F486249

General Info

Members Datasets Scaffolds Average Seq Length
938 379 1876 199

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10001482|Ga0157370_1000148213
Length 237
Sequence MLARRSARRKTILNEFLKKSADIATLRSVLGSPREVPMAASKLYHRGNRDLQDEFKSRAIADRLEQVTTRSAFTESDKQFIESAIFFFLATADAEGRPDNSIKGGTAGFVRVTGPSELAFPDFDGNGMFKSLGNVASNPHVGLLFVDFEKPRRLRVNGTAMLCRNDPLLAHTVGAQLIVRVEARAIFPNCPRYIPTMQLVEESAYSPKAGRDFPEPAWKSFPEFKDAIHPRQPTHKG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
231 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
248 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 3.09
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10001482 3300013104 Bacteria 29052
2 JGI24741J21665_1012387 3300001915 Bacteria 1466
3 JGI24738J21930_10026121 3300002075 Bacteria 1199
4 JGI24751J29686_10000215 3300002459 Bacteria 24601
5 JGI24751J29686_10003625 3300002459 Bacteria 3111
6 JGI25406J46586_10023895 3300003203 Bacteria 2407
7 JGI25405J52794_10009658 3300003911 Bacteria 1824
8 JGI25405J52794_10028502 3300003911 Unclassified 1153
9 Ga0065165_1000413 3300005262 Bacteria 67911
10 Ga0065704_10076710 3300005289 Bacteria 4999
11 Ga0065707_10082851 3300005295 Bacteria 11736
12 Ga0070658_10046799 3300005327 Bacteria 3500
13 Ga0070676_10153890 3300005328 Bacteria 1474
14 Ga0070676_10497554 3300005328 Bacteria 865
15 Ga0070690_100191131 3300005330 Bacteria 1419
16 Ga0070690_100688412 3300005330 Bacteria 784
17 Ga0070670_100001886 3300005331 Bacteria 17123
18 Ga0070670_100450372 3300005331 Bacteria 1141
19 Ga0070670_100552326 3300005331 Bacteria 1028
20 Ga0070677_10018528 3300005333 Bacteria 2508
21 Ga0070677_10329895 3300005333 Unclassified 784
22 Ga0068869_100084721 3300005334 Bacteria 2373
23 Ga0070680_100012496 3300005336 Bacteria 6600
24 Ga0070680_100053078 3300005336 Bacteria 3308
25 Ga0070680_100213607 3300005336 Bacteria 1628
26 Ga0070680_100579995 3300005336 Bacteria 962
27 Ga0070682_100002383 3300005337 Bacteria 10410
28 Ga0070682_100053618 3300005337 Bacteria 2528
29 Ga0068868_100617194 3300005338 Unclassified 962
30 Ga0068868_100726321 3300005338 Bacteria 890
31 Ga0070660_100104963 3300005339 Bacteria 2242
32 Ga0070660_100107681 3300005339 Bacteria 2215
33 Ga0070660_100239476 3300005339 Bacteria 1478
34 Ga0070660_100292131 3300005339 Bacteria 1335
35 Ga0070689_100007921 3300005340 Bacteria 7456
36 Ga0070689_100039767 3300005340 Bacteria 3602
37 Ga0070689_100336505 3300005340 Bacteria 1263
38 Ga0070691_10030690 3300005341 Bacteria 2518
39 Ga0070691_10036241 3300005341 Bacteria 2324
40 Ga0070687_100044336 3300005343 Bacteria 2265
41 Ga0070687_100116930 3300005343 Bacteria 1519
42 Ga0070687_100119362 3300005343 Bacteria 1506
43 Ga0070661_100401352 3300005344 Bacteria 1084
44 Ga0070668_100023968 3300005347 Bacteria 4621
45 Ga0070668_100181275 3300005347 Bacteria 1721
46 Ga0070668_100213051 3300005347 Bacteria 1590
47 Ga0070668_100512824 3300005347 Bacteria 1039
48 Ga0070669_100090872 3300005353 Bacteria 2289
49 Ga0070675_100192424 3300005354 Bacteria 1768
50 Ga0070675_100280190 3300005354 Bacteria 1465
51 Ga0070675_100472006 3300005354 Bacteria 1127
52 Ga0070675_100584459 3300005354 Bacteria 1012
53 Ga0070671_100157437 3300005355 Bacteria 1919
54 Ga0070671_100241969 3300005355 Bacteria 1532
55 Ga0070671_100334834 3300005355 Bacteria 1290
56 Ga0070674_100008433 3300005356 Bacteria 6138
57 Ga0070674_100055621 3300005356 Bacteria 2741
58 Ga0070674_100331627 3300005356 Bacteria 1223
59 Ga0070674_100359222 3300005356 Unclassified 1179
60 Ga0070673_100115455 3300005364 Bacteria 2232
61 Ga0070673_100181084 3300005364 Bacteria 1804
62 Ga0070688_100020958 3300005365 Bacteria 3810
63 Ga0070688_100185533 3300005365 Bacteria 1445
64 Ga0070659_100017427 3300005366 Bacteria 5407
65 Ga0070667_100439910 3300005367 Bacteria 1190
66 Ga0070703_10011507 3300005406 Bacteria 2500
67 Ga0070709_10065464 3300005434 Bacteria 2328
68 Ga0070709_10398954 3300005434 Bacteria 1026
69 Ga0070714_100079855 3300005435 Bacteria 2845
70 Ga0070714_100123686 3300005435 Bacteria 2304
71 Ga0070701_10071306 3300005438 Bacteria 1858
72 Ga0070711_100206120 3300005439 Bacteria 1520
73 Ga0070705_100308057 3300005440 Bacteria 1138
74 Ga0070705_100326273 3300005440 Bacteria 1110
75 Ga0070700_100004965 3300005441 Bacteria 7001
76 Ga0070700_100185042 3300005441 Bacteria 1452
77 Ga0070694_100001395 3300005444 Bacteria 14118
78 Ga0070708_100030598 3300005445 Bacteria 4654
79 Ga0070708_100652353 3300005445 Unclassified 992
80 Ga0070663_100139481 3300005455 Bacteria 1849
81 Ga0070663_100223838 3300005455 Bacteria 1478
82 Ga0070678_100041136 3300005456 Bacteria 3275
83 Ga0070662_100031485 3300005457 Bacteria 3723
84 Ga0070662_100092068 3300005457 Bacteria 2278
85 Ga0070662_100221371 3300005457 Bacteria 1510
86 Ga0070662_100536327 3300005457 Bacteria 979
87 Ga0070681_10015386 3300005458 Bacteria 7613
88 Ga0070681_10032521 3300005458 Bacteria 5235
89 Ga0070681_10078339 3300005458 Bacteria 3262
90 Ga0070681_10082022 3300005458 Bacteria 3180
91 Ga0068867_100224774 3300005459 Bacteria 1514
92 Ga0068867_100320022 3300005459 Bacteria 1285
93 Ga0070685_10090935 3300005466 Bacteria 1847
94 Ga0070699_100000903 3300005518 Bacteria 27717
95 Ga0070699_100403574 3300005518 Bacteria 1236
96 Ga0070679_100100677 3300005530 Bacteria 2875
97 Ga0070679_100238262 3300005530 Bacteria 1778
98 Ga0070679_100296379 3300005530 Bacteria 1568
99 Ga0070684_100364089 3300005535 Bacteria 1331
100 Ga0070697_100153327 3300005536 Bacteria 1943
101 Ga0070697_100179967 3300005536 Bacteria 1792
102 Ga0068853_100011270 3300005539 Bacteria 7256
103 Ga0068853_100108853 3300005539 Bacteria 2459
104 Ga0068853_100299057 3300005539 Bacteria 1487
105 Ga0070672_100298212 3300005543 Unclassified 1366
106 Ga0070672_100500103 3300005543 Bacteria 1051
107 Ga0070686_100234960 3300005544 Bacteria 1332
108 Ga0070695_100000639 3300005545 Bacteria 18577
109 Ga0070695_100030339 3300005545 Bacteria 3367
110 Ga0070695_100466992 3300005545 Bacteria 970
111 Ga0070696_100000250 3300005546 Bacteria 32363
112 Ga0070693_100005322 3300005547 Bacteria 6170
113 Ga0070665_100000015 3300005548 Bacteria 462744
114 Ga0070665_100148660 3300005548 Bacteria 2345
115 Ga0070704_100001558 3300005549 Bacteria 12363
116 Ga0070704_100270154 3300005549 Bacteria 1405
117 Ga0070704_100671819 3300005549 Unclassified 916
118 Ga0068855_100022674 3300005563 Bacteria 7523
119 Ga0068855_100039944 3300005563 Bacteria 5569
120 Ga0068855_100055592 3300005563 Bacteria 4648
121 Ga0068855_100218859 3300005563 Bacteria 2136
122 Ga0068855_100344109 3300005563 Bacteria 1644
123 Ga0068855_100756710 3300005563 Bacteria 1035
124 Ga0068855_100988413 3300005563 Bacteria 885
125 Ga0070664_100017578 3300005564 Bacteria 5872
126 Ga0070664_101072973 3300005564 Bacteria 758
127 Ga0068857_100021931 3300005577 Bacteria 5622
128 Ga0068857_100157314 3300005577 Bacteria 2061
129 Ga0068854_100018166 3300005578 Bacteria 4717
130 Ga0068854_100070221 3300005578 Bacteria 2560
131 Ga0068854_100230082 3300005578 Bacteria 1471
132 Ga0068854_100878066 3300005578 Bacteria 787
133 Ga0068856_100029620 3300005614 Bacteria 5347
134 Ga0068852_100016145 3300005616 Bacteria 5813
135 Ga0068852_100136803 3300005616 Bacteria 2262
136 Ga0068852_100789508 3300005616 Bacteria 963
137 Ga0068859_100000958 3300005617 Bacteria 29557
138 Ga0068859_100008025 3300005617 Bacteria 10705
139 Ga0068859_100689544 3300005617 Bacteria 1112
140 Ga0068859_101115688 3300005617 Bacteria 868
141 Ga0068859_101199582 3300005617 Bacteria 836
142 Ga0068864_100006627 3300005618 Bacteria 9478
143 Ga0068864_101292700 3300005618 Unclassified 730
144 Ga0068864_101409256 3300005618 Unclassified 699
145 Ga0068866_10188534 3300005718 Bacteria 1223
146 Ga0068861_100003912 3300005719 Bacteria 9962
147 Ga0068861_100005610 3300005719 Bacteria 8505
148 Ga0068861_100043277 3300005719 Bacteria 3379
149 Ga0068861_100075251 3300005719 Bacteria 2628
150 Ga0068861_100218398 3300005719 Unclassified 1610
151 Ga0068870_10300266 3300005840 Bacteria 1013
152 Ga0068858_100065570 3300005842 Bacteria 3360
153 Ga0068858_100093714 3300005842 Bacteria 2796
154 Ga0068858_100220288 3300005842 Unclassified 1797
155 Ga0068858_100434324 3300005842 Bacteria 1264
156 Ga0068860_100006237 3300005843 Bacteria 11980
157 Ga0068860_100024614 3300005843 Bacteria 5813
158 Ga0068860_100859770 3300005843 Unclassified 922
159 Ga0068862_100001758 3300005844 Bacteria 19587
160 Ga0068862_100151839 3300005844 Bacteria 2062
161 Ga0068862_100459371 3300005844 Bacteria 1202
162 Ga0081455_10000078 3300005937 Bacteria 105058
163 Ga0081455_10000110 3300005937 Bacteria 92459
164 Ga0081455_10047650 3300005937 Bacteria 3710
165 Ga0081455_10142529 3300005937 Bacteria 1859
166 Ga0081455_10644120 3300005937 Bacteria 683
167 Ga0081540_1000202 3300005983 Bacteria 62303
168 Ga0081540_1013347 3300005983 Bacteria 5345
169 Ga0081540_1084155 3300005983 Unclassified 1420
170 Ga0081539_10001677 3300005985 Bacteria 35838
171 Ga0081539_10191974 3300005985 Bacteria 950
172 Ga0070717_10119294 3300006028 Bacteria 2258
173 Ga0075365_10004803 3300006038 Bacteria 7208
174 Ga0075365_10116993 3300006038 Bacteria 1836
175 Ga0075365_10151063 3300006038 Bacteria 1615
176 Ga0075365_10699328 3300006038 Bacteria 716
177 Ga0075368_10017785 3300006042 Unclassified 2664
178 Ga0075368_10070963 3300006042 Bacteria 1406
179 Ga0075363_100014479 3300006048 Bacteria 3856
180 Ga0075363_100030230 3300006048 Bacteria 2802
181 Ga0075363_100190464 3300006048 Unclassified 1170
182 Ga0075364_10006364 3300006051 Bacteria 6937
183 Ga0075364_10072805 3300006051 Bacteria 2265
184 Ga0075364_10082690 3300006051 Bacteria 2124
185 Ga0075364_10095269 3300006051 Unclassified 1979
186 Ga0075364_10443806 3300006051 Bacteria 886
187 Ga0070716_100230107 3300006173 Bacteria 1251
188 Ga0075362_10008126 3300006177 Bacteria 4002
189 Ga0075362_10104635 3300006177 Bacteria 1327
190 Ga0075362_10168307 3300006177 Unclassified 1058
191 Ga0075367_10232095 3300006178 Bacteria 1155
192 Ga0075367_10283532 3300006178 Unclassified 1041
193 Ga0075369_10000396 3300006186 Bacteria 13137
194 Ga0075369_10212560 3300006186 Bacteria 894
195 Ga0075366_10004688 3300006195 Bacteria 7356
196 Ga0075366_10038718 3300006195 Unclassified 2816
197 Ga0075370_10020103 3300006353 Bacteria 3645
198 Ga0075370_10039084 3300006353 Unclassified 2672
199 Ga0075370_10204771 3300006353 Bacteria 1164
200 Ga0075370_10277137 3300006353 Bacteria 996
201 Ga0075428_100003993 3300006844 Bacteria 16190
202 Ga0075428_100054246 3300006844 Bacteria 4393
203 Ga0075428_100060129 3300006844 Bacteria 4161
204 Ga0075428_100200047 3300006844 Unclassified 2160
205 Ga0075428_100221886 3300006844 Bacteria 2041
206 Ga0075428_100267065 3300006844 Bacteria 1841
207 Ga0075428_100351409 3300006844 Bacteria 1582
208 Ga0075428_100782670 3300006844 Unclassified 1014
209 Ga0075430_100001762 3300006846 Bacteria 17689
210 Ga0075430_100009847 3300006846 Bacteria 8085
211 Ga0075430_100016834 3300006846 Bacteria 6226
212 Ga0075430_100041371 3300006846 Bacteria 3899
213 Ga0075430_100233203 3300006846 Bacteria 1526
214 Ga0075430_100239465 3300006846 Bacteria 1504
215 Ga0075431_100028619 3300006847 Bacteria 5728
216 Ga0075431_100030283 3300006847 Bacteria 5574
217 Ga0075431_100038372 3300006847 Bacteria 4932
218 Ga0075431_100058754 3300006847 Bacteria 3969
219 Ga0075431_100089520 3300006847 Bacteria 3176
220 Ga0075431_100175755 3300006847 Bacteria 2199
221 Ga0075431_100289478 3300006847 Bacteria 1657
222 Ga0075433_10040772 3300006852 Bacteria 4020
223 Ga0075433_10057597 3300006852 Bacteria 3397
224 Ga0075434_100779152 3300006871 Bacteria 973
225 Ga0075434_100843980 3300006871 Unclassified 932
226 Ga0075429_100013355 3300006880 Bacteria 7121
227 Ga0075429_100041173 3300006880 Bacteria 4023
228 Ga0075429_100166722 3300006880 Bacteria 1929
229 Ga0075429_100260383 3300006880 Bacteria 1518
230 Ga0075429_100754095 3300006880 Bacteria 853
231 Ga0075429_100763338 3300006880 Bacteria 847
232 Ga0068865_100011667 3300006881 Bacteria 5505
233 Ga0097620_100000958 3300006931 Bacteria 29557
234 Ga0097620_100008024 3300006931 Bacteria 10705
235 Ga0097620_100689524 3300006931 Bacteria 1112
236 Ga0097620_101115552 3300006931 Bacteria 868
237 Ga0097620_101199754 3300006931 Bacteria 836
238 Ga0075435_100021488 3300007076 Bacteria 4965
239 Ga0075435_100166013 3300007076 Bacteria 1861
240 Ga0075435_100677914 3300007076 Bacteria 895
241 Ga0099795_10009637 3300007788 Bacteria 2811
242 Ga0105240_10010073 3300009093 Bacteria 13307
243 Ga0105240_10878129 3300009093 Bacteria 966
244 Ga0111539_10021299 3300009094 Bacteria 7982
245 Ga0111539_10024407 3300009094 Bacteria 7420
246 Ga0111539_10111223 3300009094 Bacteria 3214
247 Ga0111539_10157790 3300009094 Bacteria 2654
248 Ga0111539_10301381 3300009094 Bacteria 1865
249 Ga0111539_10470054 3300009094 Bacteria 1464
250 Ga0111539_11098871 3300009094 Bacteria 924
251 Ga0105245_10051687 3300009098 Bacteria 3683
252 Ga0105245_10055280 3300009098 Bacteria 3565
253 Ga0105247_10039157 3300009101 Bacteria 2895
254 Ga0105247_10082996 3300009101 Unclassified 2023
255 Ga0114129_10007093 3300009147 Bacteria 15946
256 Ga0114129_10105196 3300009147 Bacteria 3901
257 Ga0114129_10137700 3300009147 Bacteria 3349
258 Ga0114129_10143716 3300009147 Bacteria 3269
259 Ga0114129_10826888 3300009147 Bacteria 1179
260 Ga0114129_10905267 3300009147 Bacteria 1117
261 Ga0114129_11260413 3300009147 Bacteria 918
262 Ga0105243_10382684 3300009148 Bacteria 1302
263 Ga0105243_10393087 3300009148 Bacteria 1286
264 Ga0105243_10504082 3300009148 Bacteria 1147
265 Ga0105243_10782723 3300009148 Bacteria 938
266 Ga0105243_10792713 3300009148 Bacteria 933
267 Ga0105241_10170832 3300009174 Bacteria 1796
268 Ga0105241_10800492 3300009174 Bacteria 868
269 Ga0105242_10121639 3300009176 Bacteria 2241
270 Ga0105242_10213785 3300009176 Bacteria 1720
271 Ga0105242_10534900 3300009176 Bacteria 1121
272 Ga0105248_10001636 3300009177 Bacteria 24907
273 Ga0105248_10137571 3300009177 Bacteria 2755
274 Ga0105248_10345950 3300009177 Bacteria 1674
275 Ga0105248_10374233 3300009177 Bacteria 1604
276 Ga0105248_10384681 3300009177 Bacteria 1580
277 Ga0105248_10805532 3300009177 Bacteria 1060
278 Ga0105238_10043794 3300009551 Bacteria 4527
279 Ga0105238_10063581 3300009551 Bacteria 3691
280 Ga0105238_10084145 3300009551 Bacteria 3170
281 Ga0105238_10117478 3300009551 Bacteria 2640
282 Ga0105238_10259053 3300009551 Bacteria 1718
283 Ga0105249_10001768 3300009553 Bacteria 18827
284 Ga0105249_10002516 3300009553 Bacteria 15855
285 Ga0105249_10376725 3300009553 Bacteria 1444
286 Ga0105249_10583592 3300009553 Bacteria 1171
287 Ga0105249_10846450 3300009553 Bacteria 980
288 Ga0099796_10003800 3300010159 Bacteria 3559
289 Ga0105239_10348760 3300010375 Bacteria 1671
290 Ga0105239_10422992 3300010375 Bacteria 1509
291 Ga0105239_10772696 3300010375 Bacteria 1100
292 Ga0157370_11041689 3300013104 Bacteria 740
293 Ga0157369_10242817 3300013105 Bacteria 1881
294 Ga0157369_10261463 3300013105 Bacteria 1805
295 Ga0157369_10699452 3300013105 Bacteria 1044
296 Ga0157374_10091374 3300013296 Bacteria 2903
297 Ga0157378_10011699 3300013297 Bacteria 7680
298 Ga0157378_10125945 3300013297 Bacteria 2366
299 Ga0157378_10240601 3300013297 Bacteria 1729
300 Ga0157378_10333829 3300013297 Bacteria 1476
301 Ga0157378_11510913 3300013297 Bacteria 716
302 Ga0163162_10083716 3300013306 Plasmid 3264
303 Ga0163162_11082176 3300013306 Bacteria 908
304 Ga0157372_10005465 3300013307 Bacteria 13499
305 Ga0157372_10347272 3300013307 Bacteria 1728
306 Ga0157372_10476373 3300013307 Bacteria 1455
307 Ga0157372_11188487 3300013307 Bacteria 881
308 Ga0157375_10124349 3300013308 Bacteria 2693
309 Ga0157375_10222522 3300013308 Bacteria 2046
310 Ga0157375_10302062 3300013308 Bacteria 1764
311 Ga0157375_10538779 3300013308 Bacteria 1330
312 Ga0157375_11209917 3300013308 Bacteria 886
313 Ga0163163_10066373 3300014325 Unclassified 3584
314 Ga0163163_10236673 3300014325 Bacteria 1875
315 Ga0163163_10437343 3300014325 Bacteria 1367
316 Ga0163163_10553515 3300014325 Bacteria 1213
317 Ga0157380_10008333 3300014326 Bacteria 7391
318 Ga0157380_10077477 3300014326 Unclassified 2710
319 Ga0157380_10080990 3300014326 Bacteria 2655
320 Ga0157380_10179414 3300014326 Bacteria 1859
321 Ga0157380_10262453 3300014326 Bacteria 1570
322 Ga0157380_10563302 3300014326 Bacteria 1120
323 Ga0182008_10277741 3300014497 Unclassified 871
324 Ga0157377_10127846 3300014745 Bacteria 1548
325 Ga0157377_10473120 3300014745 Bacteria 870
326 Ga0157379_10809449 3300014968 Unclassified 885
327 Ga0157376_10033955 3300014969 Bacteria 4114
328 Ga0157376_10615240 3300014969 Unclassified 1083
329 Ga0163161_10347642 3300017792 Bacteria 1178
330 Ga0163161_10395363 3300017792 Bacteria 1107
331 Ga0163161_10395740 3300017792 Bacteria 1107
332 Ga0163161_10665975 3300017792 Bacteria 864
333 Ga0213876_10176645 3300021384 Bacteria 1136
334 Ga0213876_10271971 3300021384 Bacteria 900
335 Ga0213875_10000093 3300021388 Bacteria 102870
336 Ga0207697_10076179 3300025315 Bacteria 1409
337 Ga0207653_10000382 3300025885 Bacteria 20305
338 Ga0207682_10000821 3300025893 Bacteria 14352
339 Ga0207682_10335054 3300025893 Unclassified 712
340 Ga0207692_10047485 3300025898 Bacteria 2156
341 Ga0207642_10089325 3300025899 Unclassified 1518
342 Ga0207710_10003734 3300025900 Bacteria 6740
343 Ga0207688_10055385 3300025901 Bacteria 2225
344 Ga0207647_10048380 3300025904 Bacteria 2641
345 Ga0207685_10210419 3300025905 Bacteria 919
346 Ga0207699_10051336 3300025906 Bacteria 2436
347 Ga0207699_10481359 3300025906 Bacteria 894
348 Ga0207645_10164152 3300025907 Bacteria 1454
349 Ga0207645_10256611 3300025907 Bacteria 1157
350 Ga0207643_10078310 3300025908 Bacteria 1912
351 Ga0207705_10194336 3300025909 Bacteria 1535
352 Ga0207684_10603637 3300025910 Bacteria 937
353 Ga0207707_10005195 3300025912 Bacteria 11413
354 Ga0207707_10010239 3300025912 Bacteria 8139
355 Ga0207707_10129608 3300025912 Bacteria 2206
356 Ga0207695_10008153 3300025913 Bacteria 13172
357 Ga0207695_10508116 3300025913 Bacteria 1087
358 Ga0207695_10616196 3300025913 Bacteria 966
359 Ga0207693_10006473 3300025915 Bacteria 9705
360 Ga0207693_10668248 3300025915 Bacteria 806
361 Ga0207663_10341106 3300025916 Bacteria 1132
362 Ga0207660_10008213 3300025917 Bacteria 6755
363 Ga0207660_10015600 3300025917 Bacteria 5017
364 Ga0207660_10025055 3300025917 Bacteria 4046
365 Ga0207662_10039972 3300025918 Bacteria 2754
366 Ga0207662_10090491 3300025918 Bacteria 1881
367 Ga0207662_10141750 3300025918 Bacteria 1523
368 Ga0207662_10192904 3300025918 Bacteria 1315
369 Ga0207657_10051226 3300025919 Bacteria 3589
370 Ga0207657_10056774 3300025919 Bacteria 3376
371 Ga0207657_10184725 3300025919 Bacteria 1684
372 Ga0207649_10172967 3300025920 Bacteria 1506
373 Ga0207652_10038323 3300025921 Bacteria 4062
374 Ga0207652_10291499 3300025921 Bacteria 1472
375 Ga0207681_10360906 3300025923 Unclassified 1165
376 Ga0207681_10632024 3300025923 Bacteria 887
377 Ga0207694_10038009 3300025924 Bacteria 3700
378 Ga0207694_10342120 3300025924 Bacteria 1237
379 Ga0207650_10001277 3300025925 Bacteria 18255
380 Ga0207659_10106876 3300025926 Bacteria 2120
381 Ga0207659_10511714 3300025926 Bacteria 1017
382 Ga0207687_10035375 3300025927 Bacteria 3396
383 Ga0207687_10098856 3300025927 Bacteria 2143
384 Ga0207687_10316890 3300025927 Bacteria 1261
385 Ga0207700_11142467 3300025928 Bacteria 696
386 Ga0207644_10109202 3300025931 Bacteria 2090
387 Ga0207644_10220113 3300025931 Bacteria 1504
388 Ga0207644_10916818 3300025931 Bacteria 734
389 Ga0207644_11174449 3300025931 Bacteria 645
390 Ga0207690_10076422 3300025932 Bacteria 2325
391 Ga0207690_10577450 3300025932 Bacteria 916
392 Ga0207706_10053674 3300025933 Bacteria 3558
393 Ga0207706_10057728 3300025933 Bacteria 3419
394 Ga0207706_10088415 3300025933 Bacteria 2724
395 Ga0207706_10146155 3300025933 Bacteria 2079
396 Ga0207706_10173862 3300025933 Bacteria 1892
397 Ga0207706_10220525 3300025933 Bacteria 1660
398 Ga0207686_10065267 3300025934 Bacteria 2321
399 Ga0207709_10279975 3300025935 Bacteria 1231
400 Ga0207709_10389742 3300025935 Bacteria 1062
401 Ga0207709_10615947 3300025935 Bacteria 861
402 Ga0207670_10081486 3300025936 Bacteria 2265
403 Ga0207670_10116506 3300025936 Bacteria 1934
404 Ga0207670_10171714 3300025936 Bacteria 1626
405 Ga0207670_10241255 3300025936 Bacteria 1392
406 Ga0207669_10029763 3300025937 Bacteria 3025
407 Ga0207669_10115566 3300025937 Bacteria 1809
408 Ga0207669_10138837 3300025937 Bacteria 1683
409 Ga0207669_10278675 3300025937 Bacteria 1260
410 Ga0207704_10003609 3300025938 Bacteria 7027
411 Ga0207704_10216247 3300025938 Bacteria 1414
412 Ga0207704_10544701 3300025938 Bacteria 942
413 Ga0207665_10060187 3300025939 Bacteria 2571
414 Ga0207665_10144357 3300025939 Bacteria 1700
415 Ga0207691_10005190 3300025940 Bacteria 12578
416 Ga0207711_10000978 3300025941 Bacteria 27393
417 Ga0207711_10114774 3300025941 Bacteria 2399
418 Ga0207711_10685808 3300025941 Bacteria 956
419 Ga0207711_10796363 3300025941 Unclassified 880
420 Ga0207689_10131580 3300025942 Bacteria 2059
421 Ga0207689_10220929 3300025942 Bacteria 1565
422 Ga0207661_10527047 3300025944 Bacteria 1081
423 Ga0207679_10013958 3300025945 Bacteria 5268
424 Ga0207667_10003251 3300025949 Bacteria 20047
425 Ga0207667_10028640 3300025949 Bacteria 6048
426 Ga0207667_10042681 3300025949 Bacteria 4819
427 Ga0207667_10048261 3300025949 Bacteria 4503
428 Ga0207667_10204736 3300025949 Bacteria 2024
429 Ga0207712_10000685 3300025961 Bacteria 26202
430 Ga0207712_10005821 3300025961 Bacteria 7771
431 Ga0207712_10229426 3300025961 Bacteria 1489
432 Ga0207712_10317189 3300025961 Bacteria 1285
433 Ga0207712_10552568 3300025961 Bacteria 990
434 Ga0207668_10323688 3300025972 Unclassified 1280
435 Ga0207668_10506285 3300025972 Bacteria 1039
436 Ga0207640_10012353 3300025981 Bacteria 4860
437 Ga0207658_10135868 3300025986 Bacteria 1983
438 Ga0207658_10405886 3300025986 Bacteria 1198
439 Ga0207658_11032396 3300025986 Unclassified 750
440 Ga0207677_10035790 3300026023 Bacteria 3228
441 Ga0207677_10671647 3300026023 Bacteria 916
442 Ga0207703_10017879 3300026035 Bacteria 5537
443 Ga0207703_10121057 3300026035 Bacteria 2247
444 Ga0207703_10386658 3300026035 Unclassified 1295
445 Ga0207703_10651086 3300026035 Bacteria 999
446 Ga0207639_10004937 3300026041 Bacteria 8985
447 Ga0207639_10158926 3300026041 Bacteria 1902
448 Ga0207639_10234525 3300026041 Bacteria 1592
449 Ga0207639_10492834 3300026041 Bacteria 1118
450 Ga0207678_10041070 3300026067 Bacteria 4010
451 Ga0207678_10098401 3300026067 Bacteria 2499
452 Ga0207678_10168846 3300026067 Bacteria 1868
453 Ga0207678_10455730 3300026067 Bacteria 1112
454 Ga0207708_10003552 3300026075 Bacteria 11490
455 Ga0207708_10087203 3300026075 Bacteria 2403
456 Ga0207708_10105093 3300026075 Bacteria 2188
457 Ga0207708_10251317 3300026075 Bacteria 1425
458 Ga0207708_10770179 3300026075 Bacteria 827
459 Ga0207702_10122376 3300026078 Bacteria 2330
460 Ga0207702_10762433 3300026078 Bacteria 955
461 Ga0207641_10339541 3300026088 Bacteria 1429
462 Ga0207648_10140220 3300026089 Bacteria 2131
463 Ga0207648_10149060 3300026089 Bacteria 2064
464 Ga0207648_10521400 3300026089 Bacteria 1089
465 Ga0207676_10009291 3300026095 Bacteria 6995
466 Ga0207676_10051990 3300026095 Bacteria 3200
467 Ga0207676_11053861 3300026095 Bacteria 803
468 Ga0207676_11379493 3300026095 Unclassified 700
469 Ga0207674_10007063 3300026116 Bacteria 13122
470 Ga0207674_10171105 3300026116 Bacteria 2126
471 Ga0207674_10378753 3300026116 Bacteria 1368
472 Ga0207675_100008452 3300026118 Bacteria 9699
473 Ga0207675_100009092 3300026118 Bacteria 9323
474 Ga0207675_100064583 3300026118 Bacteria 3421
475 Ga0207675_100122276 3300026118 Bacteria 2464
476 Ga0207675_100170256 3300026118 Bacteria 2082
477 Ga0207683_10000733 3300026121 Bacteria 29828
478 Ga0207683_10006383 3300026121 Bacteria 10098
479 Ga0207683_10080262 3300026121 Bacteria 2894
480 Ga0207683_10127248 3300026121 Bacteria 2290
481 Ga0207698_10109332 3300026142 Bacteria 2313
482 Ga0207698_10125757 3300026142 Bacteria 2180
483 Ga0209999_1001692 3300027543 Bacteria 3817
484 Ga0209983_1004946 3300027665 Bacteria 2783
485 Ga0209813_10000690 3300027866 Bacteria 7701
486 Ga0209813_10044965 3300027866 Bacteria 1359
487 Ga0209813_10060969 3300027866 Bacteria 1204
488 Ga0207428_10023506 3300027907 Bacteria 5184
489 Ga0207428_10140193 3300027907 Bacteria 1846
490 Ga0268266_10000005 3300028379 Bacteria 1448194
491 Ga0268266_10052131 3300028379 Bacteria 3513
492 Ga0268265_10002643 3300028380 Bacteria 13304
493 Ga0268265_10224872 3300028380 Bacteria 1645
494 Ga0268265_10587664 3300028380 Bacteria 1062
495 Ga0268264_10014518 3300028381 Bacteria 6472
496 Ga0268264_10655440 3300028381 Bacteria 1039
497 Ga0268264_10748867 3300028381 Unclassified 973
498 Ga0268264_11109747 3300028381 Bacteria 800
499 Ga0265337_1004028 3300028556 Bacteria 6206
500 Ga0265318_10047166 3300028577 Bacteria 1625
501 Ga0265338_10246595 3300028800 Bacteria 1320
502 Ga0265330_10033608 3300031235 Bacteria 2293
503 Ga0265330_10054671 3300031235 Bacteria 1745
504 Ga0265332_10073566 3300031238 Bacteria 1454
505 Ga0265332_10218029 3300031238 Bacteria 792
506 Ga0265320_10045703 3300031240 Bacteria 2150
507 Ga0265325_10008156 3300031241 Bacteria 6205
508 Ga0265325_10025840 3300031241 Bacteria 3186
509 Ga0265325_10062594 3300031241 Bacteria 1884
510 Ga0265340_10009914 3300031247 Bacteria 5106
511 Ga0265340_10039778 3300031247 Bacteria 2317
512 Ga0265340_10225682 3300031247 Bacteria 838
513 Ga0265339_10012947 3300031249 Bacteria 5070
514 Ga0265339_10082195 3300031249 Bacteria 1701
515 Ga0265316_10043391 3300031344 Bacteria 3585
516 Ga0265316_10144881 3300031344 Bacteria 1782
517 Ga0265316_10397796 3300031344 Bacteria 992
518 Ga0307513_10006527 3300031456 Bacteria 15241
519 Ga0307408_100166632 3300031548 Bacteria 1755
520 Ga0307408_100339967 3300031548 Bacteria 1270
521 Ga0307408_100766452 3300031548 Bacteria 873
522 Ga0265313_10001400 3300031595 Bacteria 22611
523 Ga0265313_10007777 3300031595 Bacteria 7246
524 Ga0265313_10011350 3300031595 Bacteria 5548
525 Ga0265313_10158528 3300031595 Bacteria 963
526 Ga0265314_10173913 3300031711 Bacteria 1297
527 Ga0265314_10242971 3300031711 Bacteria 1037
528 Ga0265342_10006348 3300031712 Bacteria 8814
529 Ga0307405_10003147 3300031731 Bacteria 7510
530 Ga0307405_10223429 3300031731 Bacteria 1383
531 Ga0307413_10217896 3300031824 Bacteria 1392
532 Ga0307413_10565530 3300031824 Bacteria 925
533 Ga0307406_10148722 3300031901 Bacteria 1668
534 Ga0307406_10177067 3300031901 Bacteria 1549
535 Ga0307407_10055877 3300031903 Bacteria 2283
536 Ga0307407_10204981 3300031903 Bacteria 1324
537 Ga0307409_101343225 3300031995 Bacteria 740
538 Ga0307409_101448516 3300031995 Bacteria 714
539 Ga0307416_100031411 3300032002 Bacteria 3998
540 Ga0307416_100202545 3300032002 Bacteria 1885
541 Ga0373958_0016992 3300034819 Bacteria 1302
542 Ga0373958_0034164 3300034819 Unclassified 1012
543 Ga0373926_0149182 3300035083 Unclassified 890
544 Ga0373929_0055921 3300035085 Bacteria 913
545 Ga0373940_0020986 3300035088 Bacteria 1665
546 Ga0373940_0113064 3300035088 Bacteria 835
547 Ga0373951_0025398 3300035091 Bacteria 1376
548 Ga0373951_0090305 3300035091 Bacteria 803
549 Ga0373932_0017950 3300035112 Bacteria 1824
550 Ga0373932_0020151 3300035112 Bacteria 1746
551 Ga0373936_0073555 3300035113 Bacteria 1413
552 Ga0373939_0002641 3300035114 Bacteria 4207
553 Ga0373945_0065975 3300035116 Bacteria 1360
554 Ga0373953_0048233 3300035117 Bacteria 1715
555 Ga0373954_0059635 3300035118 Bacteria 1799
556 Ga0373956_0091500 3300035119 Bacteria 1404
557 Ga0373957_0022995 3300035120 Bacteria 2226
558 Ga0373946_0447715 3300035171 Bacteria 657
559 Ga0373955_0008661 3300035172 Bacteria 4734
560 Ga0373955_0013299 3300035172 Bacteria 3977
561 Ga0373942_0005848 3300035207 Bacteria 2846
562 Ga0373961_0024296 3300035241 Bacteria 1638
563 Ga0373962_0012217 3300035242 Bacteria 2161
564 Ga0373962_0161448 3300035242 Bacteria 739
565 Ga0373924_0157543 3300035410 Bacteria 995
566 Ga0373931_0002256 3300035691 Bacteria 8515
567 Ga0373931_0011400 3300035691 Bacteria 4295
568 Ga0373935_0073138 3300035692 Bacteria 2214
569 Ga0373935_0872176 3300035692 Bacteria 666
570 Ga0373927_0022614 3300035695 Bacteria 4117
571 Ga0373927_0028739 3300035695 Bacteria 3627
572 Ga0373927_0059984 3300035695 Bacteria 2461
573 Ga0373927_0246355 3300035695 Bacteria 1175
574 Ga0373933_0027103 3300035724 Bacteria 3297
575 Ga0373933_0140979 3300035724 Bacteria 1522
576 Ga0373947_0329135 3300035725 Unclassified 1023
577 Ga0373937_0010973 3300036401 Bacteria 7938
578 Ga0373937_0020646 3300036401 Bacteria 5906
579 Ga0373937_0047869 3300036401 Bacteria 3912
580 Ga0373937_0049280 3300036401 Bacteria 3857
581 Ga0373937_0184054 3300036401 Unclassified 1962
582 Ga0373937_0262931 3300036401 Bacteria 1627
583 Ga0373937_0630265 3300036401 Bacteria 1017
584 Ga0373925_0114843 3300037068 Bacteria 2084
585 Ga0373925_0270259 3300037068 Bacteria 1367
586 Ga0436364_0399903 3300037853 Bacteria 1571
587 Ga0436364_0773474 3300037853 Bacteria 29224
588 Ga0436365_0367932 3300039437 Bacteria 1107
589 Ga0436365_0509749 3300039437 Bacteria 2633
590 Ga0436365_1217404 3300039437 Bacteria 1820
591 Ga0436365_1819757 3300039437 Bacteria 1948
592 Ga0436360_0511587 3300039438 Bacteria 835
593 Ga0436361_1205150 3300039447 Bacteria 684
594 Ga0436363_1631277 3300039450 Bacteria 967
595 Ga0439466_0061010 3300041411 Bacteria 1215
596 Ga0451855_1085264 3300041511 Bacteria 1126
597 Ga0439443_003991 3300042003 Bacteria 1897
598 Ga0439435_0002245 3300042436 Bacteria 3791
599 Ga0450893_0022252 3300042532 Bacteria 1098
600 Ga0495592_0012987 3300046454 Bacteria 6334
601 Ga0495592_0139255 3300046454 Bacteria 1689
602 Ga0495603_0063475 3300046455 Bacteria 2179
603 Ga0495603_0123926 3300046455 Bacteria 1506
604 Ga0495603_0276157 3300046455 Bacteria 966
605 Ga0495629_0080363 3300046459 Bacteria 2276
606 Ga0495638_0053804 3300046460 Bacteria 2504
607 Ga0495638_0245358 3300046460 Bacteria 990
608 Ga0495638_0357151 3300046460 Unclassified 770
609 Ga0495651_0033079 3300046462 Bacteria 4033
610 Ga0495651_0038641 3300046462 Bacteria 3717
611 Ga0495651_0289778 3300046462 Bacteria 1102
612 Ga0495651_0564255 3300046462 Bacteria 722
613 Ga0495653_0089987 3300046463 Bacteria 2247
614 Ga0495650_0024987 3300046471 Bacteria 2811
615 Ga0495650_0069652 3300046471 Bacteria 1383
616 Ga0495582_0396973 3300046473 Unclassified 795
617 Ga0495639_0376862 3300046475 Bacteria 715
618 Ga0495664_0086896 3300046477 Bacteria 1878
619 Ga0495664_0255185 3300046477 Bacteria 1060
620 Ga0495585_0029332 3300046492 Bacteria 3132
621 Ga0495596_0117826 3300046500 Bacteria 1031
622 Ga0495583_0020119 3300046506 Bacteria 3467
623 Ga0495583_0210597 3300046506 Unclassified 788
624 Ga0495608_0008463 3300046511 Bacteria 7207
625 Ga0495608_0112935 3300046511 Bacteria 1746
626 Ga0495608_0502982 3300046511 Bacteria 734
627 Ga0495618_0348552 3300046514 Bacteria 913
628 Ga0495628_0018294 3300046516 Bacteria 5808
629 Ga0495628_0037461 3300046516 Bacteria 3888
630 Ga0495628_0095024 3300046516 Bacteria 2303
631 Ga0495628_0375719 3300046516 Bacteria 1041
632 Ga0495630_0318944 3300046517 Bacteria 1188
633 Ga0495630_0498118 3300046517 Bacteria 934
634 Ga0495644_0141073 3300046523 Bacteria 920
635 Ga0495663_0105722 3300046525 Unclassified 931
636 Ga0495663_0120312 3300046525 Bacteria 879
637 Ga0495666_0234661 3300046526 Bacteria 838
638 Ga0495652_0016350 3300046529 Bacteria 6637
639 Ga0495652_0054646 3300046529 Bacteria 3399
640 Ga0495652_0117081 3300046529 Unclassified 2132
641 Ga0495652_0239582 3300046529 Bacteria 1351
642 Ga0495652_0346526 3300046529 Bacteria 1065
643 Ga0495640_0072615 3300046533 Bacteria 2305
644 Ga0495640_0174775 3300046533 Unclassified 1371
645 Ga0495640_0175271 3300046533 Bacteria 1369
646 Ga0495640_0177476 3300046533 Bacteria 1359
647 Ga0495586_0122334 3300046535 Bacteria 1454
648 Ga0495587_0004472 3300046536 Bacteria 9197
649 Ga0495587_0013954 3300046536 Bacteria 5045
650 Ga0495587_0037914 3300046536 Bacteria 2892
651 Ga0495587_0048724 3300046536 Bacteria 2509
652 Ga0495598_0023137 3300046537 Bacteria 1670
653 Ga0495598_0043987 3300046537 Bacteria 1317
654 Ga0495598_0135763 3300046537 Unclassified 847
655 Ga0495621_0252241 3300046539 Unclassified 721
656 Ga0495645_0009743 3300046543 Bacteria 6722
657 Ga0495645_0010879 3300046543 Bacteria 6390
658 Ga0495633_0153027 3300046558 Bacteria 1065
659 Ga0495667_0005934 3300046559 Bacteria 8267
660 Ga0495667_0015775 3300046559 Bacteria 5108
661 Ga0495667_0068997 3300046559 Bacteria 2308
662 Ga0495667_0384952 3300046559 Bacteria 884
663 Ga0495656_0130270 3300046615 Bacteria 1196
664 Ga0495668_0047701 3300046616 Bacteria 2378
665 Ga0495668_0071689 3300046616 Bacteria 1904
666 Ga0495668_0176620 3300046616 Bacteria 1170
667 Ga0495668_0283930 3300046616 Bacteria 907
668 Ga0495625_0090807 3300046660 Bacteria 2112
669 Ga0495625_0110441 3300046660 Bacteria 1880
670 Ga0495635_0123371 3300046663 Unclassified 1767
671 Ga0495635_0185013 3300046663 Bacteria 1415
672 Ga0495635_0222074 3300046663 Bacteria 1278
673 Ga0495635_0605752 3300046663 Bacteria 715
674 Ga0495659_0140555 3300046664 Bacteria 963
675 Ga0495588_0195025 3300046674 Bacteria 1070
676 Ga0495657_0037654 3300046675 Bacteria 3332
677 Ga0495657_0061319 3300046675 Bacteria 2488
678 Ga0495657_0175565 3300046675 Bacteria 1317
679 Ga0495657_0316140 3300046675 Bacteria 929
680 Ga0495599_0083066 3300046678 Bacteria 2000
681 Ga0495599_0083267 3300046678 Bacteria 1998
682 Ga0495599_0250632 3300046678 Bacteria 1077
683 Ga0495623_0150751 3300046679 Unclassified 1374
684 Ga0495646_0006565 3300046680 Bacteria 7383
685 Ga0495613_0098684 3300046689 Unclassified 2111
686 Ga0495613_0169659 3300046689 Bacteria 1549
687 Ga0495670_0139527 3300046691 Bacteria 1267
688 Ga0495671_0184885 3300046692 Bacteria 1012
689 Ga0495589_0241136 3300046794 Bacteria 846
690 Ga0495600_0074665 3300046809 Bacteria 2214
691 Ga0495604_0031919 3300047317 Bacteria 4176
692 Ga0495604_0126038 3300047317 Bacteria 1846
693 Ga0495604_0129607 3300047317 Bacteria 1815
694 Ga0495604_0159449 3300047317 Bacteria 1595
695 Ga0495604_0276152 3300047317 Bacteria 1137
696 Ga0495636_0089167 3300047318 Unclassified 1337
697 Ga0495636_0246697 3300047318 Bacteria 825
698 Ga0495674_0020345 3300047319 Bacteria 6145
699 Ga0495674_0080200 3300047319 Bacteria 2801
700 Ga0495674_0133412 3300047319 Bacteria 2091
701 Ga0495674_0234409 3300047319 Bacteria 1514
702 Ga0495674_0418332 3300047319 Bacteria 1080
703 Ga0495674_0431362 3300047319 Bacteria 1061
704 Ga0495674_0471245 3300047319 Bacteria 1007
705 Ga0495674_0614688 3300047319 Bacteria 860
706 Ga0495672_0084359 3300047320 Bacteria 1762
707 Ga0495676_0290269 3300047321 Bacteria 1105
708 Ga0495680_0021163 3300047322 Bacteria 5451
709 Ga0495680_0200075 3300047322 Bacteria 1433
710 Ga0495680_0261214 3300047322 Bacteria 1225
711 Ga0495675_0008200 3300047444 Bacteria 6465
712 Ga0495675_0164037 3300047444 Bacteria 1367
713 Ga0495675_0521264 3300047444 Bacteria 680
714 Ga0495685_010835 3300047447 Bacteria 3064
715 Ga0495685_114834 3300047447 Bacteria 885
716 Ga0495684_0049239 3300047471 Bacteria 3220
717 Ga0495686_0377143 3300047472 Bacteria 766
718 Ga0495602_0037380 3300048088 Bacteria 4507
719 Ga0495602_0064991 3300048088 Bacteria 3151
720 Ga0495602_0250475 3300048088 Bacteria 1320
721 Ga0495602_0459153 3300048088 Bacteria 898
722 Ga0496101_0026834 3300048904 Bacteria 4005
723 Ga0496101_0130814 3300048904 Bacteria 1906
724 Ga0496102_0007185 3300048905 Bacteria 9508
725 Ga0496102_0565713 3300048905 Bacteria 1059
726 Ga0496103_0008881 3300048906 Bacteria 5962
727 Ga0496103_0331094 3300048906 Bacteria 979
728 Ga0496104_0002045 3300048907 Bacteria 17515
729 Ga0496104_0047392 3300048907 Bacteria 4050
730 Ga0496104_0069748 3300048907 Bacteria 3341
731 Ga0496104_0087251 3300048907 Bacteria 2980
732 Ga0496105_0006673 3300048908 Bacteria 8886
733 Ga0496106_0000882 3300048909 Bacteria 21853
734 Ga0496107_0070293 3300048910 Bacteria 2541
735 Ga0496107_0356576 3300048910 Unclassified 1088
736 Ga0496108_0269645 3300048911 Bacteria 1481
737 Ga0496108_0697884 3300048911 Bacteria 880
738 Ga0496108_0919119 3300048911 Bacteria 750
739 Ga0496109_0017657 3300048912 Bacteria 6258
740 Ga0496109_0234204 3300048912 Bacteria 1728
741 Ga0496109_0247576 3300048912 Bacteria 1678
742 Ga0496109_0487425 3300048912 Bacteria 1164
743 Ga0496110_0271458 3300048913 Bacteria 1544
744 Ga0496112_0486568 3300048915 Bacteria 1170
745 Ga0496112_0916078 3300048915 Unclassified 798
746 Ga0496112_1170573 3300048915 Bacteria 686
747 Ga0496115_0001146 3300048918 Bacteria 19143
748 Ga0496115_0012755 3300048918 Bacteria 6335
749 Ga0496115_0023397 3300048918 Bacteria 4794
750 Ga0496115_0819468 3300048918 Unclassified 723
751 Ga0496121_0100275 3300048924 Bacteria 2235
752 Ga0501032_0026246 3300049569 Bacteria 4009
753 Ga0501032_0452197 3300049569 Bacteria 823
754 Ga0501034_0030334 3300049571 Bacteria 5497
755 Ga0501034_0043161 3300049571 Bacteria 4564
756 Ga0501034_0216599 3300049571 Bacteria 1868
757 Ga0501034_0859838 3300049571 Unclassified 797
758 Ga0501036_0084099 3300049572 Bacteria 2691
759 Ga0501036_0153842 3300049572 Bacteria 1940
760 Ga0501036_0628597 3300049572 Bacteria 890
761 Ga0501038_0013988 3300049574 Bacteria 7313
762 Ga0501039_0061943 3300049575 Bacteria 2898
763 Ga0501040_0370698 3300049576 Bacteria 1027
764 Ga0501041_0200180 3300049577 Bacteria 1252
765 Ga0501041_0236445 3300049577 Bacteria 1148
766 Ga0501041_0255909 3300049577 Bacteria 1101
767 Ga0501041_0453449 3300049577 Bacteria 814
768 Ga0501041_0501056 3300049577 Bacteria 773
769 Ga0501042_0253227 3300049578 Bacteria 1271
770 Ga0501042_0436905 3300049578 Bacteria 949
771 Ga0501043_0121685 3300049579 Bacteria 2047
772 Ga0501043_0221987 3300049579 Bacteria 1462
773 Ga0501046_0071114 3300049580 Bacteria 2704
774 Ga0501047_0504799 3300049581 Bacteria 1036
775 Ga0501048_0240953 3300049582 Bacteria 1283
776 Ga0501048_0519235 3300049582 Bacteria 854
777 Ga0501067_0268342 3300049583 Bacteria 950
778 Ga0501069_0160541 3300049585 Bacteria 1294
779 Ga0501071_0424312 3300049587 Bacteria 1016
780 Ga0501071_0645102 3300049587 Bacteria 815
781 Ga0501071_0652030 3300049587 Bacteria 810
782 Ga0501072_0007891 3300049588 Bacteria 8081
783 Ga0501072_0023344 3300049588 Bacteria 4804
784 Ga0501072_0023651 3300049588 Bacteria 4772
785 Ga0501072_0148641 3300049588 Bacteria 1868
786 Ga0501072_0210254 3300049588 Bacteria 1550
787 Ga0501073_0031216 3300049589 Bacteria 3801
788 Ga0501073_0056548 3300049589 Bacteria 2744
789 Ga0501073_0177740 3300049589 Bacteria 1473
790 Ga0501073_0212043 3300049589 Bacteria 1338
791 Ga0501074_0365559 3300049590 Bacteria 1024
792 Ga0501075_0009534 3300049591 Bacteria 6796
793 Ga0501076_0013564 3300049592 Bacteria 6111
794 Ga0501076_0176015 3300049592 Bacteria 1744
795 Ga0501076_0728999 3300049592 Bacteria 818
796 Ga0501077_0010680 3300049593 Bacteria 5717
797 Ga0501077_0213334 3300049593 Bacteria 1227
798 Ga0501077_0259319 3300049593 Bacteria 1106
799 Ga0501079_0018639 3300049741 Bacteria 5302
800 Ga0501079_0032980 3300049741 Bacteria 3983
801 Ga0501079_0530200 3300049741 Bacteria 926
802 Ga0501080_0014240 3300049742 Bacteria 7322
803 Ga0501080_1042124 3300049742 Bacteria 708
804 Ga0501080_1204971 3300049742 Bacteria 651
805 Ga0501081_0068324 3300049743 Bacteria 2474
806 Ga0501081_0081391 3300049743 Bacteria 2268
807 Ga0501081_0109512 3300049743 Bacteria 1960
808 Ga0501081_0206300 3300049743 Bacteria 1426
809 Ga0501081_0404426 3300049743 Bacteria 1011
810 Ga0501083_0049416 3300049744 Bacteria 2834
811 Ga0501083_0151440 3300049744 Bacteria 1518
812 Ga0501083_0162698 3300049744 Bacteria 1460
813 Ga0501035_0480148 3300049822 Bacteria 1025
814 Ga0501044_0448618 3300049823 Bacteria 1197
815 Ga0501045_0243042 3300049824 Bacteria 1340
816 Ga0501045_0413035 3300049824 Bacteria 1004
817 Ga0501045_0519225 3300049824 Bacteria 884
818 nmdc:mga03683_136318_c1 3300050489 Bacteria 1101
819 nmdc:mga03683_153580_c1 3300050489 Bacteria 1040
820 nmdc:mga03683_196600_c1 3300050489 Bacteria 924
821 nmdc:mga03n38_414290_c1 3300050490 Unclassified 744
822 nmdc:mga03n38_7017_c1 3300050490 Bacteria 3959
823 nmdc:mga03n38_73510_c1 3300050490 Bacteria 1588
824 nmdc:mga03n38_93283_c1 3300050490 Bacteria 1438
825 nmdc:mga03n38_9430_c1 3300050490 Bacteria 3552
826 nmdc:mga00v17_102335_c1 3300050491 Unclassified 1809
827 nmdc:mga00v17_14988_c1 3300050491 Bacteria 4342
828 nmdc:mga00v17_25526_c1 3300050491 Bacteria 3436
829 nmdc:mga00v17_377089_c1 3300050491 Bacteria 922
830 nmdc:mga0yw44_158470_c1 3300050492 Bacteria 1481
831 nmdc:mga0yw44_17713_c1 3300050492 Bacteria 3884
832 nmdc:mga0yw44_20803_c1 3300050492 Bacteria 3648
833 nmdc:mga0yw44_380037_c1 3300050492 Bacteria 954
834 nmdc:mga0yw44_42148_c1 3300050492 Bacteria 2721
835 nmdc:mga0k408_4570_c1 3300050493 Bacteria 7347
836 nmdc:mga0k408_61462_c1 3300050493 Bacteria 2184
837 nmdc:mga06z11_104710_c1 3300050494 Bacteria 1558
838 nmdc:mga06z11_16982_c1 3300050494 Bacteria 3292
839 nmdc:mga06z11_6763_c1 3300050494 Bacteria 4685
840 nmdc:mga04h51_104575_c1 3300050495 Unclassified 1036
841 nmdc:mga04h51_28438_c1 3300050495 Bacteria 1744
842 nmdc:mga04h51_62193_c1 3300050495 Bacteria 1283
843 nmdc:mga04h51_7955_c1 3300050495 Bacteria 2821
844 nmdc:mga07m45_46902_c1 3300050496 Bacteria 2428
845 nmdc:mga07m45_57509_c1 3300050496 Bacteria 2199
846 nmdc:mga07m45_7640_c1 3300050496 Bacteria 5532
847 nmdc:mga05p37_1007547_c1 3300050507 Bacteria 884
848 nmdc:mga05p37_1103150_c1 3300050507 Unclassified 831
849 nmdc:mga05p37_1140703_c1 3300050507 Bacteria 812
850 nmdc:mga05p37_116573_c1 3300050507 Bacteria 3282
851 nmdc:mga05p37_116934_c1 3300050507 Bacteria 3277
852 nmdc:mga05p37_251483_c1 3300050507 Bacteria 2120
853 nmdc:mga05p37_2941_c1 3300050507 Bacteria 19774
854 nmdc:mga05p37_350558_c1 3300050507 Bacteria 1738
855 nmdc:mga05p37_616960_c1 3300050507 Bacteria 1221
856 nmdc:mga05p37_699197_c1 3300050507 Bacteria 1126
857 nmdc:mga09592_14360_c1 3300050508 Bacteria 6466
858 nmdc:mga09592_161641_c1 3300050508 Bacteria 1935
859 nmdc:mga09592_257721_c1 3300050508 Bacteria 1512
860 nmdc:mga09592_306053_c1 3300050508 Bacteria 1378
861 nmdc:mga09592_853761_c1 3300050508 Bacteria 768
862 nmdc:mga09592_97060_c1 3300050508 Bacteria 2522
863 nmdc:mga0qj67_116107_c1 3300050509 Bacteria 2163
864 nmdc:mga0qj67_122779_c1 3300050509 Bacteria 2101
865 nmdc:mga0qj67_37037_c1 3300050509 Bacteria 3820
866 nmdc:mga0qj67_612_c1 3300050509 Bacteria 24447
867 nmdc:mga0qj67_85713_c1 3300050509 Bacteria 2527
868 nmdc:mga06r32_144908_c1 3300050510 Unclassified 2353
869 nmdc:mga06r32_166935_c1 3300050510 Bacteria 2184
870 nmdc:mga06r32_175516_c1 3300050510 Bacteria 2127
871 nmdc:mga06r32_61367_c1 3300050510 Bacteria 3619
872 nmdc:mga06r32_785486_c1 3300050510 Bacteria 913
873 nmdc:mga06r32_85801_c1 3300050510 Bacteria 3070
874 nmdc:mga06r32_9884_c1 3300050510 Bacteria 8610
875 nmdc:mga08y16_106825_c1 3300050511 Bacteria 2914
876 nmdc:mga08y16_281994_c1 3300050511 Bacteria 1714
877 nmdc:mga08y16_415721_c1 3300050511 Bacteria 1375
878 nmdc:mga08y16_90174_c2 3300050511 Bacteria 2737
879 nmdc:mga0n895_167064_c1 3300050512 Bacteria 2232
880 nmdc:mga0rr50_57609_c1 3300050513 Bacteria 2907
881 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
882 nmdc:mga0a205_111697_c1 3300050515 Bacteria 2632
883 nmdc:mga0a205_246409_c1 3300050515 Bacteria 1667
884 nmdc:mga0a205_3620_c1 3300050515 Bacteria 13829
885 nmdc:mga0a205_718925_c1 3300050515 Bacteria 848
886 nmdc:mga0sz30_152411_c1 3300050516 Bacteria 1023
887 nmdc:mga0sz30_4812_c1 3300050516 Bacteria 4913
888 nmdc:mga0sz30_56677_c1 3300050516 Bacteria 1669
889 Ga0495601_0000355 3300053077 Bacteria 24059
890 Ga0495601_0005938 3300053077 Bacteria 7121
891 Ga0495601_0007783 3300053077 Bacteria 6301
892 Ga0495601_0015791 3300053077 Bacteria 4569
893 Ga0495601_0015906 3300053077 Bacteria 4552
894 Ga0495601_0127568 3300053077 Bacteria 1655
895 Ga0495601_0298026 3300053077 Bacteria 1050
896 Ga0495601_0445429 3300053077 Unclassified 838
897 Ga0495612_0002359 3300053078 Bacteria 7779
898 Ga0495612_0002974 3300053078 Bacteria 7037
899 Ga0495612_0003379 3300053078 Bacteria 6611
900 Ga0495612_0029577 3300053078 Bacteria 2207
901 Ga0495612_0138782 3300053078 Bacteria 1053
902 Ga0495612_0199648 3300053078 Bacteria 882
903 Ga0500610_0124301 3300053079 Bacteria 1317
904 Ga0495595_0000484 3300053084 Bacteria 15140
905 Ga0495595_0007121 3300053084 Bacteria 4570
906 Ga0495595_0009918 3300053084 Bacteria 3948
907 Ga0495595_0015954 3300053084 Bacteria 3208
908 Ga0495595_0091644 3300053084 Unclassified 1458
909 Ga0495595_0139752 3300053084 Bacteria 1188
910 Ga0495619_0000998 3300053085 Bacteria 18513
911 Ga0495619_0001353 3300053085 Bacteria 16080
912 Ga0495619_0010015 3300053085 Bacteria 5967
913 Ga0495619_0011323 3300053085 Bacteria 5613
914 Ga0495619_0020002 3300053085 Bacteria 4259
915 Ga0495619_0067773 3300053085 Bacteria 2383
916 Ga0495619_0107640 3300053085 Bacteria 1902
917 Ga0495619_0251502 3300053085 Bacteria 1224
918 Ga0500643_029927 3300053087 Bacteria 1672
919 Ga0500644_0000670 3300053088 Bacteria 12478
920 Ga0500651_0031552 3300053093 Bacteria 3336
921 Ga0500641_0001812 3300053096 Bacteria 7576
922 Ga0500641_0130097 3300053096 Bacteria 1086
923 Ga0500641_0232705 3300053096 Bacteria 778
924 Ga0500595_056359 3300053119 Bacteria 1201
925 Ga0500568_0032664 3300053139 Bacteria 2139
926 Ga0500616_0000002 3300053153 Bacteria 1611257
927 Ga0500616_0100815 3300053153 Bacteria 1411
928 Ga0501084_0035485 3300054114 Bacteria 4168
929 Ga0501082_0000196 3300060353 Bacteria 52428
930 Ga0501082_0001410 3300060353 Bacteria 21122
931 Ga0501082_0014359 3300060353 Bacteria 6814
932 Ga0501082_0114241 3300060353 Bacteria 2338
933 Ga0501082_0197273 3300060353 Bacteria 1751
934 Ga0501082_0230845 3300060353 Bacteria 1610
935 Ga0501082_0239964 3300060353 Bacteria 1577
936 Ga0501082_0363022 3300060353 Bacteria 1263
937 Ga0530510_0208018 3300061734 Bacteria 1454
938 Ga0530510_0249613 3300061734 Bacteria 1322
939 Ga0157370_10001482
940 JGI24741J21665_1012387
941 JGI24738J21930_10026121
942 JGI24751J29686_10000215
943 JGI24751J29686_10003625
944 JGI25406J46586_10023895
945 JGI25405J52794_10009658
946 JGI25405J52794_10028502
947 Ga0065165_1000413
948 Ga0065704_10076710
949 Ga0065707_10082851
950 Ga0070658_10046799
951 Ga0070676_10153890
952 Ga0070676_10497554
953 Ga0070690_100191131
954 Ga0070690_100688412
955 Ga0070670_100001886
956 Ga0070670_100450372
957 Ga0070670_100552326
958 Ga0070677_10018528
959 Ga0070677_10329895
960 Ga0068869_100084721
961 Ga0070680_100012496
962 Ga0070680_100053078
963 Ga0070680_100213607
964 Ga0070680_100579995
965 Ga0070682_100002383
966 Ga0070682_100053618
967 Ga0068868_100617194
968 Ga0068868_100726321
969 Ga0070660_100104963
970 Ga0070660_100107681
971 Ga0070660_100239476
972 Ga0070660_100292131
973 Ga0070689_100007921
974 Ga0070689_100039767
975 Ga0070689_100336505
976 Ga0070691_10030690
977 Ga0070691_10036241
978 Ga0070687_100044336
979 Ga0070687_100116930
980 Ga0070687_100119362
981 Ga0070661_100401352
982 Ga0070668_100023968
983 Ga0070668_100181275
984 Ga0070668_100213051
985 Ga0070668_100512824
986 Ga0070669_100090872
987 Ga0070675_100192424
988 Ga0070675_100280190
989 Ga0070675_100472006
990 Ga0070675_100584459
991 Ga0070671_100157437
992 Ga0070671_100241969
993 Ga0070671_100334834
994 Ga0070674_100008433
995 Ga0070674_100055621
996 Ga0070674_100331627
997 Ga0070674_100359222
998 Ga0070673_100115455
999 Ga0070673_100181084
1000 Ga0070688_100020958
1001 Ga0070688_100185533
1002 Ga0070659_100017427
1003 Ga0070667_100439910
1004 Ga0070703_10011507
1005 Ga0070709_10065464
1006 Ga0070709_10398954
1007 Ga0070714_100079855
1008 Ga0070714_100123686
1009 Ga0070701_10071306
1010 Ga0070711_100206120
1011 Ga0070705_100308057
1012 Ga0070705_100326273
1013 Ga0070700_100004965
1014 Ga0070700_100185042
1015 Ga0070694_100001395
1016 Ga0070708_100030598
1017 Ga0070708_100652353
1018 Ga0070663_100139481
1019 Ga0070663_100223838
1020 Ga0070678_100041136
1021 Ga0070662_100031485
1022 Ga0070662_100092068
1023 Ga0070662_100221371
1024 Ga0070662_100536327
1025 Ga0070681_10015386
1026 Ga0070681_10032521
1027 Ga0070681_10078339
1028 Ga0070681_10082022
1029 Ga0068867_100224774
1030 Ga0068867_100320022
1031 Ga0070685_10090935
1032 Ga0070699_100000903
1033 Ga0070699_100403574
1034 Ga0070679_100100677
1035 Ga0070679_100238262
1036 Ga0070679_100296379
1037 Ga0070684_100364089
1038 Ga0070697_100153327
1039 Ga0070697_100179967
1040 Ga0068853_100011270
1041 Ga0068853_100108853
1042 Ga0068853_100299057
1043 Ga0070672_100298212
1044 Ga0070672_100500103
1045 Ga0070686_100234960
1046 Ga0070695_100000639
1047 Ga0070695_100030339
1048 Ga0070695_100466992
1049 Ga0070696_100000250
1050 Ga0070693_100005322
1051 Ga0070665_100000015
1052 Ga0070665_100148660
1053 Ga0070704_100001558
1054 Ga0070704_100270154
1055 Ga0070704_100671819
1056 Ga0068855_100022674
1057 Ga0068855_100039944
1058 Ga0068855_100055592
1059 Ga0068855_100218859
1060 Ga0068855_100344109
1061 Ga0068855_100756710
1062 Ga0068855_100988413
1063 Ga0070664_100017578
1064 Ga0070664_101072973
1065 Ga0068857_100021931
1066 Ga0068857_100157314
1067 Ga0068854_100018166
1068 Ga0068854_100070221
1069 Ga0068854_100230082
1070 Ga0068854_100878066
1071 Ga0068856_100029620
1072 Ga0068852_100016145
1073 Ga0068852_100136803
1074 Ga0068852_100789508
1075 Ga0068859_100000958
1076 Ga0068859_100008025
1077 Ga0068859_100689544
1078 Ga0068859_101115688
1079 Ga0068859_101199582
1080 Ga0068864_100006627
1081 Ga0068864_101292700
1082 Ga0068864_101409256
1083 Ga0068866_10188534
1084 Ga0068861_100003912
1085 Ga0068861_100005610
1086 Ga0068861_100043277
1087 Ga0068861_100075251
1088 Ga0068861_100218398
1089 Ga0068870_10300266
1090 Ga0068858_100065570
1091 Ga0068858_100093714
1092 Ga0068858_100220288
1093 Ga0068858_100434324
1094 Ga0068860_100006237
1095 Ga0068860_100024614
1096 Ga0068860_100859770
1097 Ga0068862_100001758
1098 Ga0068862_100151839
1099 Ga0068862_100459371
1100 Ga0081455_10000078
1101 Ga0081455_10000110
1102 Ga0081455_10047650
1103 Ga0081455_10142529
1104 Ga0081455_10644120
1105 Ga0081540_1000202
1106 Ga0081540_1013347
1107 Ga0081540_1084155
1108 Ga0081539_10001677
1109 Ga0081539_10191974
1110 Ga0070717_10119294
1111 Ga0075365_10004803
1112 Ga0075365_10116993
1113 Ga0075365_10151063
1114 Ga0075365_10699328
1115 Ga0075368_10017785
1116 Ga0075368_10070963
1117 Ga0075363_100014479
1118 Ga0075363_100030230
1119 Ga0075363_100190464
1120 Ga0075364_10006364
1121 Ga0075364_10072805
1122 Ga0075364_10082690
1123 Ga0075364_10095269
1124 Ga0075364_10443806
1125 Ga0070716_100230107
1126 Ga0075362_10008126
1127 Ga0075362_10104635
1128 Ga0075362_10168307
1129 Ga0075367_10232095
1130 Ga0075367_10283532
1131 Ga0075369_10000396
1132 Ga0075369_10212560
1133 Ga0075366_10004688
1134 Ga0075366_10038718
1135 Ga0075370_10020103
1136 Ga0075370_10039084
1137 Ga0075370_10204771
1138 Ga0075370_10277137
1139 Ga0075428_100003993
1140 Ga0075428_100054246
1141 Ga0075428_100060129
1142 Ga0075428_100200047
1143 Ga0075428_100221886
1144 Ga0075428_100267065
1145 Ga0075428_100351409
1146 Ga0075428_100782670
1147 Ga0075430_100001762
1148 Ga0075430_100009847
1149 Ga0075430_100016834
1150 Ga0075430_100041371
1151 Ga0075430_100233203
1152 Ga0075430_100239465
1153 Ga0075431_100028619
1154 Ga0075431_100030283
1155 Ga0075431_100038372
1156 Ga0075431_100058754
1157 Ga0075431_100089520
1158 Ga0075431_100175755
1159 Ga0075431_100289478
1160 Ga0075433_10040772
1161 Ga0075433_10057597
1162 Ga0075434_100779152
1163 Ga0075434_100843980
1164 Ga0075429_100013355
1165 Ga0075429_100041173
1166 Ga0075429_100166722
1167 Ga0075429_100260383
1168 Ga0075429_100754095
1169 Ga0075429_100763338
1170 Ga0068865_100011667
1171 Ga0097620_100000958
1172 Ga0097620_100008024
1173 Ga0097620_100689524
1174 Ga0097620_101115552
1175 Ga0097620_101199754
1176 Ga0075435_100021488
1177 Ga0075435_100166013
1178 Ga0075435_100677914
1179 Ga0099795_10009637
1180 Ga0105240_10010073
1181 Ga0105240_10878129
1182 Ga0111539_10021299
1183 Ga0111539_10024407
1184 Ga0111539_10111223
1185 Ga0111539_10157790
1186 Ga0111539_10301381
1187 Ga0111539_10470054
1188 Ga0111539_11098871
1189 Ga0105245_10051687
1190 Ga0105245_10055280
1191 Ga0105247_10039157
1192 Ga0105247_10082996
1193 Ga0114129_10007093
1194 Ga0114129_10105196
1195 Ga0114129_10137700
1196 Ga0114129_10143716
1197 Ga0114129_10826888
1198 Ga0114129_10905267
1199 Ga0114129_11260413
1200 Ga0105243_10382684
1201 Ga0105243_10393087
1202 Ga0105243_10504082
1203 Ga0105243_10782723
1204 Ga0105243_10792713
1205 Ga0105241_10170832
1206 Ga0105241_10800492
1207 Ga0105242_10121639
1208 Ga0105242_10213785
1209 Ga0105242_10534900
1210 Ga0105248_10001636
1211 Ga0105248_10137571
1212 Ga0105248_10345950
1213 Ga0105248_10374233
1214 Ga0105248_10384681
1215 Ga0105248_10805532
1216 Ga0105238_10043794
1217 Ga0105238_10063581
1218 Ga0105238_10084145
1219 Ga0105238_10117478
1220 Ga0105238_10259053
1221 Ga0105249_10001768
1222 Ga0105249_10002516
1223 Ga0105249_10376725
1224 Ga0105249_10583592
1225 Ga0105249_10846450
1226 Ga0099796_10003800
1227 Ga0105239_10348760
1228 Ga0105239_10422992
1229 Ga0105239_10772696
1230 Ga0157370_11041689
1231 Ga0157369_10242817
1232 Ga0157369_10261463
1233 Ga0157369_10699452
1234 Ga0157374_10091374
1235 Ga0157378_10011699
1236 Ga0157378_10125945
1237 Ga0157378_10240601
1238 Ga0157378_10333829
1239 Ga0157378_11510913
1240 Ga0163162_10083716
1241 Ga0163162_11082176
1242 Ga0157372_10005465
1243 Ga0157372_10347272
1244 Ga0157372_10476373
1245 Ga0157372_11188487
1246 Ga0157375_10124349
1247 Ga0157375_10222522
1248 Ga0157375_10302062
1249 Ga0157375_10538779
1250 Ga0157375_11209917
1251 Ga0163163_10066373
1252 Ga0163163_10236673
1253 Ga0163163_10437343
1254 Ga0163163_10553515
1255 Ga0157380_10008333
1256 Ga0157380_10077477
1257 Ga0157380_10080990
1258 Ga0157380_10179414
1259 Ga0157380_10262453
1260 Ga0157380_10563302
1261 Ga0182008_10277741
1262 Ga0157377_10127846
1263 Ga0157377_10473120
1264 Ga0157379_10809449
1265 Ga0157376_10033955
1266 Ga0157376_10615240
1267 Ga0163161_10347642
1268 Ga0163161_10395363
1269 Ga0163161_10395740
1270 Ga0163161_10665975
1271 Ga0213876_10176645
1272 Ga0213876_10271971
1273 Ga0213875_10000093
1274 Ga0207697_10076179
1275 Ga0207653_10000382
1276 Ga0207682_10000821
1277 Ga0207682_10335054
1278 Ga0207692_10047485
1279 Ga0207642_10089325
1280 Ga0207710_10003734
1281 Ga0207688_10055385
1282 Ga0207647_10048380
1283 Ga0207685_10210419
1284 Ga0207699_10051336
1285 Ga0207699_10481359
1286 Ga0207645_10164152
1287 Ga0207645_10256611
1288 Ga0207643_10078310
1289 Ga0207705_10194336
1290 Ga0207684_10603637
1291 Ga0207707_10005195
1292 Ga0207707_10010239
1293 Ga0207707_10129608
1294 Ga0207695_10008153
1295 Ga0207695_10508116
1296 Ga0207695_10616196
1297 Ga0207693_10006473
1298 Ga0207693_10668248
1299 Ga0207663_10341106
1300 Ga0207660_10008213
1301 Ga0207660_10015600
1302 Ga0207660_10025055
1303 Ga0207662_10039972
1304 Ga0207662_10090491
1305 Ga0207662_10141750
1306 Ga0207662_10192904
1307 Ga0207657_10051226
1308 Ga0207657_10056774
1309 Ga0207657_10184725
1310 Ga0207649_10172967
1311 Ga0207652_10038323
1312 Ga0207652_10291499
1313 Ga0207681_10360906
1314 Ga0207681_10632024
1315 Ga0207694_10038009
1316 Ga0207694_10342120
1317 Ga0207650_10001277
1318 Ga0207659_10106876
1319 Ga0207659_10511714
1320 Ga0207687_10035375
1321 Ga0207687_10098856
1322 Ga0207687_10316890
1323 Ga0207700_11142467
1324 Ga0207644_10109202
1325 Ga0207644_10220113
1326 Ga0207644_10916818
1327 Ga0207644_11174449
1328 Ga0207690_10076422
1329 Ga0207690_10577450
1330 Ga0207706_10053674
1331 Ga0207706_10057728
1332 Ga0207706_10088415
1333 Ga0207706_10146155
1334 Ga0207706_10173862
1335 Ga0207706_10220525
1336 Ga0207686_10065267
1337 Ga0207709_10279975
1338 Ga0207709_10389742
1339 Ga0207709_10615947
1340 Ga0207670_10081486
1341 Ga0207670_10116506
1342 Ga0207670_10171714
1343 Ga0207670_10241255
1344 Ga0207669_10029763
1345 Ga0207669_10115566
1346 Ga0207669_10138837
1347 Ga0207669_10278675
1348 Ga0207704_10003609
1349 Ga0207704_10216247
1350 Ga0207704_10544701
1351 Ga0207665_10060187
1352 Ga0207665_10144357
1353 Ga0207691_10005190
1354 Ga0207711_10000978
1355 Ga0207711_10114774
1356 Ga0207711_10685808
1357 Ga0207711_10796363
1358 Ga0207689_10131580
1359 Ga0207689_10220929
1360 Ga0207661_10527047
1361 Ga0207679_10013958
1362 Ga0207667_10003251
1363 Ga0207667_10028640
1364 Ga0207667_10042681
1365 Ga0207667_10048261
1366 Ga0207667_10204736
1367 Ga0207712_10000685
1368 Ga0207712_10005821
1369 Ga0207712_10229426
1370 Ga0207712_10317189
1371 Ga0207712_10552568
1372 Ga0207668_10323688
1373 Ga0207668_10506285
1374 Ga0207640_10012353
1375 Ga0207658_10135868
1376 Ga0207658_10405886
1377 Ga0207658_11032396
1378 Ga0207677_10035790
1379 Ga0207677_10671647
1380 Ga0207703_10017879
1381 Ga0207703_10121057
1382 Ga0207703_10386658
1383 Ga0207703_10651086
1384 Ga0207639_10004937
1385 Ga0207639_10158926
1386 Ga0207639_10234525
1387 Ga0207639_10492834
1388 Ga0207678_10041070
1389 Ga0207678_10098401
1390 Ga0207678_10168846
1391 Ga0207678_10455730
1392 Ga0207708_10003552
1393 Ga0207708_10087203
1394 Ga0207708_10105093
1395 Ga0207708_10251317
1396 Ga0207708_10770179
1397 Ga0207702_10122376
1398 Ga0207702_10762433
1399 Ga0207641_10339541
1400 Ga0207648_10140220
1401 Ga0207648_10149060
1402 Ga0207648_10521400
1403 Ga0207676_10009291
1404 Ga0207676_10051990
1405 Ga0207676_11053861
1406 Ga0207676_11379493
1407 Ga0207674_10007063
1408 Ga0207674_10171105
1409 Ga0207674_10378753
1410 Ga0207675_100008452
1411 Ga0207675_100009092
1412 Ga0207675_100064583
1413 Ga0207675_100122276
1414 Ga0207675_100170256
1415 Ga0207683_10000733
1416 Ga0207683_10006383
1417 Ga0207683_10080262
1418 Ga0207683_10127248
1419 Ga0207698_10109332
1420 Ga0207698_10125757
1421 Ga0209999_1001692
1422 Ga0209983_1004946
1423 Ga0209813_10000690
1424 Ga0209813_10044965
1425 Ga0209813_10060969
1426 Ga0207428_10023506
1427 Ga0207428_10140193
1428 Ga0268266_10000005
1429 Ga0268266_10052131
1430 Ga0268265_10002643
1431 Ga0268265_10224872
1432 Ga0268265_10587664
1433 Ga0268264_10014518
1434 Ga0268264_10655440
1435 Ga0268264_10748867
1436 Ga0268264_11109747
1437 Ga0265337_1004028
1438 Ga0265318_10047166
1439 Ga0265338_10246595
1440 Ga0265330_10033608
1441 Ga0265330_10054671
1442 Ga0265332_10073566
1443 Ga0265332_10218029
1444 Ga0265320_10045703
1445 Ga0265325_10008156
1446 Ga0265325_10025840
1447 Ga0265325_10062594
1448 Ga0265340_10009914
1449 Ga0265340_10039778
1450 Ga0265340_10225682
1451 Ga0265339_10012947
1452 Ga0265339_10082195
1453 Ga0265316_10043391
1454 Ga0265316_10144881
1455 Ga0265316_10397796
1456 Ga0307513_10006527
1457 Ga0307408_100166632
1458 Ga0307408_100339967
1459 Ga0307408_100766452
1460 Ga0265313_10001400
1461 Ga0265313_10007777
1462 Ga0265313_10011350
1463 Ga0265313_10158528
1464 Ga0265314_10173913
1465 Ga0265314_10242971
1466 Ga0265342_10006348
1467 Ga0307405_10003147
1468 Ga0307405_10223429
1469 Ga0307413_10217896
1470 Ga0307413_10565530
1471 Ga0307406_10148722
1472 Ga0307406_10177067
1473 Ga0307407_10055877
1474 Ga0307407_10204981
1475 Ga0307409_101343225
1476 Ga0307409_101448516
1477 Ga0307416_100031411
1478 Ga0307416_100202545
1479 Ga0373958_0016992
1480 Ga0373958_0034164
1481 Ga0373926_0149182
1482 Ga0373929_0055921
1483 Ga0373940_0020986
1484 Ga0373940_0113064
1485 Ga0373951_0025398
1486 Ga0373951_0090305
1487 Ga0373932_0017950
1488 Ga0373932_0020151
1489 Ga0373936_0073555
1490 Ga0373939_0002641
1491 Ga0373945_0065975
1492 Ga0373953_0048233
1493 Ga0373954_0059635
1494 Ga0373956_0091500
1495 Ga0373957_0022995
1496 Ga0373946_0447715
1497 Ga0373955_0008661
1498 Ga0373955_0013299
1499 Ga0373942_0005848
1500 Ga0373961_0024296
1501 Ga0373962_0012217
1502 Ga0373962_0161448
1503 Ga0373924_0157543
1504 Ga0373931_0002256
1505 Ga0373931_0011400
1506 Ga0373935_0073138
1507 Ga0373935_0872176
1508 Ga0373927_0022614
1509 Ga0373927_0028739
1510 Ga0373927_0059984
1511 Ga0373927_0246355
1512 Ga0373933_0027103
1513 Ga0373933_0140979
1514 Ga0373947_0329135
1515 Ga0373937_0010973
1516 Ga0373937_0020646
1517 Ga0373937_0047869
1518 Ga0373937_0049280
1519 Ga0373937_0184054
1520 Ga0373937_0262931
1521 Ga0373937_0630265
1522 Ga0373925_0114843
1523 Ga0373925_0270259
1524 Ga0436364_0399903
1525 Ga0436364_0773474
1526 Ga0436365_0367932
1527 Ga0436365_0509749
1528 Ga0436365_1217404
1529 Ga0436365_1819757
1530 Ga0436360_0511587
1531 Ga0436361_1205150
1532 Ga0436363_1631277
1533 Ga0439466_0061010
1534 Ga0451855_1085264
1535 Ga0439443_003991
1536 Ga0439435_0002245
1537 Ga0450893_0022252
1538 Ga0495592_0012987
1539 Ga0495592_0139255
1540 Ga0495603_0063475
1541 Ga0495603_0123926
1542 Ga0495603_0276157
1543 Ga0495629_0080363
1544 Ga0495638_0053804
1545 Ga0495638_0245358
1546 Ga0495638_0357151
1547 Ga0495651_0033079
1548 Ga0495651_0038641
1549 Ga0495651_0289778
1550 Ga0495651_0564255
1551 Ga0495653_0089987
1552 Ga0495650_0024987
1553 Ga0495650_0069652
1554 Ga0495582_0396973
1555 Ga0495639_0376862
1556 Ga0495664_0086896
1557 Ga0495664_0255185
1558 Ga0495585_0029332
1559 Ga0495596_0117826
1560 Ga0495583_0020119
1561 Ga0495583_0210597
1562 Ga0495608_0008463
1563 Ga0495608_0112935
1564 Ga0495608_0502982
1565 Ga0495618_0348552
1566 Ga0495628_0018294
1567 Ga0495628_0037461
1568 Ga0495628_0095024
1569 Ga0495628_0375719
1570 Ga0495630_0318944
1571 Ga0495630_0498118
1572 Ga0495644_0141073
1573 Ga0495663_0105722
1574 Ga0495663_0120312
1575 Ga0495666_0234661
1576 Ga0495652_0016350
1577 Ga0495652_0054646
1578 Ga0495652_0117081
1579 Ga0495652_0239582
1580 Ga0495652_0346526
1581 Ga0495640_0072615
1582 Ga0495640_0174775
1583 Ga0495640_0175271
1584 Ga0495640_0177476
1585 Ga0495586_0122334
1586 Ga0495587_0004472
1587 Ga0495587_0013954
1588 Ga0495587_0037914
1589 Ga0495587_0048724
1590 Ga0495598_0023137
1591 Ga0495598_0043987
1592 Ga0495598_0135763
1593 Ga0495621_0252241
1594 Ga0495645_0009743
1595 Ga0495645_0010879
1596 Ga0495633_0153027
1597 Ga0495667_0005934
1598 Ga0495667_0015775
1599 Ga0495667_0068997
1600 Ga0495667_0384952
1601 Ga0495656_0130270
1602 Ga0495668_0047701
1603 Ga0495668_0071689
1604 Ga0495668_0176620
1605 Ga0495668_0283930
1606 Ga0495625_0090807
1607 Ga0495625_0110441
1608 Ga0495635_0123371
1609 Ga0495635_0185013
1610 Ga0495635_0222074
1611 Ga0495635_0605752
1612 Ga0495659_0140555
1613 Ga0495588_0195025
1614 Ga0495657_0037654
1615 Ga0495657_0061319
1616 Ga0495657_0175565
1617 Ga0495657_0316140
1618 Ga0495599_0083066
1619 Ga0495599_0083267
1620 Ga0495599_0250632
1621 Ga0495623_0150751
1622 Ga0495646_0006565
1623 Ga0495613_0098684
1624 Ga0495613_0169659
1625 Ga0495670_0139527
1626 Ga0495671_0184885
1627 Ga0495589_0241136
1628 Ga0495600_0074665
1629 Ga0495604_0031919
1630 Ga0495604_0126038
1631 Ga0495604_0129607
1632 Ga0495604_0159449
1633 Ga0495604_0276152
1634 Ga0495636_0089167
1635 Ga0495636_0246697
1636 Ga0495674_0020345
1637 Ga0495674_0080200
1638 Ga0495674_0133412
1639 Ga0495674_0234409
1640 Ga0495674_0418332
1641 Ga0495674_0431362
1642 Ga0495674_0471245
1643 Ga0495674_0614688
1644 Ga0495672_0084359
1645 Ga0495676_0290269
1646 Ga0495680_0021163
1647 Ga0495680_0200075
1648 Ga0495680_0261214
1649 Ga0495675_0008200
1650 Ga0495675_0164037
1651 Ga0495675_0521264
1652 Ga0495685_010835
1653 Ga0495685_114834
1654 Ga0495684_0049239
1655 Ga0495686_0377143
1656 Ga0495602_0037380
1657 Ga0495602_0064991
1658 Ga0495602_0250475
1659 Ga0495602_0459153
1660 Ga0496101_0026834
1661 Ga0496101_0130814
1662 Ga0496102_0007185
1663 Ga0496102_0565713
1664 Ga0496103_0008881
1665 Ga0496103_0331094
1666 Ga0496104_0002045
1667 Ga0496104_0047392
1668 Ga0496104_0069748
1669 Ga0496104_0087251
1670 Ga0496105_0006673
1671 Ga0496106_0000882
1672 Ga0496107_0070293
1673 Ga0496107_0356576
1674 Ga0496108_0269645
1675 Ga0496108_0697884
1676 Ga0496108_0919119
1677 Ga0496109_0017657
1678 Ga0496109_0234204
1679 Ga0496109_0247576
1680 Ga0496109_0487425
1681 Ga0496110_0271458
1682 Ga0496112_0486568
1683 Ga0496112_0916078
1684 Ga0496112_1170573
1685 Ga0496115_0001146
1686 Ga0496115_0012755
1687 Ga0496115_0023397
1688 Ga0496115_0819468
1689 Ga0496121_0100275
1690 Ga0501032_0026246
1691 Ga0501032_0452197
1692 Ga0501034_0030334
1693 Ga0501034_0043161
1694 Ga0501034_0216599
1695 Ga0501034_0859838
1696 Ga0501036_0084099
1697 Ga0501036_0153842
1698 Ga0501036_0628597
1699 Ga0501038_0013988
1700 Ga0501039_0061943
1701 Ga0501040_0370698
1702 Ga0501041_0200180
1703 Ga0501041_0236445
1704 Ga0501041_0255909
1705 Ga0501041_0453449
1706 Ga0501041_0501056
1707 Ga0501042_0253227
1708 Ga0501042_0436905
1709 Ga0501043_0121685
1710 Ga0501043_0221987
1711 Ga0501046_0071114
1712 Ga0501047_0504799
1713 Ga0501048_0240953
1714 Ga0501048_0519235
1715 Ga0501067_0268342
1716 Ga0501069_0160541
1717 Ga0501071_0424312
1718 Ga0501071_0645102
1719 Ga0501071_0652030
1720 Ga0501072_0007891
1721 Ga0501072_0023344
1722 Ga0501072_0023651
1723 Ga0501072_0148641
1724 Ga0501072_0210254
1725 Ga0501073_0031216
1726 Ga0501073_0056548
1727 Ga0501073_0177740
1728 Ga0501073_0212043
1729 Ga0501074_0365559
1730 Ga0501075_0009534
1731 Ga0501076_0013564
1732 Ga0501076_0176015
1733 Ga0501076_0728999
1734 Ga0501077_0010680
1735 Ga0501077_0213334
1736 Ga0501077_0259319
1737 Ga0501079_0018639
1738 Ga0501079_0032980
1739 Ga0501079_0530200
1740 Ga0501080_0014240
1741 Ga0501080_1042124
1742 Ga0501080_1204971
1743 Ga0501081_0068324
1744 Ga0501081_0081391
1745 Ga0501081_0109512
1746 Ga0501081_0206300
1747 Ga0501081_0404426
1748 Ga0501083_0049416
1749 Ga0501083_0151440
1750 Ga0501083_0162698
1751 Ga0501035_0480148
1752 Ga0501044_0448618
1753 Ga0501045_0243042
1754 Ga0501045_0413035
1755 Ga0501045_0519225
1756 nmdc:mga03683_136318_c1
1757 nmdc:mga03683_153580_c1
1758 nmdc:mga03683_196600_c1
1759 nmdc:mga03n38_414290_c1
1760 nmdc:mga03n38_7017_c1
1761 nmdc:mga03n38_73510_c1
1762 nmdc:mga03n38_93283_c1
1763 nmdc:mga03n38_9430_c1
1764 nmdc:mga00v17_102335_c1
1765 nmdc:mga00v17_14988_c1
1766 nmdc:mga00v17_25526_c1
1767 nmdc:mga00v17_377089_c1
1768 nmdc:mga0yw44_158470_c1
1769 nmdc:mga0yw44_17713_c1
1770 nmdc:mga0yw44_20803_c1
1771 nmdc:mga0yw44_380037_c1
1772 nmdc:mga0yw44_42148_c1
1773 nmdc:mga0k408_4570_c1
1774 nmdc:mga0k408_61462_c1
1775 nmdc:mga06z11_104710_c1
1776 nmdc:mga06z11_16982_c1
1777 nmdc:mga06z11_6763_c1
1778 nmdc:mga04h51_104575_c1
1779 nmdc:mga04h51_28438_c1
1780 nmdc:mga04h51_62193_c1
1781 nmdc:mga04h51_7955_c1
1782 nmdc:mga07m45_46902_c1
1783 nmdc:mga07m45_57509_c1
1784 nmdc:mga07m45_7640_c1
1785 nmdc:mga05p37_1007547_c1
1786 nmdc:mga05p37_1103150_c1
1787 nmdc:mga05p37_1140703_c1
1788 nmdc:mga05p37_116573_c1
1789 nmdc:mga05p37_116934_c1
1790 nmdc:mga05p37_251483_c1
1791 nmdc:mga05p37_2941_c1
1792 nmdc:mga05p37_350558_c1
1793 nmdc:mga05p37_616960_c1
1794 nmdc:mga05p37_699197_c1
1795 nmdc:mga09592_14360_c1
1796 nmdc:mga09592_161641_c1
1797 nmdc:mga09592_257721_c1
1798 nmdc:mga09592_306053_c1
1799 nmdc:mga09592_853761_c1
1800 nmdc:mga09592_97060_c1
1801 nmdc:mga0qj67_116107_c1
1802 nmdc:mga0qj67_122779_c1
1803 nmdc:mga0qj67_37037_c1
1804 nmdc:mga0qj67_612_c1
1805 nmdc:mga0qj67_85713_c1
1806 nmdc:mga06r32_144908_c1
1807 nmdc:mga06r32_166935_c1
1808 nmdc:mga06r32_175516_c1
1809 nmdc:mga06r32_61367_c1
1810 nmdc:mga06r32_785486_c1
1811 nmdc:mga06r32_85801_c1
1812 nmdc:mga06r32_9884_c1
1813 nmdc:mga08y16_106825_c1
1814 nmdc:mga08y16_281994_c1
1815 nmdc:mga08y16_415721_c1
1816 nmdc:mga08y16_90174_c2
1817 nmdc:mga0n895_167064_c1
1818 nmdc:mga0rr50_57609_c1
1819 nmdc:mga08x19_4_c2
1820 nmdc:mga0a205_111697_c1
1821 nmdc:mga0a205_246409_c1
1822 nmdc:mga0a205_3620_c1
1823 nmdc:mga0a205_718925_c1
1824 nmdc:mga0sz30_152411_c1
1825 nmdc:mga0sz30_4812_c1
1826 nmdc:mga0sz30_56677_c1
1827 Ga0495601_0000355
1828 Ga0495601_0005938
1829 Ga0495601_0007783
1830 Ga0495601_0015791
1831 Ga0495601_0015906
1832 Ga0495601_0127568
1833 Ga0495601_0298026
1834 Ga0495601_0445429
1835 Ga0495612_0002359
1836 Ga0495612_0002974
1837 Ga0495612_0003379
1838 Ga0495612_0029577
1839 Ga0495612_0138782
1840 Ga0495612_0199648
1841 Ga0500610_0124301
1842 Ga0495595_0000484
1843 Ga0495595_0007121
1844 Ga0495595_0009918
1845 Ga0495595_0015954
1846 Ga0495595_0091644
1847 Ga0495595_0139752
1848 Ga0495619_0000998
1849 Ga0495619_0001353
1850 Ga0495619_0010015
1851 Ga0495619_0011323
1852 Ga0495619_0020002
1853 Ga0495619_0067773
1854 Ga0495619_0107640
1855 Ga0495619_0251502
1856 Ga0500643_029927
1857 Ga0500644_0000670
1858 Ga0500651_0031552
1859 Ga0500641_0001812
1860 Ga0500641_0130097
1861 Ga0500641_0232705
1862 Ga0500595_056359
1863 Ga0500568_0032664
1864 Ga0500616_0000002
1865 Ga0500616_0100815
1866 Ga0501084_0035485
1867 Ga0501082_0000196
1868 Ga0501082_0001410
1869 Ga0501082_0014359
1870 Ga0501082_0114241
1871 Ga0501082_0197273
1872 Ga0501082_0230845
1873 Ga0501082_0239964
1874 Ga0501082_0363022
1875 Ga0530510_0208018
1876 Ga0530510_0249613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

73

166

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a6q-assembly1.cif.gz_B e13t mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8012 49 154
1flm-assembly1.cif.gz_B dimer of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8006 49 154
7eg5-assembly1.cif.gz_B fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 0.8003 37 154
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.799 36 154
1wli-assembly1.cif.gz_B l122y mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7979 49 154
ID Description Score Start End Superfamily
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7841 49 154 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7808 36 152 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7682 33 151 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7573 36 152 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7343 36 167 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A537QQE2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9768 1 198
AF-A0A433B166-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9706 7 193
AF-A0A538DHM8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9693 4 193
AF-A0A525IAS1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9685 1 178
AF-A0A4R1BTR8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9683 7 193

Map