F486247

General Info

Members Datasets Scaffolds Average Seq Length
938 521 1876 269

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10012593|Ga0105238_100125931
Length 316
Sequence MSRRHRRRASWRKPLPGSSSKAHLNRRCKHHRAVDPSLANQPVSKETAMSNSKVVVVTGVSSGIGRATAAKFAKRGCRVFGTVRNVAKAAPLAGVELVEMDVSDDASVKSGIQFIIDRAKHIDVLVNNAGTSLIGAVEETSIAEATALFDANVFGILRTAQAVLPQMRAQRNGRVVNISSVLGFLPAPYMGLYAASKHAVEGLSETLDHEVRQFGVRISLVEPTFTRTNLDVNAPQARAKISDYDRERDLASRAIVKSVKGAPEPDGVADAVVDAALGAWRMRRTPGRQASLLSKLRRFMPAAPVDASLRKTFGLG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
224 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
225 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
226 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
304 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
305 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
308 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
309 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
310 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
311 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
312 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
313 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
314 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
315 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
316 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
317 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
318 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
330 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
331 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
335 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
338 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
339 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
340 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
341 2512875024
342 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
343 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
344 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
345 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
346 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
347 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
348 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
349 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
350 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
351 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
352 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
353 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
354 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
355 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
356 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
357 2643221658 Variovorax sp. Root411 Isolate Unclassified
358 2643221672 Variovorax sp. Root434 Isolate Unclassified
359 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
360 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
361 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
362 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
363 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
364 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
365 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
366 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
367 2818991436 Collimonas arenae 515 Isolate Unclassified
368 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
369 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
370 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
371 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
372 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
373 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
374 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
375 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
376 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
377 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
378 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
379 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
380 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
381 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
382 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
383 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
384 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
385 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
386 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
387 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
388 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
389 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
390 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
391 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
392 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
393 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
394 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
395 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
396 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
397 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
398 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
399 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
400 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
401 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
402 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
403 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
404 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
405 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
406 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
407 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
408 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
409 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
410 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
411 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
412 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
413 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
414 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
415 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
416 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
417 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
418 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
419 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
420 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
421 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
422 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
423 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
424 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
425 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
426 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
427 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
428 2919476304 Duganella sp. 3397 Isolate Unclassified
429 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
430 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
431 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
432 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
433 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
434 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
435 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
436 2928058823 Ralstonia sp. 1138 Isolate Unclassified
437 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
438 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
439 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
440 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
441 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
442 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
443 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
444 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
445 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
446 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
447 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
448 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
449 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
450 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
451 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
452 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
453 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
454 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
455 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
456 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
457 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
458 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
459 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
460 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
461 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
462 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
463 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
464 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
465 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
466 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
467 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
468 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
469 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
470 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
471 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
472 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
473 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
474 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
475 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
476 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
477 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
478 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
479 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
480 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
481 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
482 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
483 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
484 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
485 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
486 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
487 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
488 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
489 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
490 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
491 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
492 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
493 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
494 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
495 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
496 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
497 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
498 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
499 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
500 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
501 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
502 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
503 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
504 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
505 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
506 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
507 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
508 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
509 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
510 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
511 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
512 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
513 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
514 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
515 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
516 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
517 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
518 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
519 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
520 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
521 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.85
Metatranscriptomes 0.32
Isolates 19.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.65
Nodule 15.25
Rhizoplane 0.85
Rhizosphere 47.97
Stem 0
Stem Tuber 0.11
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10012593 3300009551 Bacteria 8538
2 JGI24740J21852_10000061 3300001979 Bacteria 34865
3 JGI24740J21852_10000399 3300001979 Bacteria 18646
4 JGI24740J21852_10002819 3300001979 Bacteria 7774
5 JGI24739J22299_10000076 3300001989 Bacteria 27668
6 JGI24739J22299_10002903 3300001989 Bacteria 6579
7 JGI24739J22299_10003435 3300001989 Bacteria 6042
8 JGI24739J22299_10020345 3300001989 Bacteria 2371
9 JGI24737J22298_10000304 3300001990 Bacteria 16452
10 JGI24735J21928_10000201 3300002067 Bacteria 21023
11 JGI24735J21928_10000454 3300002067 Bacteria 14377
12 JGI24735J21928_10014636 3300002067 Bacteria 2455
13 JGI25155J39150_1000039 3300002704 Bacteria 91670
14 JGI25156J39149_1000096 3300002705 Bacteria 64397
15 JGI25156J39149_1009783 3300002705 Bacteria 2303
16 JGI25156J39149_1011488 3300002705 Bacteria 1999
17 JGI25154J39366_1000077 3300002738 Bacteria 90455
18 JGI25154J39366_1000148 3300002738 Bacteria 54914
19 JGI25154J39366_1000725 3300002738 Bacteria 14907
20 JGI25154J39366_1004071 3300002738 Bacteria 2766
21 JGI25154J39366_1010875 3300002738 Bacteria 1062
22 JGI25158J39367_1001215 3300002739 Bacteria 4631
23 JGI25157J39369_1000065 3300002741 Bacteria 98536
24 JGI25157J39369_1000573 3300002741 Bacteria 21883
25 JGI25157J39369_1001461 3300002741 Bacteria 8783
26 JGI25152J39213_1000003 3300002773 Bacteria 214804
27 JGI25150J39212_1000035 3300002774 Bacteria 90105
28 JGI25150J39212_1000446 3300002774 Bacteria 18374
29 JGI25150J39212_1003091 3300002774 Bacteria 3982
30 JGI25150J39212_1010085 3300002774 Bacteria 1770
31 JGI25150J39212_1016234 3300002774 Bacteria 1224
32 JGI25159J45721_1001030 3300002987 Bacteria 11942
33 JGI25151J46595_10003534 3300003187 Bacteria 8595
34 JGI25153J46596_10000046 3300003215 Bacteria 148355
35 JGI25153J46596_10010646 3300003215 Bacteria 4140
36 JGI25153J46596_10022613 3300003215 Bacteria 2311
37 rootH1_10178903 3300003323 Bacteria 3964
38 rootH1_10183483 3300003323 Bacteria 1037
39 JGI25160J50197_1034153 3300003354 Bacteria 1267
40 Ga0006562J51391_1055123 3300003578 Bacteria 1589
41 Ga0006562J51391_1055124 3300003578 Bacteria 2460
42 Ga0055538_1003839 3300003751 Bacteria 1816
43 Ga0055539_1000059 3300003752 Bacteria 146394
44 Ga0055539_1000692 3300003752 Bacteria 8734
45 Ga0055533_1000664 3300003756 Bacteria 11419
46 Ga0055533_1000803 3300003756 Bacteria 9795
47 Ga0055532_1000005 3300003758 Bacteria 458107
48 Ga0055532_1000025 3300003758 Bacteria 240145
49 Ga0055532_1001236 3300003758 Bacteria 7540
50 Ga0055525_1000207 3300003759 Bacteria 66980
51 Ga0055525_1000447 3300003759 Bacteria 23685
52 Ga0055527_1000108 3300003760 Bacteria 59457
53 Ga0055527_1000336 3300003760 Bacteria 24072
54 Ga0055527_1000901 3300003760 Bacteria 7539
55 Ga0055527_1003809 3300003760 Bacteria 2166
56 Ga0055535_1000019 3300003761 Bacteria 240145
57 Ga0055535_1000080 3300003761 Bacteria 108370
58 Ga0055535_1000712 3300003761 Bacteria 25305
59 Ga0055535_1000899 3300003761 Bacteria 20328
60 Ga0055535_1002175 3300003761 Bacteria 7540
61 Ga0055535_1002380 3300003761 Bacteria 6716
62 Ga0055535_1012321 3300003761 Bacteria 1311
63 Ga0055542_1000577 3300003762 Bacteria 31820
64 Ga0055542_1000764 3300003762 Bacteria 24368
65 Ga0055542_1000773 3300003762 Bacteria 24058
66 Ga0055542_1000898 3300003762 Bacteria 20328
67 Ga0055542_1002053 3300003762 Bacteria 7573
68 Ga0055529_1000035 3300003763 Bacteria 240145
69 Ga0055529_1000064 3300003763 Bacteria 178831
70 Ga0055529_1000172 3300003763 Bacteria 89025
71 Ga0055529_1000613 3300003763 Bacteria 26951
72 Ga0055529_1000665 3300003763 Bacteria 24058
73 Ga0055529_1000686 3300003763 Bacteria 23167
74 Ga0055526_1000089 3300003771 Bacteria 83426
75 Ga0055526_1001925 3300003771 Bacteria 14356
76 Ga0055537_1000046 3300003773 Bacteria 88251
77 Ga0055537_1000064 3300003773 Bacteria 77134
78 Ga0055537_1004523 3300003773 Bacteria 3962
79 Ga0055537_1015409 3300003773 Bacteria 1342
80 Ga0055524_1000012 3300003775 Bacteria 260384
81 Ga0055524_1002020 3300003775 Bacteria 10826
82 Ga0055524_1008763 3300003775 Bacteria 4175
83 Ga0055524_1035429 3300003775 Bacteria 1361
84 Ga0055536_1003378 3300003781 Bacteria 8611
85 Ga0055536_1005290 3300003781 Bacteria 6353
86 Ga0055534_1000094 3300003784 Bacteria 70029
87 Ga0055534_1000446 3300003784 Bacteria 24264
88 Ga0055534_1007964 3300003784 Bacteria 2455
89 Ga0055528_1000142 3300003790 Bacteria 58220
90 Ga0055528_1000250 3300003790 Bacteria 45479
91 Ga0055528_1001134 3300003790 Bacteria 17390
92 Ga0055528_1015750 3300003790 Bacteria 2713
93 Ga0055528_1024132 3300003790 Bacteria 1834
94 Ga0055530_10000015 3300003791 Bacteria 148790
95 Ga0055530_10002108 3300003791 Bacteria 13254
96 Ga0055530_10003589 3300003791 Bacteria 8717
97 Ga0055530_10004951 3300003791 Bacteria 6590
98 Ga0055530_10004954 3300003791 Bacteria 6588
99 Ga0055540_1000039 3300003792 Bacteria 161844
100 Ga0055540_1001343 3300003792 Bacteria 14821
101 Ga0055531_10001229 3300003794 Bacteria 19501
102 Ga0055531_10002703 3300003794 Bacteria 11678
103 Ga0055531_10003176 3300003794 Bacteria 10567
104 Ga0055531_10016754 3300003794 Bacteria 3139
105 Ga0055531_10025689 3300003794 Unclassified 2130
106 Ga0055531_10028559 3300003794 Bacteria 1920
107 Ga0055541_1001078 3300003841 Bacteria 6251
108 Ga0055541_1005811 3300003841 Bacteria 2135
109 Ga0055541_1007353 3300003841 Bacteria 1814
110 Ga0058692_1000035 3300003856 Bacteria 152983
111 Ga0065165_1019916 3300005262 Bacteria 2379
112 Ga0065165_1052000 3300005262 Unclassified 1159
113 Ga0065704_10004493 3300005289 Bacteria 4724
114 Ga0065707_10236624 3300005295 Bacteria 1170
115 Ga0070658_10099137 3300005327 Bacteria 2407
116 Ga0070690_100063390 3300005330 Bacteria 2385
117 Ga0070682_100092374 3300005337 Bacteria 1982
118 Ga0070660_100180758 3300005339 Bacteria 1707
119 Ga0070660_100244152 3300005339 Bacteria 1463
120 Ga0070661_100000192 3300005344 Bacteria 50400
121 Ga0070661_100289858 3300005344 Bacteria 1272
122 Ga0070661_100335551 3300005344 Bacteria 1183
123 Ga0070673_100527205 3300005364 Bacteria 1071
124 Ga0070659_100016932 3300005366 Bacteria 5479
125 Ga0070667_100281583 3300005367 Bacteria 1493
126 Ga0070714_100007578 3300005435 Bacteria 8454
127 Ga0070713_100047670 3300005436 Bacteria 3523
128 Ga0070708_100259188 3300005445 Bacteria 1634
129 Ga0070663_100000009 3300005455 Bacteria 187718
130 Ga0070663_100002493 3300005455 Bacteria 10384
131 Ga0070678_100173468 3300005456 Bacteria 1758
132 Ga0070706_100689778 3300005467 Bacteria 947
133 Ga0070707_100000050 3300005468 Bacteria 102427
134 Ga0070707_100013883 3300005468 Bacteria 7544
135 Ga0068853_100005429 3300005539 Bacteria 9990
136 Ga0068853_100044371 3300005539 Bacteria 3806
137 Ga0068853_100047285 3300005539 Bacteria 3692
138 Ga0068853_100080874 3300005539 Bacteria 2844
139 Ga0068853_100169119 3300005539 Bacteria 1977
140 Ga0068853_100243994 3300005539 Bacteria 1647
141 Ga0070696_100003577 3300005546 Bacteria 10354
142 Ga0070693_100003915 3300005547 Bacteria 6984
143 Ga0070665_100000220 3300005548 Bacteria 95539
144 Ga0068855_100048863 3300005563 Bacteria 4992
145 Ga0068855_100256025 3300005563 Bacteria 1951
146 Ga0068855_100266042 3300005563 Bacteria 1908
147 Ga0068855_100337859 3300005563 Bacteria 1661
148 Ga0068855_100391040 3300005563 Bacteria 1525
149 Ga0070664_100000200 3300005564 Bacteria 42627
150 Ga0068857_100000118 3300005577 Bacteria 47043
151 Ga0068857_100000300 3300005577 Bacteria 34132
152 Ga0068857_100033961 3300005577 Bacteria 4512
153 Ga0068857_100240893 3300005577 Bacteria 1656
154 Ga0068857_100258624 3300005577 Bacteria 1597
155 Ga0068854_100000017 3300005578 Bacteria 142796
156 Ga0068854_100002114 3300005578 Bacteria 12177
157 Ga0068854_100026322 3300005578 Bacteria 3997
158 Ga0068854_100036364 3300005578 Bacteria 3452
159 Ga0068854_100086608 3300005578 Bacteria 2323
160 Ga0068856_100000069 3300005614 Bacteria 95628
161 Ga0068856_100008554 3300005614 Bacteria 9948
162 Ga0068856_100057987 3300005614 Bacteria 3824
163 Ga0068856_100125992 3300005614 Bacteria 2564
164 Ga0068856_100130944 3300005614 Bacteria 2513
165 Ga0068856_100164875 3300005614 Bacteria 2227
166 Ga0068856_100232050 3300005614 Bacteria 1860
167 Ga0068852_100010857 3300005616 Bacteria 6825
168 Ga0068852_100019054 3300005616 Bacteria 5422
169 Ga0068852_100055638 3300005616 Bacteria 3416
170 Ga0068864_100020667 3300005618 Bacteria 5509
171 Ga0068861_100316122 3300005719 Bacteria 1358
172 Ga0068851_10009946 3300005834 Bacteria 4428
173 Ga0068863_100326424 3300005841 Bacteria 1491
174 Ga0068858_100082199 3300005842 Bacteria 2994
175 Ga0068860_100176728 3300005843 Bacteria 2063
176 Ga0068860_100365447 3300005843 Bacteria 1422
177 Ga0081455_10003754 3300005937 Bacteria 17353
178 Ga0075368_10056409 3300006042 Bacteria 1567
179 Ga0075363_100009812 3300006048 Bacteria 4513
180 Ga0075364_10010108 3300006051 Bacteria 5690
181 Ga0075364_10016634 3300006051 Bacteria 4578
182 Ga0075364_10077748 3300006051 Bacteria 2191
183 Ga0075362_10005736 3300006177 Bacteria 4569
184 Ga0075362_10052084 3300006177 Bacteria 1833
185 Ga0075367_10086159 3300006178 Bacteria 1906
186 Ga0075367_10236545 3300006178 Bacteria 1144
187 Ga0075366_10031852 3300006195 Bacteria 3104
188 Ga0075366_10159414 3300006195 Bacteria 1367
189 Ga0075366_10244640 3300006195 Bacteria 1094
190 Ga0097621_100111794 3300006237 Bacteria 2309
191 Ga0075370_10000478 3300006353 Bacteria 15041
192 Ga0075370_10001797 3300006353 Bacteria 9587
193 Ga0075370_10002208 3300006353 Bacteria 8944
194 Ga0075370_10061400 3300006353 Bacteria 2141
195 Ga0075370_10089556 3300006353 Bacteria 1774
196 Ga0075370_10100854 3300006353 Bacteria 1670
197 Ga0075370_10118051 3300006353 Bacteria 1543
198 Ga0075370_10181617 3300006353 Bacteria 1238
199 Ga0075433_10033333 3300006852 Bacteria 4415
200 Ga0075434_100380900 3300006871 Unclassified 1431
201 Ga0099826_10000002 3300006948 Bacteria 1125830
202 Ga0099826_10123691 3300006948 Bacteria 1519
203 Ga0099794_10041823 3300007265 Bacteria 2183
204 Ga0105244_10002796 3300009036 Bacteria 12976
205 Ga0105244_10014339 3300009036 Bacteria 4585
206 Ga0105240_10001373 3300009093 Bacteria 41833
207 Ga0105240_10007869 3300009093 Bacteria 15381
208 Ga0105240_10015313 3300009093 Bacteria 10433
209 Ga0105240_10101731 3300009093 Bacteria 3494
210 Ga0105240_10185957 3300009093 Bacteria 2447
211 Ga0105240_10236925 3300009093 Bacteria 2117
212 Ga0105240_10491616 3300009093 Bacteria 1366
213 Ga0105245_10054669 3300009098 Bacteria 3586
214 Ga0105245_10080505 3300009098 Bacteria 2976
215 Ga0105247_10059139 3300009101 Bacteria 2372
216 Ga0114129_10034549 3300009147 Bacteria 7142
217 Ga0114129_10450022 3300009147 Unclassified 1689
218 Ga0105243_10001884 3300009148 Bacteria 17875
219 Ga0105243_10080551 3300009148 Bacteria 2656
220 Ga0105241_10092987 3300009174 Bacteria 2382
221 Ga0105248_10383016 3300009177 Bacteria 1584
222 Ga0105237_10000063 3300009545 Bacteria 141759
223 Ga0105237_10002287 3300009545 Bacteria 23805
224 Ga0105237_10008414 3300009545 Bacteria 11176
225 Ga0105237_10257281 3300009545 Bacteria 1748
226 Ga0105237_10302147 3300009545 Bacteria 1604
227 Ga0105238_10003995 3300009551 Bacteria 14639
228 Ga0105238_10009539 3300009551 Bacteria 9713
229 Ga0105238_10154003 3300009551 Bacteria 2273
230 Ga0105238_10283280 3300009551 Bacteria 1639
231 Ga0105249_10031041 3300009553 Bacteria 4831
232 Ga0105239_10001649 3300010375 Bacteria 29428
233 Ga0105239_10089272 3300010375 Bacteria 3399
234 Ga0105239_10091015 3300010375 Bacteria 3366
235 Ga0105239_10186106 3300010375 Bacteria 2324
236 Ga0105239_10228300 3300010375 Bacteria 2089
237 Ga0105239_10309436 3300010375 Bacteria 1780
238 Ga0105246_10043190 3300011119 Bacteria 3057
239 Ga0105246_10044367 3300011119 Bacteria 3021
240 Ga0105246_10235199 3300011119 Bacteria 1445
241 Ga0157319_1000008 3300012497 Bacteria 315600
242 Ga0157314_1000500 3300012500 Bacteria 3747
243 Ga0157373_10021453 3300013100 Bacteria 4692
244 Ga0157373_10036397 3300013100 Bacteria 3533
245 Ga0157373_10167305 3300013100 Bacteria 1547
246 Ga0157373_10486471 3300013100 Bacteria 891
247 Ga0157371_10000033 3300013102 Bacteria 225328
248 Ga0157370_10000010 3300013104 Bacteria 218199
249 Ga0157370_10050072 3300013104 Bacteria 3995
250 Ga0157370_10171700 3300013104 Bacteria 2015
251 Ga0157370_10439286 3300013104 Bacteria 1200
252 Ga0157369_10011384 3300013105 Bacteria 10101
253 Ga0157369_10067951 3300013105 Bacteria 3830
254 Ga0157369_10076620 3300013105 Bacteria 3585
255 Ga0157374_10657418 3300013296 Bacteria 1060
256 Ga0157372_10000176 3300013307 Bacteria 70656
257 Ga0157372_10008352 3300013307 Bacteria 11008
258 Ga0157372_10284402 3300013307 Bacteria 1923
259 Ga0157372_10748345 3300013307 Bacteria 1136
260 Ga0157372_10811878 3300013307 Bacteria 1086
261 Ga0157375_10735423 3300013308 Bacteria 1139
262 Ga0157380_10492263 3300014326 Bacteria 1189
263 Ga0182008_10000920 3300014497 Bacteria 20488
264 Ga0182008_10007295 3300014497 Bacteria 6114
265 Ga0182008_10027139 3300014497 Bacteria 2903
266 Ga0182008_10142036 3300014497 Bacteria 1201
267 Ga0157379_10028052 3300014968 Bacteria 5011
268 Ga0157376_10345446 3300014969 Bacteria 1422
269 Ga0182006_1000019 3300015261 Bacteria 294192
270 Ga0182006_1000198 3300015261 Bacteria 61642
271 Ga0182006_1000675 3300015261 Bacteria 23953
272 Ga0182006_1007099 3300015261 Bacteria 5155
273 Ga0182006_1013260 3300015261 Bacteria 3580
274 Ga0182006_1018614 3300015261 Bacteria 2932
275 Ga0182006_1042845 3300015261 Bacteria 1771
276 Ga0182006_1045281 3300015261 Bacteria 1713
277 Ga0182007_10000671 3300015262 Bacteria 19659
278 Ga0182007_10006301 3300015262 Bacteria 5103
279 Ga0182007_10015627 3300015262 Bacteria 2825
280 Ga0182007_10026923 3300015262 Bacteria 1988
281 Ga0182005_1000005 3300015265 Bacteria 537378
282 Ga0182005_1000902 3300015265 Bacteria 12991
283 Ga0163161_10002721 3300017792 Bacteria 12561
284 Ga0154015_1514660 3300020610 Bacteria 27088
285 Ga0209435_100043 3300025206 Bacteria 102049
286 Ga0209435_100050 3300025206 Bacteria 91356
287 Ga0209435_100092 3300025206 Bacteria 40616
288 Ga0209436_102805 3300025208 Bacteria 4958
289 Ga0209784_100008 3300025224 Bacteria 740293
290 Ga0209784_100172 3300025224 Bacteria 55681
291 Ga0209784_101451 3300025224 Bacteria 3135
292 Ga0209566_100006 3300025225 Bacteria 789272
293 Ga0209566_100194 3300025225 Bacteria 63005
294 Ga0209566_101022 3300025225 Bacteria 11775
295 Ga0209674_100045 3300025226 Bacteria 362387
296 Ga0209674_100049 3300025226 Bacteria 346969
297 Ga0209674_100114 3300025226 Bacteria 139197
298 Ga0209674_100283 3300025226 Bacteria 37540
299 Ga0209674_103302 3300025226 Bacteria 3020
300 Ga0209672_100025 3300025228 Bacteria 350006
301 Ga0209672_100058 3300025228 Bacteria 211992
302 Ga0209672_100100 3300025228 Bacteria 108785
303 Ga0209672_100103 3300025228 Bacteria 104244
304 Ga0209672_100260 3300025228 Bacteria 39122
305 Ga0209672_105493 3300025228 Bacteria 2166
306 Ga0209147_100005 3300025229 Bacteria 1036530
307 Ga0209147_100011 3300025229 Bacteria 702140
308 Ga0209147_100032 3300025229 Bacteria 350006
309 Ga0209563_100016 3300025230 Bacteria 802091
310 Ga0209563_100150 3300025230 Bacteria 65666
311 Ga0209563_105627 3300025230 Bacteria 2243
312 Ga0209258_100007 3300025242 Bacteria 1036530
313 Ga0209258_100024 3300025242 Bacteria 542096
314 Ga0209258_100050 3300025242 Bacteria 350006
315 Ga0209258_100124 3300025242 Bacteria 178883
316 Ga0209258_100164 3300025242 Bacteria 148838
317 Ga0209258_100232 3300025242 Bacteria 104244
318 Ga0209258_100401 3300025242 Bacteria 54149
319 Ga0209258_100991 3300025242 Bacteria 13111
320 Ga0207425_1000014 3300025245 Bacteria 481113
321 Ga0207425_1000036 3300025245 Bacteria 225783
322 Ga0207425_1000119 3300025245 Bacteria 74008
323 Ga0207425_1000269 3300025245 Bacteria 38302
324 Ga0209646_1000027 3300025246 Bacteria 395141
325 Ga0209646_1000105 3300025246 Bacteria 163453
326 Ga0209646_1000161 3300025246 Bacteria 91356
327 Ga0209646_1000546 3300025246 Bacteria 16100
328 Ga0209646_1015973 3300025246 Bacteria 1117
329 Ga0209026_1000061 3300025250 Bacteria 219572
330 Ga0209026_1000173 3300025250 Bacteria 98585
331 Ga0209026_1000590 3300025250 Bacteria 23667
332 Ga0209026_1001604 3300025250 Bacteria 9688
333 Ga0209026_1002727 3300025250 Bacteria 6341
334 Ga0209026_1003847 3300025250 Bacteria 4736
335 Ga0209677_100008 3300025253 Bacteria 802091
336 Ga0209677_105461 3300025253 Bacteria 3311
337 Ga0209148_1000009 3300025254 Bacteria 1395625
338 Ga0209148_1000019 3300025254 Bacteria 748518
339 Ga0209148_1000039 3300025254 Bacteria 482479
340 Ga0209148_1000060 3300025254 Bacteria 350006
341 Ga0209148_1000206 3300025254 Bacteria 104244
342 Ga0209148_1009855 3300025254 Bacteria 1838
343 Ga0209759_1000041 3300025256 Bacteria 252893
344 Ga0209759_1000169 3300025256 Bacteria 110110
345 Ga0209759_1000426 3300025256 Bacteria 51309
346 Ga0209759_1000865 3300025256 Bacteria 23443
347 Ga0209759_1000893 3300025256 Bacteria 22416
348 Ga0209759_1001528 3300025256 Bacteria 12710
349 Ga0209759_1002160 3300025256 Bacteria 9020
350 Ga0209759_1008283 3300025256 Bacteria 3254
351 Ga0209759_1010122 3300025256 Bacteria 2787
352 Ga0209129_1000017 3300025258 Bacteria 480935
353 Ga0209129_1000538 3300025258 Bacteria 26434
354 Ga0209129_1001239 3300025258 Bacteria 14649
355 Ga0209129_1021217 3300025258 Bacteria 1195
356 Ga0209233_1005033 3300025261 Bacteria 4431
357 Ga0209565_1000004 3300025263 Bacteria 983150
358 Ga0209565_1000025 3300025263 Bacteria 377969
359 Ga0209565_1000741 3300025263 Bacteria 19347
360 Ga0209565_1001718 3300025263 Bacteria 8987
361 Ga0209565_1005817 3300025263 Bacteria 3539
362 Ga0209565_1009678 3300025263 Bacteria 2429
363 Ga0209565_1018473 3300025263 Bacteria 1507
364 Ga0209455_1000011 3300025272 Bacteria 947242
365 Ga0209455_1000029 3300025272 Bacteria 542096
366 Ga0209455_1000034 3300025272 Bacteria 483129
367 Ga0209455_1000055 3300025272 Bacteria 350006
368 Ga0209455_1000111 3300025272 Bacteria 188820
369 Ga0209455_1000114 3300025272 Bacteria 178883
370 Ga0209455_1000179 3300025272 Bacteria 104244
371 Ga0209455_1014013 3300025272 Bacteria 1833
372 Ga0209673_1000149 3300025273 Bacteria 148659
373 Ga0209673_1000221 3300025273 Bacteria 112739
374 Ga0209673_1000986 3300025273 Bacteria 34808
375 Ga0209673_1012476 3300025273 Bacteria 3420
376 Ga0209130_1000379 3300025284 Bacteria 49962
377 Ga0209130_1005218 3300025284 Bacteria 4592
378 Ga0209130_1009348 3300025284 Bacteria 2803
379 Ga0209675_1000017 3300025291 Bacteria 378002
380 Ga0209675_1000061 3300025291 Bacteria 181096
381 Ga0209675_1000856 3300025291 Bacteria 19729
382 Ga0209675_1010031 3300025291 Bacteria 3277
383 Ga0209675_1036130 3300025291 Bacteria 1121
384 Ga0209676_1000007 3300025292 Bacteria 1029371
385 Ga0209676_1000437 3300025292 Bacteria 71544
386 Ga0209676_1022664 3300025292 Bacteria 2075
387 Ga0209025_1001820 3300025294 Bacteria 25104
388 Ga0209025_1012575 3300025294 Bacteria 5412
389 Ga0209025_1023855 3300025294 Bacteria 3180
390 Ga0209025_1025801 3300025294 Bacteria 2976
391 Ga0209025_1029526 3300025294 Bacteria 2650
392 Ga0209564_1000299 3300025295 Bacteria 99740
393 Ga0209564_1000934 3300025295 Bacteria 37894
394 Ga0209564_1002212 3300025295 Bacteria 16212
395 Ga0209564_1033912 3300025295 Bacteria 1507
396 Ga0209758_1000038 3300025297 Bacteria 433771
397 Ga0209758_1000124 3300025297 Bacteria 189933
398 Ga0209758_1000221 3300025297 Bacteria 123812
399 Ga0209758_1000483 3300025297 Bacteria 65467
400 Ga0209758_1002033 3300025297 Bacteria 21722
401 Ga0209758_1005840 3300025297 Bacteria 9191
402 Ga0209758_1013005 3300025297 Bacteria 4590
403 Ga0209758_1020327 3300025297 Bacteria 3147
404 Ga0209050_1000003 3300025298 Bacteria 1609245
405 Ga0209050_1000040 3300025298 Bacteria 408492
406 Ga0209050_1000089 3300025298 Bacteria 256212
407 Ga0209050_1000723 3300025298 Bacteria 48329
408 Ga0209050_1001052 3300025298 Bacteria 33980
409 Ga0209050_1003969 3300025298 Bacteria 10435
410 Ga0209050_1034769 3300025298 Bacteria 1501
411 Ga0209256_1000001 3300025299 Bacteria 2166974
412 Ga0209256_1000138 3300025299 Bacteria 156076
413 Ga0209256_1026782 3300025299 Bacteria 1654
414 Ga0207426_1002343 3300025302 Bacteria 12374
415 Ga0207426_1004319 3300025302 Bacteria 7003
416 Ga0209051_1000003 3300025303 Bacteria 1609245
417 Ga0209051_1000312 3300025303 Bacteria 75251
418 Ga0209051_1006484 3300025303 Bacteria 6583
419 Ga0209051_1049583 3300025303 Unclassified 1413
420 Ga0209257_1000018 3300025304 Bacteria 836016
421 Ga0209257_1000053 3300025304 Bacteria 425160
422 Ga0209257_1000054 3300025304 Bacteria 416957
423 Ga0209257_1000504 3300025304 Bacteria 68999
424 Ga0209257_1000669 3300025304 Bacteria 53655
425 Ga0209257_1001206 3300025304 Bacteria 32484
426 Ga0209257_1005453 3300025304 Bacteria 8928
427 Ga0209257_1007376 3300025304 Bacteria 6660
428 Ga0207656_10012230 3300025321 Bacteria 3260
429 Ga0207655_1027498 3300025728 Bacteria 2708
430 Ga0207655_1052667 3300025728 Bacteria 1635
431 Ga0207710_10015889 3300025900 Bacteria 3184
432 Ga0207680_10010971 3300025903 Bacteria 4557
433 Ga0207647_10000504 3300025904 Bacteria 31238
434 Ga0207647_10005351 3300025904 Bacteria 9430
435 Ga0207647_10055928 3300025904 Bacteria 2423
436 Ga0207647_10104630 3300025904 Bacteria 1677
437 Ga0207654_10131677 3300025911 Bacteria 1584
438 Ga0207695_10000372 3300025913 Bacteria 101840
439 Ga0207695_10000664 3300025913 Bacteria 67787
440 Ga0207695_10001246 3300025913 Bacteria 43517
441 Ga0207695_10002167 3300025913 Bacteria 29675
442 Ga0207695_10003529 3300025913 Bacteria 21909
443 Ga0207695_10007941 3300025913 Bacteria 13392
444 Ga0207695_10095287 3300025913 Bacteria 2981
445 Ga0207695_10185980 3300025913 Bacteria 1996
446 Ga0207671_10000021 3300025914 Bacteria 300409
447 Ga0207671_10002068 3300025914 Bacteria 21960
448 Ga0207671_10005943 3300025914 Bacteria 11059
449 Ga0207671_10021681 3300025914 Bacteria 4869
450 Ga0207671_10291441 3300025914 Bacteria 1288
451 Ga0207671_10340845 3300025914 Bacteria 1188
452 Ga0207662_10170889 3300025918 Bacteria 1394
453 Ga0207657_10183638 3300025919 Bacteria 1690
454 Ga0207657_10353105 3300025919 Bacteria 1159
455 Ga0207649_10000191 3300025920 Bacteria 50371
456 Ga0207649_10055829 3300025920 Bacteria 2464
457 Ga0207649_10131067 3300025920 Bacteria 1703
458 Ga0207646_10000037 3300025922 Bacteria 196362
459 Ga0207694_10000364 3300025924 Bacteria 42625
460 Ga0207694_10015720 3300025924 Bacteria 5709
461 Ga0207694_10027336 3300025924 Bacteria 4344
462 Ga0207694_10202457 3300025924 Bacteria 1615
463 Ga0207687_10049240 3300025927 Bacteria 2929
464 Ga0207664_10117273 3300025929 Bacteria 2223
465 Ga0207690_10003114 3300025932 Bacteria 9991
466 Ga0207706_10016628 3300025933 Bacteria 6640
467 Ga0207689_10048662 3300025942 Bacteria 3498
468 Ga0207679_10000002 3300025945 Bacteria 634491
469 Ga0207679_10069409 3300025945 Bacteria 2652
470 Ga0207667_10000198 3300025949 Bacteria 87446
471 Ga0207667_10026299 3300025949 Bacteria 6360
472 Ga0207667_10069528 3300025949 Bacteria 3664
473 Ga0207712_10135148 3300025961 Bacteria 1884
474 Ga0207640_10000138 3300025981 Bacteria 53518
475 Ga0207640_10001942 3300025981 Bacteria 11133
476 Ga0207640_10008907 3300025981 Bacteria 5593
477 Ga0207640_10036039 3300025981 Bacteria 3102
478 Ga0207640_10042659 3300025981 Bacteria 2894
479 Ga0207658_10152568 3300025986 Bacteria 1884
480 Ga0207658_10510285 3300025986 Bacteria 1072
481 Ga0207703_10600380 3300026035 Bacteria 1041
482 Ga0207639_10002600 3300026041 Bacteria 12121
483 Ga0207639_10051425 3300026041 Bacteria 3134
484 Ga0207639_10053382 3300026041 Bacteria 3084
485 Ga0207639_10121679 3300026041 Bacteria 2145
486 Ga0207678_10000015 3300026067 Bacteria 138937
487 Ga0207678_10005311 3300026067 Bacteria 11535
488 Ga0207702_10000308 3300026078 Bacteria 55913
489 Ga0207702_10000864 3300026078 Bacteria 31591
490 Ga0207702_10001120 3300026078 Bacteria 27360
491 Ga0207702_10032104 3300026078 Bacteria 4381
492 Ga0207702_10133825 3300026078 Bacteria 2234
493 Ga0207702_10188207 3300026078 Bacteria 1905
494 Ga0207641_10341276 3300026088 Bacteria 1425
495 Ga0207674_10000623 3300026116 Bacteria 46466
496 Ga0207674_10165891 3300026116 Bacteria 2163
497 Ga0207674_10270670 3300026116 Bacteria 1646
498 Ga0207674_10276291 3300026116 Bacteria 1628
499 Ga0207674_10466978 3300026116 Bacteria 1220
500 Ga0207698_10027182 3300026142 Bacteria 4059
501 Ga0207698_10041658 3300026142 Bacteria 3424
502 Ga0207698_10085970 3300026142 Bacteria 2556
503 Ga0207698_10093021 3300026142 Bacteria 2474
504 Ga0209281_1012323 3300027111 Bacteria 1881
505 Ga0209371_1000043 3300027312 Bacteria 331009
506 Ga0209371_1000067 3300027312 Bacteria 210294
507 Ga0209282_1000001 3300027666 Bacteria 2450367
508 Ga0209282_1005617 3300027666 Bacteria 7718
509 Ga0209588_1001412 3300027671 Bacteria 6261
510 Ga0268266_10000008 3300028379 Bacteria 1161875
511 Ga0268265_10076637 3300028380 Bacteria 2623
512 Ga0268264_10053834 3300028381 Bacteria 3359
513 Ga0268256_1000044 3300030500 Bacteria 330997
514 Ga0268256_1000078 3300030500 Bacteria 176504
515 Ga0307511_10000082 3300030521 Bacteria 80315
516 Ga0265332_10039573 3300031238 Bacteria 2042
517 Ga0307513_10062358 3300031456 Bacteria 3941
518 Ga0307513_10316342 3300031456 Bacteria 1321
519 Ga0307408_100000127 3300031548 Bacteria 84326
520 Ga0307408_100001493 3300031548 Bacteria 17356
521 Ga0307408_100001544 3300031548 Bacteria 17060
522 Ga0307408_100009312 3300031548 Bacteria 6474
523 Ga0307408_100064846 3300031548 Bacteria 2677
524 Ga0307408_100315282 3300031548 Bacteria 1315
525 Ga0265314_10091991 3300031711 Bacteria 1973
526 Ga0307405_10293315 3300031731 Bacteria 1230
527 Ga0307406_10003366 3300031901 Bacteria 8712
528 Ga0307412_10000376 3300031911 Bacteria 27824
529 Ga0307411_10029693 3300032005 Bacteria 3342
530 Ga0307411_10586479 3300032005 Bacteria 956
531 Ga0307507_10200140 3300033179 Bacteria 1383
532 Ga0373950_0003560 3300034818 Bacteria 2234
533 Ga0373926_0004635 3300035083 Bacteria 4515
534 Ga0373949_0010993 3300035090 Unclassified 1990
535 Ga0373936_0005893 3300035113 Bacteria 4613
536 Ga0373939_0002890 3300035114 Bacteria 4036
537 Ga0373945_0002958 3300035116 Bacteria 5340
538 Ga0373960_0003848 3300035121 Bacteria 3414
539 Ga0373943_0000070 3300035170 Bacteria 36396
540 Ga0373946_0006989 3300035171 Bacteria 4113
541 Ga0373961_0016276 3300035241 Bacteria 1914
542 Ga0373962_0018013 3300035242 Bacteria 1834
543 Ga0373931_0000340 3300035691 Bacteria 19340
544 Ga0373935_0016883 3300035692 Bacteria 4420
545 Ga0373927_0020709 3300035695 Bacteria 4312
546 Ga0373947_0001458 3300035725 Bacteria 14538
547 Ga0373925_0004088 3300037068 Bacteria 11075
548 Ga0395899_0000023 3300037312 Bacteria 367159
549 Ga0395899_0000153 3300037312 Bacteria 105214
550 Ga0395899_0000670 3300037312 Bacteria 34678
551 Ga0395900_0000019 3300037418 Bacteria 357240
552 Ga0395900_0000166 3300037418 Bacteria 107636
553 Ga0395900_0000858 3300037418 Bacteria 40064
554 Ga0395900_0107346 3300037418 Bacteria 2868
555 Ga0395900_0258410 3300037418 Bacteria 1740
556 Ga0395898_0000016 3300037466 Bacteria 435585
557 Ga0395898_0000637 3300037466 Bacteria 64022
558 Ga0395898_0024815 3300037466 Bacteria 6044
559 Ga0395898_0031953 3300037466 Bacteria 5256
560 Ga0395898_0083591 3300037466 Bacteria 3077
561 Ga0395905_0000989 3300037471 Bacteria 36379
562 Ga0395905_0001102 3300037471 Bacteria 33960
563 Ga0395905_0056648 3300037471 Bacteria 3666
564 Ga0395905_0077914 3300037471 Bacteria 3106
565 Ga0395905_0235481 3300037471 Bacteria 1712
566 Ga0395901_0001090 3300038443 Bacteria 28972
567 Ga0395901_0043521 3300038443 Bacteria 4657
568 Ga0436361_0133284 3300039447 Bacteria 12809
569 Ga0439436_0032713 3300041404 Bacteria 1507
570 Ga0439436_0056397 3300041404 Bacteria 1103
571 Ga0439447_010813 3300041407 Bacteria 2693
572 Ga0439461_0005688 3300041410 Bacteria 2139
573 Ga0439466_0009691 3300041411 Bacteria 3595
574 Ga0439442_032544 3300042002 Bacteria 1089
575 Ga0439448_0104069 3300042005 Bacteria 966
576 Ga0450923_010690 3300042125 Bacteria 1635
577 Ga0450898_042412 3300042134 Bacteria 864
578 Ga0450906_010839 3300042145 Bacteria 1714
579 Ga0450907_010393 3300042146 Bacteria 1545
580 Ga0439446_0000114 3300042156 Bacteria 13903
581 Ga0450908_004385 3300042184 Bacteria 2721
582 Ga0450909_007521 3300042185 Bacteria 1578
583 Ga0439434_0015648 3300042435 Bacteria 2262
584 Ga0450918_001884 3300042531 Bacteria 4058
585 Ga0451577_0005033 3300042876 Bacteria 13666
586 Ga0451577_0046868 3300042876 Bacteria 3865
587 Ga0451577_0057843 3300042876 Bacteria 3455
588 Ga0451577_0222431 3300042876 Unclassified 1706
589 Ga0453683_0032497 3300044673 Bacteria 3293
590 Ga0453683_0116617 3300044673 Bacteria 1680
591 Ga0453683_0148117 3300044673 Unclassified 1482
592 Ga0466965_0017603 3300044683 Bacteria 3418
593 Ga0466963_0088412 3300044694 Bacteria 2108
594 Ga0453684_0000014 3300044712 Bacteria 993311
595 Ga0453684_0017510 3300044712 Bacteria 11094
596 Ga0453684_0109875 3300044712 Bacteria 3352
597 Ga0453684_0270615 3300044712 Unclassified 1942
598 Ga0453684_0286578 3300044712 Bacteria 1876
599 Ga0466968_0015964 3300044735 Bacteria 2984
600 Ga0451576_0000787 3300045051 Bacteria 62334
601 Ga0451576_0008247 3300045051 Bacteria 12251
602 Ga0451576_0015427 3300045051 Bacteria 8464
603 Ga0451576_0184896 3300045051 Bacteria 2176
604 Ga0451576_0244417 3300045051 Bacteria 1875
605 Ga0451576_0325938 3300045051 Unclassified 1607
606 Ga0495617_013166 3300046452 Bacteria 2817
607 Ga0495592_0009846 3300046454 Bacteria 7196
608 Ga0495638_0003135 3300046460 Bacteria 13084
609 Ga0495651_0002288 3300046462 Bacteria 14778
610 Ga0495651_0093047 3300046462 Bacteria 2257
611 Ga0495651_0143381 3300046462 Bacteria 1729
612 Ga0495653_0003206 3300046463 Bacteria 13102
613 Ga0495650_0000226 3300046471 Bacteria 115930
614 Ga0495580_0020320 3300046472 Bacteria 4917
615 Ga0495605_0008558 3300046474 Bacteria 5783
616 Ga0495662_0018914 3300046476 Bacteria 3334
617 Ga0495584_0000016 3300046491 Bacteria 156560
618 Ga0495584_0043987 3300046491 Bacteria 2254
619 Ga0495584_0092751 3300046491 Bacteria 1524
620 Ga0495607_0000747 3300046501 Bacteria 31132
621 Ga0495607_0018267 3300046501 Bacteria 4474
622 Ga0495583_0000045 3300046506 Bacteria 220503
623 Ga0495583_0000633 3300046506 Bacteria 46837
624 Ga0495583_0000982 3300046506 Bacteria 32675
625 Ga0495606_0000066 3300046507 Bacteria 181028
626 Ga0495608_0006352 3300046511 Bacteria 8388
627 Ga0495610_0002725 3300046512 Bacteria 14529
628 Ga0495616_0013136 3300046513 Bacteria 4681
629 Ga0495628_0101498 3300046516 Bacteria 2220
630 Ga0495643_0000289 3300046522 Bacteria 71822
631 Ga0495643_0172733 3300046522 Bacteria 1056
632 Ga0495644_0004097 3300046523 Bacteria 5737
633 Ga0495648_0000245 3300046524 Bacteria 61457
634 Ga0495642_0113989 3300046528 Bacteria 1157
635 Ga0495652_0078832 3300046529 Bacteria 2725
636 Ga0495665_0013029 3300046531 Bacteria 4503
637 Ga0495609_0000072 3300046538 Bacteria 125273
638 Ga0495609_0000157 3300046538 Bacteria 70102
639 Ga0495597_0024457 3300046542 Bacteria 2787
640 Ga0495622_0032528 3300046557 Bacteria 2435
641 Ga0495633_0012382 3300046558 Bacteria 4539
642 Ga0495633_0015145 3300046558 Bacteria 4006
643 Ga0495668_0073258 3300046616 Bacteria 1881
644 Ga0495611_0009785 3300046648 Bacteria 4053
645 Ga0495625_0007610 3300046660 Bacteria 9405
646 Ga0495659_0000215 3300046664 Bacteria 24812
647 Ga0495659_0073650 3300046664 Bacteria 1284
648 Ga0495661_0020688 3300046665 Bacteria 4293
649 Ga0495661_0070233 3300046665 Bacteria 2050
650 Ga0495599_0015227 3300046678 Bacteria 4769
651 Ga0495623_0034769 3300046679 Bacteria 3231
652 Ga0495646_0136548 3300046680 Bacteria 1375
653 Ga0495669_0013365 3300046684 Bacteria 3496
654 Ga0495670_0017473 3300046691 Bacteria 3529
655 Ga0495671_0008870 3300046692 Bacteria 5648
656 Ga0495671_0018296 3300046692 Bacteria 3720
657 Ga0495649_0011319 3300046694 Bacteria 5237
658 Ga0495600_0083235 3300046809 Bacteria 2088
659 Ga0495604_0053502 3300047317 Bacteria 3119
660 Ga0495636_0000137 3300047318 Bacteria 29284
661 Ga0495636_0000276 3300047318 Bacteria 20170
662 Ga0495674_0081403 3300047319 Bacteria 2777
663 Ga0495672_0000291 3300047320 Bacteria 69062
664 Ga0495672_0028219 3300047320 Bacteria 3553
665 Ga0495683_0001436 3300047323 Bacteria 15674
666 Ga0495683_0099284 3300047323 Bacteria 1401
667 Ga0495687_000156 3300047443 Bacteria 103711
668 Ga0495687_001091 3300047443 Bacteria 26564
669 Ga0495677_0028309 3300047445 Bacteria 2034
670 Ga0495677_0044094 3300047445 Bacteria 1635
671 Ga0495685_000022 3300047447 Bacteria 71800
672 Ga0495673_0022746 3300047469 Bacteria 3066
673 Ga0495684_0003295 3300047471 Bacteria 12680
674 Ga0495602_0024840 3300048088 Bacteria 5808
675 Ga0495602_0155730 3300048088 Bacteria 1789
676 Ga0496101_0100597 3300048904 Bacteria 2163
677 Ga0496104_0009028 3300048907 Bacteria 8864
678 Ga0496107_0039327 3300048910 Bacteria 3393
679 Ga0496113_0096118 3300048916 Bacteria 2290
680 Ga0496116_0017933 3300048919 Bacteria 5474
681 Ga0496116_0019335 3300048919 Bacteria 5216
682 Ga0496116_0127284 3300048919 Bacteria 1460
683 Ga0496117_0000996 3300048920 Bacteria 43337
684 Ga0496117_0008586 3300048920 Bacteria 9682
685 Ga0496117_0022877 3300048920 Bacteria 5004
686 Ga0496117_0167036 3300048920 Bacteria 1282
687 Ga0496118_0006657 3300048921 Bacteria 12608
688 Ga0496118_0016297 3300048921 Bacteria 6823
689 Ga0496118_0052096 3300048921 Bacteria 3125
690 Ga0496118_0086174 3300048921 Bacteria 2183
691 Ga0496118_0121881 3300048921 Bacteria 1697
692 Ga0496119_0186176 3300048922 Bacteria 1085
693 Ga0496121_0007798 3300048924 Bacteria 12818
694 Ga0496121_0029198 3300048924 Bacteria 5109
695 Ga0496124_0016240 3300048927 Bacteria 7092
696 Ga0496125_0000338 3300048928 Bacteria 89749
697 Ga0496125_0059624 3300048928 Bacteria 3074
698 Ga0496125_0074716 3300048928 Bacteria 2627
699 Ga0496125_0128172 3300048928 Bacteria 1793
700 Ga0495678_001681 3300049459 Bacteria 16787
701 Ga0495682_0002722 3300049460 Bacteria 8200
702 Ga0495682_0026192 3300049460 Bacteria 2167
703 Ga0501297_001698 3300049520 Bacteria 2057
704 Ga0501300_005523 3300049523 Bacteria 1861
705 Ga0501222_004083 3300049662 Bacteria 1980
706 Ga0501222_004818 3300049662 Bacteria 1834
707 Ga0501223_003578 3300049663 Bacteria 3362
708 Ga0501223_005650 3300049663 Bacteria 2618
709 Ga0501227_012221 3300049665 Bacteria 1878
710 Ga0501233_010399 3300049668 Bacteria 1832
711 Ga0501235_004673 3300049669 Bacteria 2961
712 Ga0501255_004054 3300049684 Bacteria 1395
713 Ga0501221_001071 3300049704 Bacteria 4496
714 Ga0501229_000091 3300049706 Bacteria 9342
715 Ga0501262_003913 3300049759 Bacteria 1717
716 Ga0501266_000886 3300049763 Bacteria 3888
717 Ga0501272_000534 3300049769 Bacteria 3372
718 Ga0501279_001288 3300049775 Bacteria 3301
719 Ga0501280_000143 3300049776 Bacteria 18608
720 Ga0501282_001025 3300049778 Bacteria 3163
721 Ga0501282_006400 3300049778 Bacteria 1259
722 nmdc:mga03683_57378_c1 3300050489 Bacteria 1639
723 nmdc:mga00v17_213122_c1 3300050491 Bacteria 1250
724 nmdc:mga00v17_46933_c1 3300050491 Bacteria 2615
725 nmdc:mga0k408_151128_c1 3300050493 Bacteria 1383
726 nmdc:mga0k408_15379_c1 3300050493 Bacteria 4231
727 nmdc:mga0k408_184593_c1 3300050493 Bacteria 1244
728 nmdc:mga0k408_30100_c1 3300050493 Bacteria 3093
729 nmdc:mga0k408_3828_c1 3300050493 Bacteria 7979
730 nmdc:mga0k408_74831_c1 3300050493 Bacteria 1367
731 nmdc:mga07m45_11798_c1 3300050496 Bacteria 4600
732 nmdc:mga07m45_1908_c1 3300050496 Bacteria 9620
733 nmdc:mga07m45_212851_c1 3300050496 Bacteria 1124
734 nmdc:mga07m45_22004_c1 3300050496 Bacteria 3479
735 nmdc:mga07m45_4672_c1 3300050496 Bacteria 6722
736 nmdc:mga07m45_86078_c1 3300050496 Bacteria 1798
737 nmdc:mga07m45_94519_c1 3300050496 Bacteria 1714
738 nmdc:mga05p37_51053_c1 3300050507 Bacteria 5087
739 nmdc:mga05p37_80836_c1 3300050507 Bacteria 4003
740 nmdc:mga0n895_378600_c1 3300050512 Unclassified 1432
741 nmdc:mga0a205_553231_c1 3300050515 Unclassified 1006
742 Ga0500644_0001588 3300053088 Bacteria 5947
743 Ga0500651_0011712 3300053093 Bacteria 5297
744 Ga0500566_0106460 3300053094 Bacteria 1530
745 Ga0500650_0020046 3300053098 Bacteria 2929
746 Ga0500556_0195544 3300053104 Bacteria 799
747 Ga0500593_000196 3300053117 Bacteria 24504
748 Ga0500595_004466 3300053119 Bacteria 6270
749 Ga0500658_0004895 3300053134 Bacteria 4993
750 Ga0500619_006744 3300053154 Bacteria 2668
751 Ga0500620_000108 3300053155 Bacteria 16359
752 Ga0500634_0000067 3300053161 Bacteria 43218
753 2509368617 2509276018 Bacteria 6910194
754 2510252018 2510065045 Bacteria 7761063
755 2511244945 2511231002 Bacteria 5042903
756 2512932424 2512875016 Bacteria 6529530
757 2512960441 2512875024 Bacteria 7195110
758 2513230904 2513020051 Bacteria 6053213
759 2513912089 2513237144 Bacteria 7530820
760 2514590896 2513237351 Bacteria 6968952
761 2515692237 2515154123 Bacteria 6387382
762 2516024626 2515154189 Bacteria 9629850
763 2527078179 2526164713 Bacteria 6780608
764 2563056007 2562617112 Bacteria 10918404
765 2587760172 2585428062 Bacteria 6842168
766 2597811883 2597489875 Bacteria 7010078
767 2599446324 2599185178 Bacteria 5365746
768 2599745033 2599185240 Bacteria 7968121
769 2600206786 2599185355 Bacteria 7968906
770 2643786894 2643221554 Bacteria 6603920
771 2644160189 2643221628 Bacteria 5745828
772 2644244395 2643221644 Bacteria 6865017
773 2644329641 2643221658 Bacteria 6064537
774 2644398557 2643221672 Bacteria 6322190
775 2676743239 2675903129 Bacteria 7964495
776 2713472209 2711768613 Bacteria 11048459
777 2756671665 2756170246 Bacteria 7451806
778 2774388028 2773857761 Bacteria 3837365
779 2792834467 2791355137 Bacteria 9654227
780 2809130814 2808606415 Bacteria 4576710
781 2809150851 2808606419 Bacteria 4576925
782 2812366748 2811994881 Bacteria 6298475
783 2819540944 2818991436 Bacteria 5376622
784 2841736759 2841734538 Bacteria 6784580
785 2844008418 2844002411 Bacteria 7168230
786 2844010685 2844009547 Bacteria 6728125
787 2852622372 2852618963 Bacteria 4577824
788 2854602087 2854601825 Bacteria 4797592
789 2856355948 2856349417 Bacteria 6230045
790 2856364264 2856356410 Bacteria 6297484
791 2856368154 2856364286 Bacteria 6939991
792 2869176953 2869169390 Bacteria 6659796
793 2869240227 2869234852 Bacteria 6654993
794 2869242771 2869242130 Bacteria 6609239
795 2869254671 2869249662 Bacteria 6868783
796 2869263195 2869256925 Bacteria 6981691
797 2869265225 2869264136 Bacteria 6880765
798 2869290227 2869285874 Bacteria 6901219
799 2871432511 2871429161 Bacteria 6547891
800 2871442963 2871435913 Bacteria 6880295
801 2871453692 2871451962 Bacteria 7336357
802 2871466228 2871459585 Bacteria 6866887
803 2871478237 2871474448 Bacteria 6806570
804 2871485209 2871481445 Bacteria 6700002
805 2871493117 2871488783 Bacteria 6929816
806 2874109573 2874109183 Bacteria 6517025
807 2874118128 2874116593 Bacteria 6674494
808 2874126382 2874123672 Bacteria 7238285
809 2874134887 2874131515 Bacteria 6820270
810 2874152478 2874146452 Bacteria 7533118
811 2874159878 2874155637 Bacteria 6724144
812 2874223974 2874220319 Bacteria 4594709
813 2876389843 2876386047 Bacteria 6698674
814 2876418394 2876413966 Bacteria 6831344
815 2878735856 2878730984 Bacteria 6380721
816 2878750125 2878745973 Bacteria 6867388
817 2878757162 2878753008 Bacteria 6922523
818 2878784206 2878781027 Bacteria 6834456
819 2881157993 2881155292 Bacteria 6461656
820 2881848546 2881845957 Bacteria 6611900
821 2881867698 2881861095 Bacteria 7128710
822 2882915352 2882912400 Bacteria 6801539
823 2885311367 2885305155 Bacteria 7348390
824 2885316408 2885312484 Bacteria 6415165
825 2885332892 2885326080 Bacteria 7134805
826 2888344742 2888343758 Bacteria 6611049
827 2889012980 2889010040 Bacteria 6749192
828 2889795089 2889790730 Bacteria 5689708
829 2889918184 2889914905 Bacteria 5702301
830 2900581743 2900577576 Bacteria 5438534
831 2903497814 2903492973 Bacteria 13473544
832 2903500889 2903492973 Bacteria 13473544
833 2903520455 2903513507 Bacteria 6344008
834 2904616653 2904615490 Bacteria 10047340
835 2906312483 2906308376 Bacteria 6841989
836 2906325192 2906321335 Bacteria 6579571
837 2906370532 2906363423 Bacteria 6856682
838 2906375097 2906370794 Bacteria 6881062
839 2906395456 2906393657 Bacteria 6790866
840 2906406269 2906401398 Bacteria 6693206
841 2906430594 2906427513 Bacteria 6375796
842 2919090083 2919089067 Bacteria 4560942
843 2919182584 2919182534 Bacteria 3907101
844 2919454086 2919450847 Bacteria 5631160
845 2919479517 2919476304 Bacteria 5888696
846 2919498258 2919497567 Bacteria 4408621
847 2921654770 2921643360 Bacteria 11448031
848 2922132618 2922130491 Bacteria 7173936
849 2922158163 2922151315 Bacteria 6902399
850 2923520782 2923519811 Bacteria 6298479
851 2924741686 2924741084 Bacteria 6661321
852 2924760645 2924754689 Bacteria 6774424
853 2928059468 2928058823 Bacteria 5520022
854 2928069609 2928064002 Bacteria 7419480
855 2928498052 2928496128 Bacteria 4631123
856 2937819372 2937813078 Bacteria 7783518
857 2937828198 2937822353 Bacteria 7290551
858 2937839190 2937836603 Bacteria 6811263
859 2937847901 2937843397 Bacteria 5256375
860 2937864669 2937861824 Bacteria 6660327
861 2937871290 2937868953 Bacteria 6639878
862 2958044555 2958041894 Bacteria 13082850
863 2958069129 2958064165 Bacteria 7158582
864 2958073027 2958071322 Bacteria 6815895
865 2958092815 2958092219 Bacteria 6861151
866 2958114623 2958108152 Bacteria 6681128
867 2958126100 2958122699 Bacteria 7280457
868 2958134615 2958130278 Bacteria 6897202
869 2958143241 2958137437 Bacteria 6050276
870 2958164871 2958158011 Bacteria 6058449
871 2958181096 2958179912 Bacteria 6874908
872 2961050738 2961047084 Bacteria 4594415
873 2961078932 2961077736 Bacteria 7079850
874 2961139120 2961136820 Bacteria 6775228
875 2961175509 2961170736 Bacteria 7072258
876 2961185689 2961183825 Bacteria 6688536
877 2965030090 2965025482 Bacteria 6532201
878 2965034436 2965032056 Bacteria 6887443
879 2965042940 2965040258 Bacteria 6855979
880 2965053411 2965047637 Bacteria 6623551
881 2965092526 2965089291 Bacteria 6866420
882 2965107146 2965102966 Bacteria 6800987
883 2965116418 2965110997 Bacteria 6693150
884 2967999489 2967996073 Bacteria 6787468
885 2968007847 2968003550 Bacteria 6929263
886 2968142356 2968138860 Bacteria 6605449
887 2970492479 2970489779 Bacteria 6517260
888 2970508097 2970503327 Bacteria 7099517
889 2970518040 2970510686 Bacteria 7006402
890 2970526474 2970524798 Bacteria 6840927
891 2970536366 2970532167 Bacteria 6553173
892 2970540597 2970540015 Bacteria 6977556
893 2970550209 2970547951 Bacteria 6931819
894 2970621166 2970619444 Bacteria 6986144
895 2970628347 2970627176 Bacteria 6680862
896 2974322216 2974320154 Bacteria 4571377
897 2977826321 2977821940 Bacteria 6906439
898 2977832198 2977828996 Bacteria 7007971
899 2977848271 2977843712 Bacteria 6753583
900 2977856038 2977851361 Bacteria 6694324
901 2977873449 2977872689 Bacteria 7270173
902 2977904044 2977898635 Bacteria 6675551
903 2977913130 2977907340 Bacteria 6577984
904 2977920812 2977915119 Bacteria 6829656
905 2977938272 2977935797 Bacteria 6252826
906 2977950746 2977950692 Bacteria 6893264
907 2977961403 2977957713 Bacteria 6877875
908 2979767908 2979764755 Bacteria 6610066
909 2979777015 2979772303 Bacteria 6618277
910 2979798857 2979793036 Bacteria 6808957
911 2979813281 2979808191 Bacteria 7179355
912 2987645556 2987645492 Bacteria 6117018
913 2987658657 2987652177 Bacteria 6969023
914 2987679394 2987673487 Bacteria 6884027
915 2996390474 2996386984 Bacteria 6978667
916 3000140031 3000135777 Bacteria 6891109
917 3004197914 3004195979 Bacteria 6776956
918 3004239349 3004232784 Bacteria 6662140
919 3004242497 3004239961 Bacteria 6892290
920 3004253408 3004248173 Bacteria 6563236
921 3004269305 3004268573 Bacteria 7043476
922 3004335571 3004334049 Bacteria 8449246
923 642418605 641736154 Bacteria 7689995
924 642595320 642555112 Bacteria 8676562
925 649870440 649633066 Bacteria 6690028
926 8004303096 8004300914 Bacteria 6132239
927 8004316201 8004312739 Bacteria 7444653
928 8004364799 8004361976 Bacteria 6858373
929 8004378737 8004374579 Bacteria 6898112
930 8004392433 8004387939 Bacteria 7049250
931 8004633272 8004633249 Bacteria 6723080
932 8004696082 8004695233 Bacteria 6731676
933 8004718742 8004714634 Bacteria 6776161
934 8004729012 8004727605 Bacteria 6643904
935 8020941353 8020938398 Bacteria 7472757
936 8020956690 8020953355 Bacteria 7439080
937 8055271088 8055266321 Bacteria 7999742
938 8055306920 8055301274 Bacteria 8587385
939 Ga0105238_10012593
940 JGI24740J21852_10000061
941 JGI24740J21852_10000399
942 JGI24740J21852_10002819
943 JGI24739J22299_10000076
944 JGI24739J22299_10002903
945 JGI24739J22299_10003435
946 JGI24739J22299_10020345
947 JGI24737J22298_10000304
948 JGI24735J21928_10000201
949 JGI24735J21928_10000454
950 JGI24735J21928_10014636
951 JGI25155J39150_1000039
952 JGI25156J39149_1000096
953 JGI25156J39149_1009783
954 JGI25156J39149_1011488
955 JGI25154J39366_1000077
956 JGI25154J39366_1000148
957 JGI25154J39366_1000725
958 JGI25154J39366_1004071
959 JGI25154J39366_1010875
960 JGI25158J39367_1001215
961 JGI25157J39369_1000065
962 JGI25157J39369_1000573
963 JGI25157J39369_1001461
964 JGI25152J39213_1000003
965 JGI25150J39212_1000035
966 JGI25150J39212_1000446
967 JGI25150J39212_1003091
968 JGI25150J39212_1010085
969 JGI25150J39212_1016234
970 JGI25159J45721_1001030
971 JGI25151J46595_10003534
972 JGI25153J46596_10000046
973 JGI25153J46596_10010646
974 JGI25153J46596_10022613
975 rootH1_10178903
976 rootH1_10183483
977 JGI25160J50197_1034153
978 Ga0006562J51391_1055123
979 Ga0006562J51391_1055124
980 Ga0055538_1003839
981 Ga0055539_1000059
982 Ga0055539_1000692
983 Ga0055533_1000664
984 Ga0055533_1000803
985 Ga0055532_1000005
986 Ga0055532_1000025
987 Ga0055532_1001236
988 Ga0055525_1000207
989 Ga0055525_1000447
990 Ga0055527_1000108
991 Ga0055527_1000336
992 Ga0055527_1000901
993 Ga0055527_1003809
994 Ga0055535_1000019
995 Ga0055535_1000080
996 Ga0055535_1000712
997 Ga0055535_1000899
998 Ga0055535_1002175
999 Ga0055535_1002380
1000 Ga0055535_1012321
1001 Ga0055542_1000577
1002 Ga0055542_1000764
1003 Ga0055542_1000773
1004 Ga0055542_1000898
1005 Ga0055542_1002053
1006 Ga0055529_1000035
1007 Ga0055529_1000064
1008 Ga0055529_1000172
1009 Ga0055529_1000613
1010 Ga0055529_1000665
1011 Ga0055529_1000686
1012 Ga0055526_1000089
1013 Ga0055526_1001925
1014 Ga0055537_1000046
1015 Ga0055537_1000064
1016 Ga0055537_1004523
1017 Ga0055537_1015409
1018 Ga0055524_1000012
1019 Ga0055524_1002020
1020 Ga0055524_1008763
1021 Ga0055524_1035429
1022 Ga0055536_1003378
1023 Ga0055536_1005290
1024 Ga0055534_1000094
1025 Ga0055534_1000446
1026 Ga0055534_1007964
1027 Ga0055528_1000142
1028 Ga0055528_1000250
1029 Ga0055528_1001134
1030 Ga0055528_1015750
1031 Ga0055528_1024132
1032 Ga0055530_10000015
1033 Ga0055530_10002108
1034 Ga0055530_10003589
1035 Ga0055530_10004951
1036 Ga0055530_10004954
1037 Ga0055540_1000039
1038 Ga0055540_1001343
1039 Ga0055531_10001229
1040 Ga0055531_10002703
1041 Ga0055531_10003176
1042 Ga0055531_10016754
1043 Ga0055531_10025689
1044 Ga0055531_10028559
1045 Ga0055541_1001078
1046 Ga0055541_1005811
1047 Ga0055541_1007353
1048 Ga0058692_1000035
1049 Ga0065165_1019916
1050 Ga0065165_1052000
1051 Ga0065704_10004493
1052 Ga0065707_10236624
1053 Ga0070658_10099137
1054 Ga0070690_100063390
1055 Ga0070682_100092374
1056 Ga0070660_100180758
1057 Ga0070660_100244152
1058 Ga0070661_100000192
1059 Ga0070661_100289858
1060 Ga0070661_100335551
1061 Ga0070673_100527205
1062 Ga0070659_100016932
1063 Ga0070667_100281583
1064 Ga0070714_100007578
1065 Ga0070713_100047670
1066 Ga0070708_100259188
1067 Ga0070663_100000009
1068 Ga0070663_100002493
1069 Ga0070678_100173468
1070 Ga0070706_100689778
1071 Ga0070707_100000050
1072 Ga0070707_100013883
1073 Ga0068853_100005429
1074 Ga0068853_100044371
1075 Ga0068853_100047285
1076 Ga0068853_100080874
1077 Ga0068853_100169119
1078 Ga0068853_100243994
1079 Ga0070696_100003577
1080 Ga0070693_100003915
1081 Ga0070665_100000220
1082 Ga0068855_100048863
1083 Ga0068855_100256025
1084 Ga0068855_100266042
1085 Ga0068855_100337859
1086 Ga0068855_100391040
1087 Ga0070664_100000200
1088 Ga0068857_100000118
1089 Ga0068857_100000300
1090 Ga0068857_100033961
1091 Ga0068857_100240893
1092 Ga0068857_100258624
1093 Ga0068854_100000017
1094 Ga0068854_100002114
1095 Ga0068854_100026322
1096 Ga0068854_100036364
1097 Ga0068854_100086608
1098 Ga0068856_100000069
1099 Ga0068856_100008554
1100 Ga0068856_100057987
1101 Ga0068856_100125992
1102 Ga0068856_100130944
1103 Ga0068856_100164875
1104 Ga0068856_100232050
1105 Ga0068852_100010857
1106 Ga0068852_100019054
1107 Ga0068852_100055638
1108 Ga0068864_100020667
1109 Ga0068861_100316122
1110 Ga0068851_10009946
1111 Ga0068863_100326424
1112 Ga0068858_100082199
1113 Ga0068860_100176728
1114 Ga0068860_100365447
1115 Ga0081455_10003754
1116 Ga0075368_10056409
1117 Ga0075363_100009812
1118 Ga0075364_10010108
1119 Ga0075364_10016634
1120 Ga0075364_10077748
1121 Ga0075362_10005736
1122 Ga0075362_10052084
1123 Ga0075367_10086159
1124 Ga0075367_10236545
1125 Ga0075366_10031852
1126 Ga0075366_10159414
1127 Ga0075366_10244640
1128 Ga0097621_100111794
1129 Ga0075370_10000478
1130 Ga0075370_10001797
1131 Ga0075370_10002208
1132 Ga0075370_10061400
1133 Ga0075370_10089556
1134 Ga0075370_10100854
1135 Ga0075370_10118051
1136 Ga0075370_10181617
1137 Ga0075433_10033333
1138 Ga0075434_100380900
1139 Ga0099826_10000002
1140 Ga0099826_10123691
1141 Ga0099794_10041823
1142 Ga0105244_10002796
1143 Ga0105244_10014339
1144 Ga0105240_10001373
1145 Ga0105240_10007869
1146 Ga0105240_10015313
1147 Ga0105240_10101731
1148 Ga0105240_10185957
1149 Ga0105240_10236925
1150 Ga0105240_10491616
1151 Ga0105245_10054669
1152 Ga0105245_10080505
1153 Ga0105247_10059139
1154 Ga0114129_10034549
1155 Ga0114129_10450022
1156 Ga0105243_10001884
1157 Ga0105243_10080551
1158 Ga0105241_10092987
1159 Ga0105248_10383016
1160 Ga0105237_10000063
1161 Ga0105237_10002287
1162 Ga0105237_10008414
1163 Ga0105237_10257281
1164 Ga0105237_10302147
1165 Ga0105238_10003995
1166 Ga0105238_10009539
1167 Ga0105238_10154003
1168 Ga0105238_10283280
1169 Ga0105249_10031041
1170 Ga0105239_10001649
1171 Ga0105239_10089272
1172 Ga0105239_10091015
1173 Ga0105239_10186106
1174 Ga0105239_10228300
1175 Ga0105239_10309436
1176 Ga0105246_10043190
1177 Ga0105246_10044367
1178 Ga0105246_10235199
1179 Ga0157319_1000008
1180 Ga0157314_1000500
1181 Ga0157373_10021453
1182 Ga0157373_10036397
1183 Ga0157373_10167305
1184 Ga0157373_10486471
1185 Ga0157371_10000033
1186 Ga0157370_10000010
1187 Ga0157370_10050072
1188 Ga0157370_10171700
1189 Ga0157370_10439286
1190 Ga0157369_10011384
1191 Ga0157369_10067951
1192 Ga0157369_10076620
1193 Ga0157374_10657418
1194 Ga0157372_10000176
1195 Ga0157372_10008352
1196 Ga0157372_10284402
1197 Ga0157372_10748345
1198 Ga0157372_10811878
1199 Ga0157375_10735423
1200 Ga0157380_10492263
1201 Ga0182008_10000920
1202 Ga0182008_10007295
1203 Ga0182008_10027139
1204 Ga0182008_10142036
1205 Ga0157379_10028052
1206 Ga0157376_10345446
1207 Ga0182006_1000019
1208 Ga0182006_1000198
1209 Ga0182006_1000675
1210 Ga0182006_1007099
1211 Ga0182006_1013260
1212 Ga0182006_1018614
1213 Ga0182006_1042845
1214 Ga0182006_1045281
1215 Ga0182007_10000671
1216 Ga0182007_10006301
1217 Ga0182007_10015627
1218 Ga0182007_10026923
1219 Ga0182005_1000005
1220 Ga0182005_1000902
1221 Ga0163161_10002721
1222 Ga0154015_1514660
1223 Ga0209435_100043
1224 Ga0209435_100050
1225 Ga0209435_100092
1226 Ga0209436_102805
1227 Ga0209784_100008
1228 Ga0209784_100172
1229 Ga0209784_101451
1230 Ga0209566_100006
1231 Ga0209566_100194
1232 Ga0209566_101022
1233 Ga0209674_100045
1234 Ga0209674_100049
1235 Ga0209674_100114
1236 Ga0209674_100283
1237 Ga0209674_103302
1238 Ga0209672_100025
1239 Ga0209672_100058
1240 Ga0209672_100100
1241 Ga0209672_100103
1242 Ga0209672_100260
1243 Ga0209672_105493
1244 Ga0209147_100005
1245 Ga0209147_100011
1246 Ga0209147_100032
1247 Ga0209563_100016
1248 Ga0209563_100150
1249 Ga0209563_105627
1250 Ga0209258_100007
1251 Ga0209258_100024
1252 Ga0209258_100050
1253 Ga0209258_100124
1254 Ga0209258_100164
1255 Ga0209258_100232
1256 Ga0209258_100401
1257 Ga0209258_100991
1258 Ga0207425_1000014
1259 Ga0207425_1000036
1260 Ga0207425_1000119
1261 Ga0207425_1000269
1262 Ga0209646_1000027
1263 Ga0209646_1000105
1264 Ga0209646_1000161
1265 Ga0209646_1000546
1266 Ga0209646_1015973
1267 Ga0209026_1000061
1268 Ga0209026_1000173
1269 Ga0209026_1000590
1270 Ga0209026_1001604
1271 Ga0209026_1002727
1272 Ga0209026_1003847
1273 Ga0209677_100008
1274 Ga0209677_105461
1275 Ga0209148_1000009
1276 Ga0209148_1000019
1277 Ga0209148_1000039
1278 Ga0209148_1000060
1279 Ga0209148_1000206
1280 Ga0209148_1009855
1281 Ga0209759_1000041
1282 Ga0209759_1000169
1283 Ga0209759_1000426
1284 Ga0209759_1000865
1285 Ga0209759_1000893
1286 Ga0209759_1001528
1287 Ga0209759_1002160
1288 Ga0209759_1008283
1289 Ga0209759_1010122
1290 Ga0209129_1000017
1291 Ga0209129_1000538
1292 Ga0209129_1001239
1293 Ga0209129_1021217
1294 Ga0209233_1005033
1295 Ga0209565_1000004
1296 Ga0209565_1000025
1297 Ga0209565_1000741
1298 Ga0209565_1001718
1299 Ga0209565_1005817
1300 Ga0209565_1009678
1301 Ga0209565_1018473
1302 Ga0209455_1000011
1303 Ga0209455_1000029
1304 Ga0209455_1000034
1305 Ga0209455_1000055
1306 Ga0209455_1000111
1307 Ga0209455_1000114
1308 Ga0209455_1000179
1309 Ga0209455_1014013
1310 Ga0209673_1000149
1311 Ga0209673_1000221
1312 Ga0209673_1000986
1313 Ga0209673_1012476
1314 Ga0209130_1000379
1315 Ga0209130_1005218
1316 Ga0209130_1009348
1317 Ga0209675_1000017
1318 Ga0209675_1000061
1319 Ga0209675_1000856
1320 Ga0209675_1010031
1321 Ga0209675_1036130
1322 Ga0209676_1000007
1323 Ga0209676_1000437
1324 Ga0209676_1022664
1325 Ga0209025_1001820
1326 Ga0209025_1012575
1327 Ga0209025_1023855
1328 Ga0209025_1025801
1329 Ga0209025_1029526
1330 Ga0209564_1000299
1331 Ga0209564_1000934
1332 Ga0209564_1002212
1333 Ga0209564_1033912
1334 Ga0209758_1000038
1335 Ga0209758_1000124
1336 Ga0209758_1000221
1337 Ga0209758_1000483
1338 Ga0209758_1002033
1339 Ga0209758_1005840
1340 Ga0209758_1013005
1341 Ga0209758_1020327
1342 Ga0209050_1000003
1343 Ga0209050_1000040
1344 Ga0209050_1000089
1345 Ga0209050_1000723
1346 Ga0209050_1001052
1347 Ga0209050_1003969
1348 Ga0209050_1034769
1349 Ga0209256_1000001
1350 Ga0209256_1000138
1351 Ga0209256_1026782
1352 Ga0207426_1002343
1353 Ga0207426_1004319
1354 Ga0209051_1000003
1355 Ga0209051_1000312
1356 Ga0209051_1006484
1357 Ga0209051_1049583
1358 Ga0209257_1000018
1359 Ga0209257_1000053
1360 Ga0209257_1000054
1361 Ga0209257_1000504
1362 Ga0209257_1000669
1363 Ga0209257_1001206
1364 Ga0209257_1005453
1365 Ga0209257_1007376
1366 Ga0207656_10012230
1367 Ga0207655_1027498
1368 Ga0207655_1052667
1369 Ga0207710_10015889
1370 Ga0207680_10010971
1371 Ga0207647_10000504
1372 Ga0207647_10005351
1373 Ga0207647_10055928
1374 Ga0207647_10104630
1375 Ga0207654_10131677
1376 Ga0207695_10000372
1377 Ga0207695_10000664
1378 Ga0207695_10001246
1379 Ga0207695_10002167
1380 Ga0207695_10003529
1381 Ga0207695_10007941
1382 Ga0207695_10095287
1383 Ga0207695_10185980
1384 Ga0207671_10000021
1385 Ga0207671_10002068
1386 Ga0207671_10005943
1387 Ga0207671_10021681
1388 Ga0207671_10291441
1389 Ga0207671_10340845
1390 Ga0207662_10170889
1391 Ga0207657_10183638
1392 Ga0207657_10353105
1393 Ga0207649_10000191
1394 Ga0207649_10055829
1395 Ga0207649_10131067
1396 Ga0207646_10000037
1397 Ga0207694_10000364
1398 Ga0207694_10015720
1399 Ga0207694_10027336
1400 Ga0207694_10202457
1401 Ga0207687_10049240
1402 Ga0207664_10117273
1403 Ga0207690_10003114
1404 Ga0207706_10016628
1405 Ga0207689_10048662
1406 Ga0207679_10000002
1407 Ga0207679_10069409
1408 Ga0207667_10000198
1409 Ga0207667_10026299
1410 Ga0207667_10069528
1411 Ga0207712_10135148
1412 Ga0207640_10000138
1413 Ga0207640_10001942
1414 Ga0207640_10008907
1415 Ga0207640_10036039
1416 Ga0207640_10042659
1417 Ga0207658_10152568
1418 Ga0207658_10510285
1419 Ga0207703_10600380
1420 Ga0207639_10002600
1421 Ga0207639_10051425
1422 Ga0207639_10053382
1423 Ga0207639_10121679
1424 Ga0207678_10000015
1425 Ga0207678_10005311
1426 Ga0207702_10000308
1427 Ga0207702_10000864
1428 Ga0207702_10001120
1429 Ga0207702_10032104
1430 Ga0207702_10133825
1431 Ga0207702_10188207
1432 Ga0207641_10341276
1433 Ga0207674_10000623
1434 Ga0207674_10165891
1435 Ga0207674_10270670
1436 Ga0207674_10276291
1437 Ga0207674_10466978
1438 Ga0207698_10027182
1439 Ga0207698_10041658
1440 Ga0207698_10085970
1441 Ga0207698_10093021
1442 Ga0209281_1012323
1443 Ga0209371_1000043
1444 Ga0209371_1000067
1445 Ga0209282_1000001
1446 Ga0209282_1005617
1447 Ga0209588_1001412
1448 Ga0268266_10000008
1449 Ga0268265_10076637
1450 Ga0268264_10053834
1451 Ga0268256_1000044
1452 Ga0268256_1000078
1453 Ga0307511_10000082
1454 Ga0265332_10039573
1455 Ga0307513_10062358
1456 Ga0307513_10316342
1457 Ga0307408_100000127
1458 Ga0307408_100001493
1459 Ga0307408_100001544
1460 Ga0307408_100009312
1461 Ga0307408_100064846
1462 Ga0307408_100315282
1463 Ga0265314_10091991
1464 Ga0307405_10293315
1465 Ga0307406_10003366
1466 Ga0307412_10000376
1467 Ga0307411_10029693
1468 Ga0307411_10586479
1469 Ga0307507_10200140
1470 Ga0373950_0003560
1471 Ga0373926_0004635
1472 Ga0373949_0010993
1473 Ga0373936_0005893
1474 Ga0373939_0002890
1475 Ga0373945_0002958
1476 Ga0373960_0003848
1477 Ga0373943_0000070
1478 Ga0373946_0006989
1479 Ga0373961_0016276
1480 Ga0373962_0018013
1481 Ga0373931_0000340
1482 Ga0373935_0016883
1483 Ga0373927_0020709
1484 Ga0373947_0001458
1485 Ga0373925_0004088
1486 Ga0395899_0000023
1487 Ga0395899_0000153
1488 Ga0395899_0000670
1489 Ga0395900_0000019
1490 Ga0395900_0000166
1491 Ga0395900_0000858
1492 Ga0395900_0107346
1493 Ga0395900_0258410
1494 Ga0395898_0000016
1495 Ga0395898_0000637
1496 Ga0395898_0024815
1497 Ga0395898_0031953
1498 Ga0395898_0083591
1499 Ga0395905_0000989
1500 Ga0395905_0001102
1501 Ga0395905_0056648
1502 Ga0395905_0077914
1503 Ga0395905_0235481
1504 Ga0395901_0001090
1505 Ga0395901_0043521
1506 Ga0436361_0133284
1507 Ga0439436_0032713
1508 Ga0439436_0056397
1509 Ga0439447_010813
1510 Ga0439461_0005688
1511 Ga0439466_0009691
1512 Ga0439442_032544
1513 Ga0439448_0104069
1514 Ga0450923_010690
1515 Ga0450898_042412
1516 Ga0450906_010839
1517 Ga0450907_010393
1518 Ga0439446_0000114
1519 Ga0450908_004385
1520 Ga0450909_007521
1521 Ga0439434_0015648
1522 Ga0450918_001884
1523 Ga0451577_0005033
1524 Ga0451577_0046868
1525 Ga0451577_0057843
1526 Ga0451577_0222431
1527 Ga0453683_0032497
1528 Ga0453683_0116617
1529 Ga0453683_0148117
1530 Ga0466965_0017603
1531 Ga0466963_0088412
1532 Ga0453684_0000014
1533 Ga0453684_0017510
1534 Ga0453684_0109875
1535 Ga0453684_0270615
1536 Ga0453684_0286578
1537 Ga0466968_0015964
1538 Ga0451576_0000787
1539 Ga0451576_0008247
1540 Ga0451576_0015427
1541 Ga0451576_0184896
1542 Ga0451576_0244417
1543 Ga0451576_0325938
1544 Ga0495617_013166
1545 Ga0495592_0009846
1546 Ga0495638_0003135
1547 Ga0495651_0002288
1548 Ga0495651_0093047
1549 Ga0495651_0143381
1550 Ga0495653_0003206
1551 Ga0495650_0000226
1552 Ga0495580_0020320
1553 Ga0495605_0008558
1554 Ga0495662_0018914
1555 Ga0495584_0000016
1556 Ga0495584_0043987
1557 Ga0495584_0092751
1558 Ga0495607_0000747
1559 Ga0495607_0018267
1560 Ga0495583_0000045
1561 Ga0495583_0000633
1562 Ga0495583_0000982
1563 Ga0495606_0000066
1564 Ga0495608_0006352
1565 Ga0495610_0002725
1566 Ga0495616_0013136
1567 Ga0495628_0101498
1568 Ga0495643_0000289
1569 Ga0495643_0172733
1570 Ga0495644_0004097
1571 Ga0495648_0000245
1572 Ga0495642_0113989
1573 Ga0495652_0078832
1574 Ga0495665_0013029
1575 Ga0495609_0000072
1576 Ga0495609_0000157
1577 Ga0495597_0024457
1578 Ga0495622_0032528
1579 Ga0495633_0012382
1580 Ga0495633_0015145
1581 Ga0495668_0073258
1582 Ga0495611_0009785
1583 Ga0495625_0007610
1584 Ga0495659_0000215
1585 Ga0495659_0073650
1586 Ga0495661_0020688
1587 Ga0495661_0070233
1588 Ga0495599_0015227
1589 Ga0495623_0034769
1590 Ga0495646_0136548
1591 Ga0495669_0013365
1592 Ga0495670_0017473
1593 Ga0495671_0008870
1594 Ga0495671_0018296
1595 Ga0495649_0011319
1596 Ga0495600_0083235
1597 Ga0495604_0053502
1598 Ga0495636_0000137
1599 Ga0495636_0000276
1600 Ga0495674_0081403
1601 Ga0495672_0000291
1602 Ga0495672_0028219
1603 Ga0495683_0001436
1604 Ga0495683_0099284
1605 Ga0495687_000156
1606 Ga0495687_001091
1607 Ga0495677_0028309
1608 Ga0495677_0044094
1609 Ga0495685_000022
1610 Ga0495673_0022746
1611 Ga0495684_0003295
1612 Ga0495602_0024840
1613 Ga0495602_0155730
1614 Ga0496101_0100597
1615 Ga0496104_0009028
1616 Ga0496107_0039327
1617 Ga0496113_0096118
1618 Ga0496116_0017933
1619 Ga0496116_0019335
1620 Ga0496116_0127284
1621 Ga0496117_0000996
1622 Ga0496117_0008586
1623 Ga0496117_0022877
1624 Ga0496117_0167036
1625 Ga0496118_0006657
1626 Ga0496118_0016297
1627 Ga0496118_0052096
1628 Ga0496118_0086174
1629 Ga0496118_0121881
1630 Ga0496119_0186176
1631 Ga0496121_0007798
1632 Ga0496121_0029198
1633 Ga0496124_0016240
1634 Ga0496125_0000338
1635 Ga0496125_0059624
1636 Ga0496125_0074716
1637 Ga0496125_0128172
1638 Ga0495678_001681
1639 Ga0495682_0002722
1640 Ga0495682_0026192
1641 Ga0501297_001698
1642 Ga0501300_005523
1643 Ga0501222_004083
1644 Ga0501222_004818
1645 Ga0501223_003578
1646 Ga0501223_005650
1647 Ga0501227_012221
1648 Ga0501233_010399
1649 Ga0501235_004673
1650 Ga0501255_004054
1651 Ga0501221_001071
1652 Ga0501229_000091
1653 Ga0501262_003913
1654 Ga0501266_000886
1655 Ga0501272_000534
1656 Ga0501279_001288
1657 Ga0501280_000143
1658 Ga0501282_001025
1659 Ga0501282_006400
1660 nmdc:mga03683_57378_c1
1661 nmdc:mga00v17_213122_c1
1662 nmdc:mga00v17_46933_c1
1663 nmdc:mga0k408_151128_c1
1664 nmdc:mga0k408_15379_c1
1665 nmdc:mga0k408_184593_c1
1666 nmdc:mga0k408_30100_c1
1667 nmdc:mga0k408_3828_c1
1668 nmdc:mga0k408_74831_c1
1669 nmdc:mga07m45_11798_c1
1670 nmdc:mga07m45_1908_c1
1671 nmdc:mga07m45_212851_c1
1672 nmdc:mga07m45_22004_c1
1673 nmdc:mga07m45_4672_c1
1674 nmdc:mga07m45_86078_c1
1675 nmdc:mga07m45_94519_c1
1676 nmdc:mga05p37_51053_c1
1677 nmdc:mga05p37_80836_c1
1678 nmdc:mga0n895_378600_c1
1679 nmdc:mga0a205_553231_c1
1680 Ga0500644_0001588
1681 Ga0500651_0011712
1682 Ga0500566_0106460
1683 Ga0500650_0020046
1684 Ga0500556_0195544
1685 Ga0500593_000196
1686 Ga0500595_004466
1687 Ga0500658_0004895
1688 Ga0500619_006744
1689 Ga0500620_000108
1690 Ga0500634_0000067
1691 2509368617
1692 2510252018
1693 2511244945
1694 2512932424
1695 2512960441
1696 2513230904
1697 2513912089
1698 2514590896
1699 2515692237
1700 2516024626
1701 2527078179
1702 2563056007
1703 2587760172
1704 2597811883
1705 2599446324
1706 2599745033
1707 2600206786
1708 2643786894
1709 2644160189
1710 2644244395
1711 2644329641
1712 2644398557
1713 2676743239
1714 2713472209
1715 2756671665
1716 2774388028
1717 2792834467
1718 2809130814
1719 2809150851
1720 2812366748
1721 2819540944
1722 2841736759
1723 2844008418
1724 2844010685
1725 2852622372
1726 2854602087
1727 2856355948
1728 2856364264
1729 2856368154
1730 2869176953
1731 2869240227
1732 2869242771
1733 2869254671
1734 2869263195
1735 2869265225
1736 2869290227
1737 2871432511
1738 2871442963
1739 2871453692
1740 2871466228
1741 2871478237
1742 2871485209
1743 2871493117
1744 2874109573
1745 2874118128
1746 2874126382
1747 2874134887
1748 2874152478
1749 2874159878
1750 2874223974
1751 2876389843
1752 2876418394
1753 2878735856
1754 2878750125
1755 2878757162
1756 2878784206
1757 2881157993
1758 2881848546
1759 2881867698
1760 2882915352
1761 2885311367
1762 2885316408
1763 2885332892
1764 2888344742
1765 2889012980
1766 2889795089
1767 2889918184
1768 2900581743
1769 2903497814
1770 2903500889
1771 2903520455
1772 2904616653
1773 2906312483
1774 2906325192
1775 2906370532
1776 2906375097
1777 2906395456
1778 2906406269
1779 2906430594
1780 2919090083
1781 2919182584
1782 2919454086
1783 2919479517
1784 2919498258
1785 2921654770
1786 2922132618
1787 2922158163
1788 2923520782
1789 2924741686
1790 2924760645
1791 2928059468
1792 2928069609
1793 2928498052
1794 2937819372
1795 2937828198
1796 2937839190
1797 2937847901
1798 2937864669
1799 2937871290
1800 2958044555
1801 2958069129
1802 2958073027
1803 2958092815
1804 2958114623
1805 2958126100
1806 2958134615
1807 2958143241
1808 2958164871
1809 2958181096
1810 2961050738
1811 2961078932
1812 2961139120
1813 2961175509
1814 2961185689
1815 2965030090
1816 2965034436
1817 2965042940
1818 2965053411
1819 2965092526
1820 2965107146
1821 2965116418
1822 2967999489
1823 2968007847
1824 2968142356
1825 2970492479
1826 2970508097
1827 2970518040
1828 2970526474
1829 2970536366
1830 2970540597
1831 2970550209
1832 2970621166
1833 2970628347
1834 2974322216
1835 2977826321
1836 2977832198
1837 2977848271
1838 2977856038
1839 2977873449
1840 2977904044
1841 2977913130
1842 2977920812
1843 2977938272
1844 2977950746
1845 2977961403
1846 2979767908
1847 2979777015
1848 2979798857
1849 2979813281
1850 2987645556
1851 2987658657
1852 2987679394
1853 2996390474
1854 3000140031
1855 3004197914
1856 3004239349
1857 3004242497
1858 3004253408
1859 3004269305
1860 3004335571
1861 642418605
1862 642595320
1863 649870440
1864 8004303096
1865 8004316201
1866 8004364799
1867 8004378737
1868 8004392433
1869 8004633272
1870 8004696082
1871 8004718742
1872 8004729012
1873 8020941353
1874 8020956690
1875 8055271088
1876 8055306920

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

53

239

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

59

271

0.91

PF08659

KR

KR domain

53

221

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

55

229

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9379 5 227
2fwm-assembly1.cif.gz_X crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase 0.9345 1 228
6zzp-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.933 5 182
3k31-assembly1.cif.gz_A crystal structure of eonyl-(acyl-carrier-protein) reductase from anaplasma phagocytophilum in complex with nad at 1.9a resolution 0.9248 5 174
5gws-assembly1.cif.gz_C 4-hydroxyisoleucine dehydrogenase complexed with nadh and succinate 0.9237 7 176
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9691 86 176 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9643 2 172 3.40.50.720
af_Q9M1K9_1_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 4 186 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 42 176 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 5 227 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6CHQ7-F1-model_v4 Short-chain dehydrogenase/reductase 0.9899 5 201 GO:0016491
AF-A0A2V7PTR5-F1-model_v4 Short-chain dehydrogenase/reductase 0.9853 4 232 GO:0016491
AF-A0A7V4F2L6-F1-model_v4 SDR family oxidoreductase 0.9828 4 190 GO:0016491
AF-A0A3S0L3Z2-F1-model_v4 Oxidoreductase 0.9814 1 268 GO:0016491
AF-A0A537FAK0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9801 1 176 GO:0016491

Map