901_0001090 | |||
| 1505 | Ga0395901_0043521 | |||
| 1506 | Ga0436361_0133284 | |||
| 1507 | Ga0439436_0032713 | |||
| 1508 | Ga0439436_0056397 | |||
| 1509 | Ga0439447_010813 | |||
| 1510 | Ga0439461_0005688 | |||
| 1511 | Ga0439466_0009691 | |||
| 1512 | Ga0439442_032544 | |||
| 1513 | Ga0439448_0104069 | |||
| 1514 | Ga0450923_010690 | |||
| 1515 | Ga0450898_042412 | |||
| 1516 | Ga0450906_010839 | |||
| 1517 | Ga0450907_010393 | |||
| 1518 | Ga0439446_0000114 | |||
| 1519 | Ga0450908_004385 | |||
| 1520 | Ga0450909_007521 | |||
| 1521 | Ga0439434_0015648 | |||
| 1522 | Ga0450918_001884 | |||
| 1523 | Ga0451577_0005033 | |||
| 1524 | Ga0451577_0046868 | |||
| 1525 | Ga0451577_0057843 | |||
| 1526 | Ga0451577_0222431 | |||
| 1527 | Ga0453683_0032497 | |||
| 1528 | Ga0453683_0116617 | |||
| 1529 | Ga0453683_0148117 | |||
| 1530 | Ga0466965_0017603 | |||
| 1531 | Ga0466963_0088412 | |||
| 1532 | Ga0453684_0000014 | |||
| 1533 | Ga0453684_0017510 | |||
| 1534 | Ga0453684_0109875 | |||
| 1535 | Ga0453684_0270615 | |||
| 1536 | Ga0453684_0286578 | |||
| 1537 | Ga0466968_0015964 | |||
| 1538 | Ga0451576_0000787 | |||
| 1539 | Ga0451576_0008247 | |||
| 1540 | Ga0451576_0015427 | |||
| 1541 | Ga0451576_0184896 | |||
| 1542 | Ga0451576_0244417 | |||
| 1543 | Ga0451576_0325938 | |||
| 1544 | Ga0495617_013166 | |||
| 1545 | Ga0495592_0009846 | |||
| 1546 | Ga0495638_0003135 | |||
| 1547 | Ga0495651_0002288 | |||
| 1548 | Ga0495651_0093047 | |||
| 1549 | Ga0495651_0143381 | |||
| 1550 | Ga0495653_0003206 | |||
| 1551 | Ga0495650_0000226 | |||
| 1552 | Ga0495580_0020320 | |||
| 1553 | Ga0495605_0008558 | |||
| 1554 | Ga0495662_0018914 | |||
| 1555 | Ga0495584_0000016 | |||
| 1556 | Ga0495584_0043987 | |||
| 1557 | Ga0495584_0092751 | |||
| 1558 | Ga0495607_0000747 | |||
| 1559 | Ga0495607_0018267 | |||
| 1560 | Ga0495583_0000045 | |||
| 1561 | Ga0495583_0000633 | |||
| 1562 | Ga0495583_0000982 | |||
| 1563 | Ga0495606_0000066 | |||
| 1564 | Ga0495608_0006352 | |||
| 1565 | Ga0495610_0002725 | |||
| 1566 | Ga0495616_0013136 | |||
| 1567 | Ga0495628_0101498 | |||
| 1568 | Ga0495643_0000289 | |||
| 1569 | Ga0495643_0172733 | |||
| 1570 | Ga0495644_0004097 | |||
| 1571 | Ga0495648_0000245 | |||
| 1572 | Ga0495642_0113989 | |||
| 1573 | Ga0495652_0078832 | |||
| 1574 | Ga0495665_0013029 | |||
| 1575 | Ga0495609_0000072 | |||
| 1576 | Ga0495609_0000157 | |||
| 1577 | Ga0495597_0024457 | |||
| 1578 | Ga0495622_0032528 | |||
| 1579 | Ga0495633_0012382 | |||
| 1580 | Ga0495633_0015145 | |||
| 1581 | Ga0495668_0073258 | |||
| 1582 | Ga0495611_0009785 | |||
| 1583 | Ga0495625_0007610 | |||
| 1584 | Ga0495659_0000215 | |||
| 1585 | Ga0495659_0073650 | |||
| 1586 | Ga0495661_0020688 | |||
| 1587 | Ga0495661_0070233 | |||
| 1588 | Ga0495599_0015227 | |||
| 1589 | Ga0495623_0034769 | |||
| 1590 | Ga0495646_0136548 | |||
| 1591 | Ga0495669_0013365 | |||
| 1592 | Ga0495670_0017473 | |||
| 1593 | Ga0495671_0008870 | |||
| 1594 | Ga0495671_0018296 | |||
| 1595 | Ga0495649_0011319 | |||
| 1596 | Ga0495600_0083235 | |||
| 1597 | Ga0495604_0053502 | |||
| 1598 | Ga0495636_0000137 | |||
| 1599 | Ga0495636_0000276 | |||
| 1600 | Ga0495674_0081403 | |||
| 1601 | Ga0495672_0000291 | |||
| 1602 | Ga0495672_0028219 | |||
| 1603 | Ga0495683_0001436 | |||
| 1604 | Ga0495683_0099284 | |||
| 1605 | Ga0495687_000156 | |||
| 1606 | Ga0495687_001091 | |||
| 1607 | Ga0495677_0028309 | |||
| 1608 | Ga0495677_0044094 | |||
| 1609 | Ga0495685_000022 | |||
| 1610 | Ga0495673_0022746 | |||
| 1611 | Ga0495684_0003295 | |||
| 1612 | Ga0495602_0024840 | |||
| 1613 | Ga0495602_0155730 | |||
| 1614 | Ga0496101_0100597 | |||
| 1615 | Ga0496104_0009028 | |||
| 1616 | Ga0496107_0039327 | |||
| 1617 | Ga0496113_0096118 | |||
| 1618 | Ga0496116_0017933 | |||
| 1619 | Ga0496116_0019335 | |||
| 1620 | Ga0496116_0127284 | |||
| 1621 | Ga0496117_0000996 | |||
| 1622 | Ga0496117_0008586 | |||
| 1623 | Ga0496117_0022877 | |||
| 1624 | Ga0496117_0167036 | |||
| 1625 | Ga0496118_0006657 | |||
| 1626 | Ga0496118_0016297 | |||
| 1627 | Ga0496118_0052096 | |||
| 1628 | Ga0496118_0086174 | |||
| 1629 | Ga0496118_0121881 | |||
| 1630 | Ga0496119_0186176 | |||
| 1631 | Ga0496121_0007798 | |||
| 1632 | Ga0496121_0029198 | |||
| 1633 | Ga0496124_0016240 | |||
| 1634 | Ga0496125_0000338 | |||
| 1635 | Ga0496125_0059624 | |||
| 1636 | Ga0496125_0074716 | |||
| 1637 | Ga0496125_0128172 | |||
| 1638 | Ga0495678_001681 | |||
| 1639 | Ga0495682_0002722 | |||
| 1640 | Ga0495682_0026192 | |||
| 1641 | Ga0501297_001698 | |||
| 1642 | Ga0501300_005523 | |||
| 1643 | Ga0501222_004083 | |||
| 1644 | Ga0501222_004818 | |||
| 1645 | Ga0501223_003578 | |||
| 1646 | Ga0501223_005650 | |||
| 1647 | Ga0501227_012221 | |||
| 1648 | Ga0501233_010399 | |||
| 1649 | Ga0501235_004673 | |||
| 1650 | Ga0501255_004054 | |||
| 1651 | Ga0501221_001071 | |||
| 1652 | Ga0501229_000091 | |||
| 1653 | Ga0501262_003913 | |||
| 1654 | Ga0501266_000886 | |||
| 1655 | Ga0501272_000534 | |||
| 1656 | Ga0501279_001288 | |||
| 1657 | Ga0501280_000143 | |||
| 1658 | Ga0501282_001025 | |||
| 1659 | Ga0501282_006400 | |||
| 1660 | nmdc:mga03683_57378_c1 | |||
| 1661 | nmdc:mga00v17_213122_c1 | |||
| 1662 | nmdc:mga00v17_46933_c1 | |||
| 1663 | nmdc:mga0k408_151128_c1 | |||
| 1664 | nmdc:mga0k408_15379_c1 | |||
| 1665 | nmdc:mga0k408_184593_c1 | |||
| 1666 | nmdc:mga0k408_30100_c1 | |||
| 1667 | nmdc:mga0k408_3828_c1 | |||
| 1668 | nmdc:mga0k408_74831_c1 | |||
| 1669 | nmdc:mga07m45_11798_c1 | |||
| 1670 | nmdc:mga07m45_1908_c1 | |||
| 1671 | nmdc:mga07m45_212851_c1 | |||
| 1672 | nmdc:mga07m45_22004_c1 | |||
| 1673 | nmdc:mga07m45_4672_c1 | |||
| 1674 | nmdc:mga07m45_86078_c1 | |||
| 1675 | nmdc:mga07m45_94519_c1 | |||
| 1676 | nmdc:mga05p37_51053_c1 | |||
| 1677 | nmdc:mga05p37_80836_c1 | |||
| 1678 | nmdc:mga0n895_378600_c1 | |||
| 1679 | nmdc:mga0a205_553231_c1 | |||
| 1680 | Ga0500644_0001588 | |||
| 1681 | Ga0500651_0011712 | |||
| 1682 | Ga0500566_0106460 | |||
| 1683 | Ga0500650_0020046 | |||
| 1684 | Ga0500556_0195544 | |||
| 1685 | Ga0500593_000196 | |||
| 1686 | Ga0500595_004466 | |||
| 1687 | Ga0500658_0004895 | |||
| 1688 | Ga0500619_006744 | |||
| 1689 | Ga0500620_000108 | |||
| 1690 | Ga0500634_0000067 | |||
| 1691 | 2509368617 | |||
| 1692 | 2510252018 | |||
| 1693 | 2511244945 | |||
| 1694 | 2512932424 | |||
| 1695 | 2512960441 | |||
| 1696 | 2513230904 | |||
| 1697 | 2513912089 | |||
| 1698 | 2514590896 | |||
| 1699 | 2515692237 | |||
| 1700 | 2516024626 | |||
| 1701 | 2527078179 | |||
| 1702 | 2563056007 | |||
| 1703 | 2587760172 | |||
| 1704 | 2597811883 | |||
| 1705 | 2599446324 | |||
| 1706 | 2599745033 | |||
| 1707 | 2600206786 | |||
| 1708 | 2643786894 | |||
| 1709 | 2644160189 | |||
| 1710 | 2644244395 | |||
| 1711 | 2644329641 | |||
| 1712 | 2644398557 | |||
| 1713 | 2676743239 | |||
| 1714 | 2713472209 | |||
| 1715 | 2756671665 | |||
| 1716 | 2774388028 | |||
| 1717 | 2792834467 | |||
| 1718 | 2809130814 | |||
| 1719 | 2809150851 | |||
| 1720 | 2812366748 | |||
| 1721 | 2819540944 | |||
| 1722 | 2841736759 | |||
| 1723 | 2844008418 | |||
| 1724 | 2844010685 | |||
| 1725 | 2852622372 | |||
| 1726 | 2854602087 | |||
| 1727 | 2856355948 | |||
| 1728 | 2856364264 | |||
| 1729 | 2856368154 | |||
| 1730 | 2869176953 | |||
| 1731 | 2869240227 | |||
| 1732 | 2869242771 | |||
| 1733 | 2869254671 | |||
| 1734 | 2869263195 | |||
| 1735 | 2869265225 | |||
| 1736 | 2869290227 | |||
| 1737 | 2871432511 | |||
| 1738 | 2871442963 | |||
| 1739 | 2871453692 | |||
| 1740 | 2871466228 | |||
| 1741 | 2871478237 | |||
| 1742 | 2871485209 | |||
| 1743 | 2871493117 | |||
| 1744 | 2874109573 | |||
| 1745 | 2874118128 | |||
| 1746 | 2874126382 | |||
| 1747 | 2874134887 | |||
| 1748 | 2874152478 | |||
| 1749 | 2874159878 | |||
| 1750 | 2874223974 | |||
| 1751 | 2876389843 | |||
| 1752 | 2876418394 | |||
| 1753 | 2878735856 | |||
| 1754 | 2878750125 | |||
| 1755 | 2878757162 | |||
| 1756 | 2878784206 | |||
| 1757 | 2881157993 | |||
| 1758 | 2881848546 | |||
| 1759 | 2881867698 | |||
| 1760 | 2882915352 | |||
| 1761 | 2885311367 | |||
| 1762 | 2885316408 | |||
| 1763 | 2885332892 | |||
| 1764 | 2888344742 | |||
| 1765 | 2889012980 | |||
| 1766 | 2889795089 | |||
| 1767 | 2889918184 | |||
| 1768 | 2900581743 | |||
| 1769 | 2903497814 | |||
| 1770 | 2903500889 | |||
| 1771 | 2903520455 | |||
| 1772 | 2904616653 | |||
| 1773 | 2906312483 | |||
| 1774 | 2906325192 | |||
| 1775 | 2906370532 | |||
| 1776 | 2906375097 | |||
| 1777 | 2906395456 | |||
| 1778 | 2906406269 | |||
| 1779 | 2906430594 | |||
| 1780 | 2919090083 | |||
| 1781 | 2919182584 | |||
| 1782 | 2919454086 | |||
| 1783 | 2919479517 | |||
| 1784 | 2919498258 | |||
| 1785 | 2921654770 | |||
| 1786 | 2922132618 | |||
| 1787 | 2922158163 | |||
| 1788 | 2923520782 | |||
| 1789 | 2924741686 | |||
| 1790 | 2924760645 | |||
| 1791 | 2928059468 | |||
| 1792 | 2928069609 | |||
| 1793 | 2928498052 | |||
| 1794 | 2937819372 | |||
| 1795 | 2937828198 | |||
| 1796 | 2937839190 | |||
| 1797 | 2937847901 | |||
| 1798 | 2937864669 | |||
| 1799 | 2937871290 | |||
| 1800 | 2958044555 | |||
| 1801 | 2958069129 | |||
| 1802 | 2958073027 | |||
| 1803 | 2958092815 | |||
| 1804 | 2958114623 | |||
| 1805 | 2958126100 | |||
| 1806 | 2958134615 | |||
| 1807 | 2958143241 | |||
| 1808 | 2958164871 | |||
| 1809 | 2958181096 | |||
| 1810 | 2961050738 | |||
| 1811 | 2961078932 | |||
| 1812 | 2961139120 | |||
| 1813 | 2961175509 | |||
| 1814 | 2961185689 | |||
| 1815 | 2965030090 | |||
| 1816 | 2965034436 | |||
| 1817 | 2965042940 | |||
| 1818 | 2965053411 | |||
| 1819 | 2965092526 | |||
| 1820 | 2965107146 | |||
| 1821 | 2965116418 | |||
| 1822 | 2967999489 | |||
| 1823 | 2968007847 | |||
| 1824 | 2968142356 | |||
| 1825 | 2970492479 | |||
| 1826 | 2970508097 | |||
| 1827 | 2970518040 | |||
| 1828 | 2970526474 | |||
| 1829 | 2970536366 | |||
| 1830 | 2970540597 | |||
| 1831 | 2970550209 | |||
| 1832 | 2970621166 | |||
| 1833 | 2970628347 | |||
| 1834 | 2974322216 | |||
| 1835 | 2977826321 | |||
| 1836 | 2977832198 | |||
| 1837 | 2977848271 | |||
| 1838 | 2977856038 | |||
| 1839 | 2977873449 | |||
| 1840 | 2977904044 | |||
| 1841 | 2977913130 | |||
| 1842 | 2977920812 | |||
| 1843 | 2977938272 | |||
| 1844 | 2977950746 | |||
| 1845 | 2977961403 | |||
| 1846 | 2979767908 | |||
| 1847 | 2979777015 | |||
| 1848 | 2979798857 | |||
| 1849 | 2979813281 | |||
| 1850 | 2987645556 | |||
| 1851 | 2987658657 | |||
| 1852 | 2987679394 | |||
| 1853 | 2996390474 | |||
| 1854 | 3000140031 | |||
| 1855 | 3004197914 | |||
| 1856 | 3004239349 | |||
| 1857 | 3004242497 | |||
| 1858 | 3004253408 | |||
| 1859 | 3004269305 | |||
| 1860 | 3004335571 | |||
| 1861 | 642418605 | |||
| 1862 | 642595320 | |||
| 1863 | 649870440 | |||
| 1864 | 8004303096 | |||
| 1865 | 8004316201 | |||
| 1866 | 8004364799 | |||
| 1867 | 8004378737 | |||
| 1868 | 8004392433 | |||
| 1869 | 8004633272 | |||
| 1870 | 8004696082 | |||
| 1871 | 8004718742 | |||
| 1872 | 8004729012 | |||
| 1873 | 8020941353 | |||
| 1874 | 8020956690 | |||
| 1875 | 8055271088 | |||
| 1876 | 8055306920 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p19-assembly1.cif.gz_B | improved nadph-dependent blue fluorescent protein | 0.9379 | 5 | 227 |
| 2fwm-assembly1.cif.gz_X | crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase | 0.9345 | 1 | 228 |
| 6zzp-assembly2.cif.gz_D-3 | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate | 0.933 | 5 | 182 |
| 3k31-assembly1.cif.gz_A | crystal structure of eonyl-(acyl-carrier-protein) reductase from anaplasma phagocytophilum in complex with nad at 1.9a resolution | 0.9248 | 5 | 174 |
| 5gws-assembly1.cif.gz_C | 4-hydroxyisoleucine dehydrogenase complexed with nadh and succinate | 0.9237 | 7 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9691 | 86 | 176 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9643 | 2 | 172 | 3.40.50.720 |
| af_Q9M1K9_1_271_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9527 | 4 | 186 | 3.40.50.720 |
| af_A0A0R0IEI4_1_176_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9514 | 42 | 176 | 3.40.50.720 |
| 3p19C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9388 | 5 | 227 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6CHQ7-F1-model_v4 | Short-chain dehydrogenase/reductase | 0.9899 | 5 | 201 |
GO:0016491
|
| AF-A0A2V7PTR5-F1-model_v4 | Short-chain dehydrogenase/reductase | 0.9853 | 4 | 232 |
GO:0016491
|
| AF-A0A7V4F2L6-F1-model_v4 | SDR family oxidoreductase | 0.9828 | 4 | 190 |
GO:0016491
|
| AF-A0A3S0L3Z2-F1-model_v4 | Oxidoreductase | 0.9814 | 1 | 268 |
GO:0016491
|
| AF-A0A537FAK0-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9801 | 1 | 176 |
GO:0016491
|