F486252

General Info

Members Datasets Scaffolds Average Seq Length
938 524 1876 479

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10042921|Ga0207688_100429212
Length 523
Sequence MLLWFVIIYWIISVGIGLWAAMRVKNTADYAVAGRSLPLYIVTATVFATWFGSETVLGIPATFLREGLGGVIADPFGSSMCLILVGLFFARPLYRMQLLTIGDFYRNKYGRTVETLTTLCIVLSYLGWVAAQISALGLVFHVVSEGAMSQSTGMIVGASTVLIYTMWGGMWAVAITDFLQMIIIVIGMLYIGWDVSQLAGGVTAVVSHAADAGKFATFLPEASLAGILGFTAAAITMMLGSIPQQDVFQRVASSKDERTAGRASILGGCLYFCFAFIPMFLAYSATLIDPQLVQKLIDGDKQSQLILPNMILNHAPLFAQVMFFGALLSAIKSCASATLLAPSVTFTENILRPAFKHLGDQQLLRLMRIVVLCFTVLVTLFALNSQLSIYKMVENAYKVTLVSAFVPLAFGLYWKRANTQGALAAIVLGLATWIWLEILAPTAVCPPQLAGFLAALFGMIAGSLAPLVIRHQPASHAGLMTSSVRIRSASVTVASWSSSFEPKCAYRPLLLMPMAAARLPACV

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
227 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
236 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
261 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
280 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
281 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
282 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
285 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
286 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
287 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
293 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
317 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
318 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
326 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
332 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
343 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
375 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
376 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
377 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
378 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
379 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
380 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
381 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
382 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
383 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
384 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
401 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
402 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
403 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
404 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
405 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
406 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
407 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
408 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
409 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
410 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
411 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
412 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
413 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
414 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
415 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
416 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
417 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
418 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
419 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
420 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
421 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
422 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
423 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
424 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
425 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
426 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
427 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
428 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
429 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
430 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
431 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
434 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
435 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
436 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
437 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
438 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
439 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
440 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
441 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
442 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
443 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
444 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
445 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
446 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
450 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
451 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
454 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
455 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
456 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
457 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
458 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
459 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
460 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
461 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
462 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
463 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
464 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
465 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
466 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
467 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
470 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
471 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
472 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
473 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
474 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
475 2547132512 Azospira oryzae 6a3 Isolate Unclassified
476 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
477 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
478 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
479 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
480 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
481 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
482 2643221556 Massilia sp. Root1485 Isolate Unclassified
483 2643221585 Pelomonas sp. Root662 Isolate Unclassified
484 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
485 2643221656 Pelomonas sp. Root405 Isolate Unclassified
486 2643221684 Massilia sp. Root133 Isolate Unclassified
487 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
488 2738541337 Pelomonas sp. BT06 Isolate Unclassified
489 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
490 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
491 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
492 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
493 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
494 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
495 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
496 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
497 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
498 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
499 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
500 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
501 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
502 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
503 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
504 2885266251 Ralstonia sp. SET104 Isolate Nodule
505 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
506 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
507 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
508 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
509 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
510 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
511 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
512 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
513 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
514 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
515 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
516 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
517 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
518 2928058823 Ralstonia sp. 1138 Isolate Unclassified
519 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
520 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
521 639633007 Azoarcus olearius BH72 Isolate Unclassified
522 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
523 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
524 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0.21
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.28
Nodule 1.17
Rhizoplane 1.6
Rhizosphere 80.6
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10042921 3300025901 Bacteria 2518
2 JGI24741J21665_1000120 3300001915 Bacteria 21131
3 JGI25155J39150_1000205 3300002704 Bacteria 23971
4 JGI25155J39150_1000224 3300002704 Bacteria 22214
5 JGI25155J39150_1000386 3300002704 Bacteria 12552
6 JGI25156J39149_1000357 3300002705 Bacteria 29554
7 JGI25156J39149_1002757 3300002705 Bacteria 6103
8 JGI25156J39149_1003165 3300002705 Bacteria 5528
9 JGI25154J39366_1000298 3300002738 Bacteria 29516
10 JGI25154J39366_1000314 3300002738 Bacteria 28089
11 JGI25154J39366_1001626 3300002738 Bacteria 7580
12 JGI25157J39369_1000262 3300002741 Bacteria 38795
13 JGI25157J39369_1000702 3300002741 Bacteria 18049
14 JGI25151J46595_10002295 3300003187 Bacteria 11698
15 rootH2_10038054 3300003320 Bacteria 8042
16 JGI26145J50221_1000448 3300003371 Bacteria 3576
17 Ga0006562J51391_1127957 3300003578 Bacteria 2566
18 Ga0055538_1000110 3300003751 Bacteria 64583
19 Ga0055539_1000094 3300003752 Bacteria 103196
20 Ga0055539_1000159 3300003752 Bacteria 64583
21 Ga0055533_1000161 3300003756 Bacteria 64583
22 Ga0055532_1000006 3300003758 Bacteria 451244
23 Ga0055532_1000059 3300003758 Bacteria 152948
24 Ga0055525_1000081 3300003759 Bacteria 161329
25 Ga0055525_1000214 3300003759 Bacteria 64583
26 Ga0055525_1000323 3300003759 Bacteria 37297
27 Ga0055527_1003007 3300003760 Bacteria 2632
28 Ga0055535_1000004 3300003761 Bacteria 451244
29 Ga0055542_1000940 3300003762 Bacteria 19156
30 Ga0055529_1000022 3300003763 Bacteria 320108
31 Ga0055526_1000651 3300003771 Bacteria 26844
32 Ga0055526_1003073 3300003771 Bacteria 10849
33 Ga0055526_1004090 3300003771 Bacteria 8916
34 Ga0055526_1006100 3300003771 Bacteria 6656
35 Ga0055537_1001420 3300003773 Bacteria 9394
36 Ga0055524_1000642 3300003775 Bacteria 24850
37 Ga0055524_1006682 3300003775 Bacteria 4983
38 Ga0055536_1000094 3300003781 Bacteria 76734
39 Ga0055536_1000110 3300003781 Bacteria 72378
40 Ga0055534_1000656 3300003784 Bacteria 17498
41 Ga0055534_1001751 3300003784 Bacteria 8196
42 Ga0055531_10000007 3300003794 Bacteria 225289
43 Ga0055541_1000105 3300003841 Bacteria 64583
44 Ga0055541_1000464 3300003841 Bacteria 11612
45 Ga0065704_10077577 3300005289 Bacteria 4689
46 Ga0065712_10096373 3300005290 Bacteria 2185
47 Ga0065707_10082548 3300005295 Bacteria 13907
48 Ga0070676_10008985 3300005328 Bacteria 5405
49 Ga0070683_100015466 3300005329 Bacteria 6704
50 Ga0070690_100001012 3300005330 Bacteria 14375
51 Ga0070690_100012031 3300005330 Bacteria 5079
52 Ga0070670_100000054 3300005331 Bacteria 127396
53 Ga0070670_100007425 3300005331 Bacteria 9309
54 Ga0070670_100024257 3300005331 Bacteria 5217
55 Ga0070677_10001872 3300005333 Bacteria 6654
56 Ga0068869_100124717 3300005334 Unclassified 1974
57 Ga0070666_10008897 3300005335 Bacteria 6245
58 Ga0070666_10015909 3300005335 Bacteria 4806
59 Ga0070682_100039419 3300005337 Bacteria 2903
60 Ga0070682_100078636 3300005337 Bacteria 2128
61 Ga0070682_100096002 3300005337 Bacteria 1948
62 Ga0068868_100045184 3300005338 Bacteria 3445
63 Ga0068868_100086366 3300005338 Bacteria 2522
64 Ga0068868_100160142 3300005338 Bacteria 1858
65 Ga0070660_100003556 3300005339 Bacteria 10762
66 Ga0070660_100004636 3300005339 Bacteria 9517
67 Ga0070660_100100823 3300005339 Bacteria 2287
68 Ga0070689_100000070 3300005340 Bacteria 61448
69 Ga0070689_100040742 3300005340 Bacteria 3562
70 Ga0070689_100042986 3300005340 Bacteria 3471
71 Ga0070691_10000598 3300005341 Bacteria 13822
72 Ga0070687_100013134 3300005343 Bacteria 3680
73 Ga0070661_100000012 3300005344 Bacteria 167998
74 Ga0070661_100005481 3300005344 Bacteria 8749
75 Ga0070668_100005970 3300005347 Bacteria 9034
76 Ga0070669_100000779 3300005353 Bacteria 23159
77 Ga0070669_100002303 3300005353 Bacteria 13840
78 Ga0070675_100013140 3300005354 Bacteria 6506
79 Ga0070671_100000037 3300005355 Bacteria 95248
80 Ga0070671_100053012 3300005355 Unclassified 3372
81 Ga0070674_100001339 3300005356 Bacteria 12993
82 Ga0070674_100006470 3300005356 Bacteria 6837
83 Ga0070673_100000190 3300005364 Bacteria 30180
84 Ga0070673_100001171 3300005364 Bacteria 15046
85 Ga0070673_100153218 3300005364 Bacteria 1954
86 Ga0070688_100000006 3300005365 Bacteria 92017
87 Ga0070659_100001082 3300005366 Bacteria 19884
88 Ga0070659_100001965 3300005366 Bacteria 14678
89 Ga0070659_100006729 3300005366 Bacteria 8311
90 Ga0070659_100053140 3300005366 Bacteria 3188
91 Ga0070667_100000002 3300005367 Bacteria 504831
92 Ga0070667_100121803 3300005367 Unclassified 2269
93 Ga0070701_10000161 3300005438 Bacteria 20802
94 Ga0070700_100000390 3300005441 Bacteria 22595
95 Ga0070700_100053233 3300005441 Bacteria 2525
96 Ga0070694_100029065 3300005444 Unclassified 3604
97 Ga0070694_100075087 3300005444 Bacteria 2338
98 Ga0070663_100000003 3300005455 Bacteria 260492
99 Ga0070663_100014804 3300005455 Bacteria 5014
100 Ga0070678_100075262 3300005456 Bacteria 2539
101 Ga0070662_100000059 3300005457 Bacteria 59672
102 Ga0070662_100018115 3300005457 Bacteria 4760
103 Ga0070662_100091708 3300005457 Bacteria 2282
104 Ga0070681_10032587 3300005458 Bacteria 5231
105 Ga0068867_100000588 3300005459 Bacteria 24065
106 Ga0070685_10000014 3300005466 Bacteria 120530
107 Ga0070685_10000693 3300005466 Bacteria 18235
108 Ga0070706_100035202 3300005467 Bacteria 4624
109 Ga0070707_100000032 3300005468 Bacteria 118776
110 Ga0070707_100082597 3300005468 Bacteria 3103
111 Ga0070707_100193040 3300005468 Bacteria 1986
112 Ga0070698_100097369 3300005471 Unclassified 2918
113 Ga0070699_100005467 3300005518 Bacteria 11135
114 Ga0070699_100049858 3300005518 Bacteria 3623
115 Ga0070684_100149560 3300005535 Unclassified 2115
116 Ga0070697_100035617 3300005536 Bacteria 4016
117 Ga0070697_100055367 3300005536 Bacteria 3225
118 Ga0070672_100000116 3300005543 Bacteria 40577
119 Ga0070672_100000683 3300005543 Bacteria 19990
120 Ga0070672_100173255 3300005543 Bacteria 1795
121 Ga0070686_100000897 3300005544 Bacteria 17311
122 Ga0070686_100002011 3300005544 Bacteria 11273
123 Ga0070695_100027086 3300005545 Bacteria 3548
124 Ga0070695_100077990 3300005545 Bacteria 2183
125 Ga0070696_100000917 3300005546 Bacteria 19177
126 Ga0070696_100002873 3300005546 Bacteria 11454
127 Ga0070665_100079228 3300005548 Bacteria 3291
128 Ga0070665_100252100 3300005548 Bacteria 1766
129 Ga0070704_100025964 3300005549 Bacteria 3863
130 Ga0070704_100131554 3300005549 Unclassified 1940
131 Ga0068855_100002313 3300005563 Bacteria 23555
132 Ga0068855_100296172 3300005563 Unclassified 1792
133 Ga0070664_100000003 3300005564 Bacteria 325604
134 Ga0070664_100002039 3300005564 Bacteria 16186
135 Ga0070664_100018224 3300005564 Bacteria 5762
136 Ga0068857_100004739 3300005577 Bacteria 11524
137 Ga0068857_100130134 3300005577 Bacteria 2270
138 Ga0068854_100000063 3300005578 Bacteria 77198
139 Ga0068854_100014150 3300005578 Bacteria 5253
140 Ga0068854_100028452 3300005578 Bacteria 3862
141 Ga0068856_100000256 3300005614 Bacteria 58184
142 Ga0068856_100150656 3300005614 Bacteria 2335
143 Ga0070702_100047359 3300005615 Bacteria 2442
144 Ga0068852_100002180 3300005616 Bacteria 13425
145 Ga0068852_100022134 3300005616 Bacteria 5092
146 Ga0068859_100046115 3300005617 Bacteria 4378
147 Ga0068859_100187125 3300005617 Bacteria 2154
148 Ga0068864_100000002 3300005618 Bacteria 658857
149 Ga0068866_10019056 3300005718 Bacteria 3116
150 Ga0068861_100050758 3300005719 Bacteria 3146
151 Ga0068861_100057108 3300005719 Unclassified 2981
152 Ga0068851_10056120 3300005834 Bacteria 2008
153 Ga0068858_100001596 3300005842 Bacteria 23124
154 Ga0068858_100003164 3300005842 Bacteria 16479
155 Ga0068858_100026292 3300005842 Bacteria 5410
156 Ga0068858_100084998 3300005842 Bacteria 2943
157 Ga0068860_100000844 3300005843 Bacteria 34309
158 Ga0068860_100014459 3300005843 Bacteria 7728
159 Ga0081455_10000900 3300005937 Bacteria 38337
160 Ga0081539_10042221 3300005985 Bacteria 2658
161 Ga0075363_100034682 3300006048 Bacteria 2635
162 Ga0075364_10051700 3300006051 Bacteria 2684
163 Ga0075432_10000012 3300006058 Bacteria 34480
164 Ga0075366_10008423 3300006195 Bacteria 5733
165 Ga0075366_10020793 3300006195 Bacteria 3809
166 Ga0075366_10036985 3300006195 Bacteria 2880
167 Ga0097621_100021171 3300006237 Bacteria 5024
168 Ga0097621_100021799 3300006237 Bacteria 4964
169 Ga0097621_100041534 3300006237 Bacteria 3702
170 Ga0097621_100173286 3300006237 Bacteria 1861
171 Ga0068871_100012101 3300006358 Bacteria 6350
172 Ga0068871_100019039 3300006358 Bacteria 5234
173 Ga0068871_100075038 3300006358 Bacteria 2791
174 Ga0075428_100051320 3300006844 Bacteria 4523
175 Ga0075430_100002760 3300006846 Bacteria 14668
176 Ga0075430_100005824 3300006846 Bacteria 10398
177 Ga0075431_100004053 3300006847 Bacteria 14278
178 Ga0075431_100021196 3300006847 Bacteria 6641
179 Ga0075431_100090819 3300006847 Bacteria 3152
180 Ga0075431_100092175 3300006847 Bacteria 3127
181 Ga0075433_10006279 3300006852 Bacteria 9383
182 Ga0075429_100028503 3300006880 Bacteria 4848
183 Ga0075429_100041774 3300006880 Bacteria 3993
184 Ga0068865_100003182 3300006881 Bacteria 9837
185 Ga0097620_100046114 3300006931 Bacteria 4378
186 Ga0097620_100187119 3300006931 Bacteria 2154
187 Ga0079104_1002487 3300006946 Bacteria 9833
188 Ga0099826_10000014 3300006948 Bacteria 258520
189 Ga0075435_100022656 3300007076 Bacteria 4847
190 Ga0075435_100054284 3300007076 Bacteria 3233
191 Ga0105244_10036312 3300009036 Bacteria 2582
192 Ga0105244_10063047 3300009036 Bacteria 1862
193 Ga0105240_10002549 3300009093 Bacteria 29203
194 Ga0105240_10006370 3300009093 Bacteria 17381
195 Ga0105240_10052544 3300009093 Bacteria 5121
196 Ga0105240_10067174 3300009093 Bacteria 4445
197 Ga0111539_10000106 3300009094 Bacteria 90149
198 Ga0111539_10006915 3300009094 Bacteria 14568
199 Ga0111539_10013844 3300009094 Bacteria 10084
200 Ga0111539_10125488 3300009094 Bacteria 3007
201 Ga0105245_10016534 3300009098 Bacteria 6437
202 Ga0105245_10067537 3300009098 Bacteria 3238
203 Ga0105247_10042854 3300009101 Bacteria 2772
204 Ga0114129_10003723 3300009147 Bacteria 21500
205 Ga0114129_10016942 3300009147 Bacteria 10375
206 Ga0114129_10020244 3300009147 Bacteria 9469
207 Ga0114129_10041544 3300009147 Bacteria 6479
208 Ga0114129_10081280 3300009147 Bacteria 4504
209 Ga0114129_10395888 3300009147 Bacteria 1821
210 Ga0105243_10001690 3300009148 Bacteria 19014
211 Ga0105243_10029824 3300009148 Bacteria 4197
212 Ga0105243_10034506 3300009148 Bacteria 3917
213 Ga0105243_10083206 3300009148 Bacteria 2618
214 Ga0105241_10021227 3300009174 Bacteria 4798
215 Ga0105242_10000115 3300009176 Bacteria 57986
216 Ga0105242_10000834 3300009176 Bacteria 23976
217 Ga0105242_10033981 3300009176 Bacteria 4087
218 Ga0105242_10156871 3300009176 Bacteria 1989
219 Ga0105248_10004494 3300009177 Bacteria 15438
220 Ga0105248_10020966 3300009177 Bacteria 7244
221 Ga0105248_10042075 3300009177 Bacteria 5124
222 Ga0105237_10014545 3300009545 Bacteria 8222
223 Ga0105237_10040376 3300009545 Bacteria 4706
224 Ga0105238_10000258 3300009551 Bacteria 59300
225 Ga0105238_10000537 3300009551 Bacteria 39712
226 Ga0105249_10107901 3300009553 Bacteria 2628
227 Ga0105239_10003482 3300010375 Bacteria 19261
228 Ga0105239_10012398 3300010375 Bacteria 9492
229 Ga0105246_10000428 3300011119 Bacteria 22446
230 Ga0157373_10037002 3300013100 Bacteria 3501
231 Ga0157373_10042627 3300013100 Bacteria 3243
232 Ga0157371_10000755 3300013102 Bacteria 37443
233 Ga0157370_10000921 3300013104 Bacteria 37306
234 Ga0157369_10026862 3300013105 Bacteria 6384
235 Ga0157369_10111531 3300013105 Bacteria 2907
236 Ga0157374_10003255 3300013296 Bacteria 13642
237 Ga0157374_10005053 3300013296 Bacteria 11065
238 Ga0157374_10110758 3300013296 Bacteria 2640
239 Ga0157374_10201938 3300013296 Bacteria 1947
240 Ga0157378_10005614 3300013297 Bacteria 10990
241 Ga0157378_10056594 3300013297 Bacteria 3495
242 Ga0163162_10013512 3300013306 Bacteria 7972
243 Ga0157372_10002524 3300013307 Bacteria 19852
244 Ga0157375_10072169 3300013308 Bacteria 3468
245 Ga0157375_10096306 3300013308 Bacteria 3032
246 Ga0163163_10004619 3300014325 Bacteria 11758
247 Ga0157380_10003948 3300014326 Bacteria 10238
248 Ga0157380_10033827 3300014326 Unclassified 3938
249 Ga0157380_10090109 3300014326 Bacteria 2529
250 Ga0182008_10013237 3300014497 Bacteria 4337
251 Ga0157377_10055886 3300014745 Bacteria 2240
252 Ga0157376_10005228 3300014969 Bacteria 9063
253 Ga0157376_10024880 3300014969 Bacteria 4708
254 Ga0182006_1002915 3300015261 Bacteria 9073
255 Ga0182007_10009681 3300015262 Bacteria 3865
256 Ga0154015_1057316 3300020610 Bacteria 23087
257 Ga0213872_10000093 3300021361 Bacteria 83513
258 Ga0213872_10002967 3300021361 Bacteria 9599
259 Ga0213872_10003726 3300021361 Bacteria 8334
260 Ga0213872_10027058 3300021361 Bacteria 2633
261 Ga0209435_100032 3300025206 Bacteria 153068
262 Ga0209435_100146 3300025206 Bacteria 23627
263 Ga0209784_100035 3300025224 Bacteria 299760
264 Ga0209784_100223 3300025224 Bacteria 38244
265 Ga0209784_100389 3300025224 Bacteria 20132
266 Ga0209566_100002 3300025225 Bacteria 2614868
267 Ga0209566_100040 3300025225 Bacteria 299760
268 Ga0209566_100597 3300025225 Bacteria 22638
269 Ga0209566_102325 3300025225 Bacteria 3632
270 Ga0209674_100010 3300025226 Bacteria 1038638
271 Ga0209674_100050 3300025226 Bacteria 341738
272 Ga0209674_100057 3300025226 Bacteria 299760
273 Ga0209674_100262 3300025226 Bacteria 42282
274 Ga0209672_100111 3300025228 Bacteria 94440
275 Ga0209147_100015 3300025229 Bacteria 565073
276 Ga0209147_100109 3300025229 Bacteria 153068
277 Ga0209563_100004 3300025230 Bacteria 1814108
278 Ga0209563_100015 3300025230 Bacteria 879901
279 Ga0209563_100026 3300025230 Bacteria 559453
280 Ga0209563_100059 3300025230 Bacteria 299760
281 Ga0209437_100512 3300025233 Bacteria 27460
282 Ga0209258_100021 3300025242 Bacteria 565073
283 Ga0209258_100190 3300025242 Bacteria 126878
284 Ga0209646_1000055 3300025246 Bacteria 271793
285 Ga0209646_1000113 3300025246 Bacteria 153068
286 Ga0209646_1000327 3300025246 Bacteria 36378
287 Ga0209026_1000102 3300025250 Bacteria 153068
288 Ga0209026_1003686 3300025250 Bacteria 4903
289 Ga0209677_100007 3300025253 Bacteria 1021332
290 Ga0209677_100036 3300025253 Bacteria 299760
291 Ga0209677_102096 3300025253 Bacteria 7876
292 Ga0209677_104484 3300025253 Bacteria 4003
293 Ga0209148_1000109 3300025254 Bacteria 204266
294 Ga0209759_1000104 3300025256 Bacteria 153068
295 Ga0209759_1001940 3300025256 Bacteria 10056
296 Ga0209759_1001952 3300025256 Bacteria 9947
297 Ga0209565_1000045 3300025263 Bacteria 226864
298 Ga0209565_1010345 3300025263 Bacteria 2315
299 Ga0209455_1000028 3300025272 Bacteria 565073
300 Ga0209455_1005292 3300025272 Bacteria 4021
301 Ga0209675_1000661 3300025291 Bacteria 24235
302 Ga0209676_1000064 3300025292 Bacteria 321700
303 Ga0209025_1000371 3300025294 Bacteria 94612
304 Ga0209025_1001907 3300025294 Bacteria 24289
305 Ga0209025_1004682 3300025294 Bacteria 11678
306 Ga0209025_1008213 3300025294 Bacteria 7550
307 Ga0209564_1001969 3300025295 Bacteria 18087
308 Ga0209564_1003010 3300025295 Bacteria 12070
309 Ga0209564_1003370 3300025295 Bacteria 11056
310 Ga0209758_1016413 3300025297 Bacteria 3763
311 Ga0209050_1010447 3300025298 Bacteria 4576
312 Ga0209256_1000287 3300025299 Bacteria 88526
313 Ga0209256_1000835 3300025299 Bacteria 38753
314 Ga0209051_1016564 3300025303 Bacteria 3328
315 Ga0209051_1020107 3300025303 Bacteria 2889
316 Ga0209257_1000021 3300025304 Bacteria 771986
317 Ga0207656_10002178 3300025321 Bacteria 6554
318 Ga0207682_10002916 3300025893 Bacteria 7543
319 Ga0207642_10011312 3300025899 Bacteria 3178
320 Ga0207642_10038230 3300025899 Bacteria 2075
321 Ga0207710_10029853 3300025900 Bacteria 2376
322 Ga0207688_10007275 3300025901 Bacteria 6025
323 Ga0207680_10008088 3300025903 Bacteria 5153
324 Ga0207680_10017073 3300025903 Bacteria 3826
325 Ga0207680_10021987 3300025903 Bacteria 3462
326 Ga0207645_10000009 3300025907 Bacteria 142449
327 Ga0207645_10009334 3300025907 Bacteria 6790
328 Ga0207645_10016845 3300025907 Bacteria 4831
329 Ga0207643_10018377 3300025908 Bacteria 3829
330 Ga0207684_10041172 3300025910 Bacteria 3918
331 Ga0207707_10106442 3300025912 Bacteria 2452
332 Ga0207695_10001571 3300025913 Bacteria 37209
333 Ga0207695_10003997 3300025913 Bacteria 20338
334 Ga0207695_10021978 3300025913 Bacteria 7260
335 Ga0207695_10241708 3300025913 Bacteria 1706
336 Ga0207671_10006562 3300025914 Bacteria 10334
337 Ga0207660_10005324 3300025917 Bacteria 8361
338 Ga0207660_10032198 3300025917 Bacteria 3618
339 Ga0207662_10015073 3300025918 Bacteria 4344
340 Ga0207662_10020619 3300025918 Bacteria 3761
341 Ga0207657_10005067 3300025919 Bacteria 13820
342 Ga0207657_10102751 3300025919 Unclassified 2370
343 Ga0207649_10000408 3300025920 Bacteria 31917
344 Ga0207649_10009607 3300025920 Bacteria 5296
345 Ga0207649_10013648 3300025920 Bacteria 4540
346 Ga0207646_10000032 3300025922 Bacteria 216397
347 Ga0207646_10063723 3300025922 Bacteria 3290
348 Ga0207646_10081509 3300025922 Bacteria 2893
349 Ga0207681_10001771 3300025923 Bacteria 13871
350 Ga0207681_10001840 3300025923 Bacteria 13592
351 Ga0207694_10000384 3300025924 Bacteria 41184
352 Ga0207650_10000002 3300025925 Bacteria 1439222
353 Ga0207650_10001415 3300025925 Bacteria 17295
354 Ga0207650_10011570 3300025925 Bacteria 6076
355 Ga0207650_10026204 3300025925 Bacteria 4156
356 Ga0207650_10034544 3300025925 Bacteria 3667
357 Ga0207659_10001981 3300025926 Bacteria 12117
358 Ga0207659_10002634 3300025926 Bacteria 10689
359 Ga0207687_10063307 3300025927 Bacteria 2618
360 Ga0207644_10000114 3300025931 Bacteria 59996
361 Ga0207644_10054530 3300025931 Bacteria 2880
362 Ga0207690_10001518 3300025932 Bacteria 14519
363 Ga0207690_10006028 3300025932 Bacteria 7184
364 Ga0207706_10000134 3300025933 Bacteria 80573
365 Ga0207706_10024959 3300025933 Bacteria 5359
366 Ga0207706_10026965 3300025933 Bacteria 5140
367 Ga0207706_10052507 3300025933 Bacteria 3599
368 Ga0207706_10067903 3300025933 Bacteria 3138
369 Ga0207686_10006468 3300025934 Bacteria 6307
370 Ga0207686_10033668 3300025934 Bacteria 3060
371 Ga0207709_10028889 3300025935 Bacteria 3210
372 Ga0207709_10095548 3300025935 Bacteria 1953
373 Ga0207709_10123125 3300025935 Bacteria 1754
374 Ga0207670_10000160 3300025936 Bacteria 44356
375 Ga0207670_10011882 3300025936 Bacteria 5071
376 Ga0207670_10019416 3300025936 Bacteria 4152
377 Ga0207669_10042504 3300025937 Bacteria 2653
378 Ga0207704_10009221 3300025938 Bacteria 4750
379 Ga0207665_10095622 3300025939 Bacteria 2065
380 Ga0207691_10000015 3300025940 Bacteria 142014
381 Ga0207691_10000066 3300025940 Bacteria 84662
382 Ga0207691_10047442 3300025940 Bacteria 3941
383 Ga0207691_10151284 3300025940 Bacteria 2040
384 Ga0207711_10005430 3300025941 Bacteria 10780
385 Ga0207711_10192370 3300025941 Bacteria 1860
386 Ga0207689_10004460 3300025942 Bacteria 12692
387 Ga0207661_10085137 3300025944 Unclassified 2620
388 Ga0207679_10000007 3300025945 Bacteria 460140
389 Ga0207679_10000931 3300025945 Bacteria 18690
390 Ga0207679_10010190 3300025945 Bacteria 6047
391 Ga0207679_10015279 3300025945 Bacteria 5067
392 Ga0207679_10037901 3300025945 Bacteria 3431
393 Ga0207667_10002083 3300025949 Bacteria 25061
394 Ga0207667_10023865 3300025949 Bacteria 6730
395 Ga0207651_10000209 3300025960 Bacteria 25205
396 Ga0207651_10013780 3300025960 Bacteria 4641
397 Ga0207712_10118138 3300025961 Bacteria 2001
398 Ga0207668_10067417 3300025972 Bacteria 2541
399 Ga0207640_10000132 3300025981 Bacteria 55549
400 Ga0207640_10029086 3300025981 Bacteria 3387
401 Ga0207640_10062780 3300025981 Bacteria 2466
402 Ga0207658_10000001 3300025986 Bacteria 1439333
403 Ga0207658_10017783 3300025986 Bacteria 4898
404 Ga0207677_10027785 3300026023 Bacteria 3569
405 Ga0207703_10007101 3300026035 Bacteria 8909
406 Ga0207703_10036652 3300026035 Bacteria 3904
407 Ga0207678_10000011 3300026067 Bacteria 147685
408 Ga0207678_10004674 3300026067 Bacteria 12296
409 Ga0207678_10059322 3300026067 Bacteria 3292
410 Ga0207678_10135373 3300026067 Bacteria 2102
411 Ga0207708_10000336 3300026075 Bacteria 36973
412 Ga0207708_10001429 3300026075 Bacteria 17906
413 Ga0207708_10015389 3300026075 Bacteria 5738
414 Ga0207708_10063040 3300026075 Bacteria 2832
415 Ga0207708_10071162 3300026075 Bacteria 2664
416 Ga0207702_10000018 3300026078 Bacteria 212617
417 Ga0207702_10116246 3300026078 Bacteria 2387
418 Ga0207641_10010053 3300026088 Bacteria 7781
419 Ga0207641_10010055 3300026088 Bacteria 7779
420 Ga0207648_10000049 3300026089 Bacteria 108876
421 Ga0207648_10003565 3300026089 Bacteria 16280
422 Ga0207648_10007583 3300026089 Bacteria 10641
423 Ga0207676_10000001 3300026095 Bacteria 1439222
424 Ga0207676_10008539 3300026095 Bacteria 7281
425 Ga0207674_10001844 3300026116 Bacteria 27005
426 Ga0207674_10031517 3300026116 Bacteria 5569
427 Ga0207674_10037920 3300026116 Bacteria 5007
428 Ga0207674_10086447 3300026116 Bacteria 3130
429 Ga0207674_10095295 3300026116 Bacteria 2962
430 Ga0207674_10148254 3300026116 Bacteria 2304
431 Ga0207683_10000023 3300026121 Bacteria 114463
432 Ga0207683_10000501 3300026121 Bacteria 36209
433 Ga0207698_10000462 3300026142 Bacteria 23583
434 Ga0207698_10000553 3300026142 Bacteria 21782
435 Ga0207698_10081542 3300026142 Bacteria 2612
436 Ga0207698_10110019 3300026142 Bacteria 2307
437 Ga0209281_1003184 3300027111 Bacteria 5643
438 Ga0209969_1000683 3300027360 Bacteria 4544
439 Ga0209969_1001115 3300027360 Bacteria 3682
440 Ga0209967_1000047 3300027364 Bacteria 15443
441 Ga0209981_1000336 3300027378 Bacteria 6067
442 Ga0209996_1000225 3300027395 Bacteria 7304
443 Ga0209984_1000396 3300027424 Bacteria 4750
444 Ga0210000_1000180 3300027462 Bacteria 9138
445 Ga0209995_1000150 3300027471 Bacteria 11181
446 Ga0209968_1000036 3300027526 Bacteria 24144
447 Ga0209970_1000719 3300027614 Bacteria 5745
448 Ga0209282_1000048 3300027666 Bacteria 111312
449 Ga0209971_1000062 3300027682 Bacteria 34062
450 Ga0209966_1000210 3300027695 Bacteria 23707
451 Ga0209998_10000030 3300027717 Bacteria 60299
452 Ga0209974_10000386 3300027876 Bacteria 14621
453 Ga0209974_10000506 3300027876 Bacteria 13008
454 Ga0207428_10001516 3300027907 Bacteria 24234
455 Ga0207428_10006322 3300027907 Bacteria 10951
456 Ga0207428_10007796 3300027907 Bacteria 9747
457 Ga0268266_10023623 3300028379 Bacteria 5233
458 Ga0268266_10056565 3300028379 Bacteria 3374
459 Ga0268266_10085640 3300028379 Bacteria 2754
460 Ga0268265_10009824 3300028380 Bacteria 6458
461 Ga0268264_10000004 3300028381 Bacteria 1116842
462 Ga0265318_10001430 3300028577 Bacteria 14112
463 Ga0265336_10000511 3300028666 Bacteria 22483
464 Ga0307515_10009616 3300028794 Bacteria 18663
465 Ga0265338_10093773 3300028800 Bacteria 2472
466 Ga0265324_10000011 3300029957 Bacteria 218521
467 Ga0265324_10000340 3300029957 Bacteria 34285
468 Ga0265324_10024393 3300029957 Bacteria 2147
469 Ga0307511_10000022 3300030521 Bacteria 116875
470 Ga0265328_10000447 3300031239 Bacteria 19190
471 Ga0265328_10002460 3300031239 Bacteria 8309
472 Ga0265328_10005254 3300031239 Bacteria 5562
473 Ga0265328_10006977 3300031239 Bacteria 4740
474 Ga0265325_10000125 3300031241 Bacteria 52592
475 Ga0265325_10007301 3300031241 Bacteria 6632
476 Ga0265329_10004482 3300031242 Bacteria 5795
477 Ga0265331_10000070 3300031250 Bacteria 152331
478 Ga0265331_10003188 3300031250 Bacteria 10707
479 Ga0265331_10022219 3300031250 Bacteria 3238
480 Ga0265327_10000068 3300031251 Bacteria 219962
481 Ga0265327_10000156 3300031251 Bacteria 146362
482 Ga0265327_10000205 3300031251 Bacteria 123596
483 Ga0265327_10000706 3300031251 Bacteria 52819
484 Ga0265327_10000719 3300031251 Bacteria 52024
485 Ga0265327_10001333 3300031251 Bacteria 31995
486 Ga0265327_10003120 3300031251 Bacteria 16304
487 Ga0265327_10003549 3300031251 Bacteria 14790
488 Ga0265327_10006214 3300031251 Bacteria 9629
489 Ga0265327_10006520 3300031251 Bacteria 9293
490 Ga0265327_10008435 3300031251 Bacteria 7671
491 Ga0265327_10020927 3300031251 Bacteria 3966
492 Ga0265327_10044401 3300031251 Bacteria 2370
493 Ga0265327_10073494 3300031251 Bacteria 1705
494 Ga0265316_10000005 3300031344 Bacteria 304442
495 Ga0265316_10059298 3300031344 Bacteria 2977
496 Ga0307408_100000023 3300031548 Bacteria 295931
497 Ga0307408_100023759 3300031548 Bacteria 4179
498 Ga0316575_10005752 3300031665 Bacteria 4428
499 Ga0316579_10000015 3300031691 Bacteria 39681
500 Ga0265314_10000134 3300031711 Bacteria 111395
501 Ga0265314_10007756 3300031711 Bacteria 9281
502 Ga0265314_10020023 3300031711 Bacteria 5172
503 Ga0307516_10002741 3300031730 Bacteria 23228
504 Ga0307405_10018136 3300031731 Bacteria 3877
505 Ga0307413_10002623 3300031824 Bacteria 7356
506 Ga0307407_10030521 3300031903 Bacteria 2909
507 Ga0307412_10030943 3300031911 Bacteria 3375
508 Ga0307412_10057247 3300031911 Bacteria 2601
509 Ga0307416_100006355 3300032002 Bacteria 7388
510 Ga0307416_100050238 3300032002 Bacteria 3323
511 Ga0307416_100126947 3300032002 Bacteria 2286
512 Ga0307411_10090392 3300032005 Bacteria 2135
513 Ga0307415_100000756 3300032126 Bacteria 14568
514 Ga0316583_10000483 3300032133 Bacteria 11841
515 Ga0316583_10004823 3300032133 Bacteria 4817
516 Ga0307507_10047428 3300033179 Bacteria 4196
517 Ga0373952_0000324 3300035092 Bacteria 8028
518 Ga0373923_0094106 3300035111 Bacteria 1314
519 Ga0373956_0036076 3300035119 Bacteria 2182
520 Ga0373957_0045731 3300035120 Bacteria 1660
521 Ga0373960_0019946 3300035121 Bacteria 1767
522 Ga0373955_0013547 3300035172 Bacteria 3947
523 Ga0373955_0078224 3300035172 Bacteria 1864
524 Ga0373924_0007992 3300035410 Bacteria 3829
525 Ga0373935_0086873 3300035692 Bacteria 2041
526 Ga0373933_0002452 3300035724 Bacteria 10435
527 Ga0373937_0028631 3300036401 Bacteria 5043
528 Ga0373937_0045752 3300036401 Bacteria 4000
529 Ga0316582_0003674 3300036647 Bacteria 7582
530 Ga0373925_0114893 3300037068 Bacteria 2083
531 Ga0395899_0002272 3300037312 Bacteria 15706
532 Ga0395899_0023327 3300037312 Bacteria 4688
533 Ga0395899_0024592 3300037312 Bacteria 4552
534 Ga0395899_0042010 3300037312 Bacteria 3414
535 Ga0395899_0097786 3300037312 Bacteria 2121
536 Ga0395899_0108211 3300037312 Bacteria 2000
537 Ga0395900_0001906 3300037418 Bacteria 23725
538 Ga0395900_0004368 3300037418 Bacteria 14997
539 Ga0395900_0040940 3300037418 Bacteria 4776
540 Ga0395900_0058716 3300037418 Bacteria 3960
541 Ga0395900_0167746 3300037418 Bacteria 2236
542 Ga0395905_0000043 3300037471 Bacteria 247469
543 Ga0395905_0000242 3300037471 Bacteria 82835
544 Ga0395905_0008311 3300037471 Bacteria 10241
545 Ga0395905_0014548 3300037471 Bacteria 7507
546 Ga0395905_0016517 3300037471 Bacteria 7016
547 Ga0395905_0056374 3300037471 Bacteria 3676
548 Ga0395905_0087784 3300037471 Bacteria 2915
549 Ga0395905_0242384 3300037471 Bacteria 1684
550 Ga0395901_0000307 3300038443 Bacteria 60012
551 Ga0395901_0002559 3300038443 Bacteria 18423
552 Ga0395901_0005833 3300038443 Bacteria 12465
553 Ga0395901_0060610 3300038443 Bacteria 3937
554 Ga0395901_0077433 3300038443 Bacteria 3471
555 Ga0395901_0169831 3300038443 Bacteria 2288
556 Ga0400490_21110 3300038726 Bacteria 5837
557 Ga0436361_0100960 3300039447 Bacteria 8932
558 Ga0436361_0257895 3300039447 Bacteria 4702
559 Ga0436361_0545153 3300039447 Bacteria 4298
560 Ga0436361_0773293 3300039447 Bacteria 38992
561 Ga0436361_1049300 3300039447 Bacteria 3677
562 Ga0439436_0024218 3300041404 Bacteria 1793
563 Ga0439438_010003 3300041405 Bacteria 3033
564 Ga0450911_004719 3300042115 Bacteria 2200
565 Ga0450888_000035 3300042126 Bacteria 9574
566 Ga0450890_000572 3300042127 Bacteria 5368
567 Ga0450891_000065 3300042129 Bacteria 8426
568 Ga0450889_000145 3300042144 Bacteria 7163
569 Ga0439458_0003049 3300042157 Bacteria 3994
570 Ga0450909_002848 3300042185 Bacteria 2458
571 Ga0450893_0001962 3300042532 Bacteria 3197
572 Ga0451577_0000085 3300042876 Bacteria 211141
573 Ga0451577_0008429 3300042876 Bacteria 10034
574 Ga0451577_0008841 3300042876 Bacteria 9752
575 Ga0451577_0018842 3300042876 Bacteria 6353
576 Ga0451577_0019578 3300042876 Bacteria 6221
577 Ga0466969_0019979 3300044656 Bacteria 3472
578 Ga0466969_0039336 3300044656 Bacteria 2375
579 Ga0466972_0000359 3300044658 Bacteria 24761
580 Ga0466972_0017061 3300044658 Bacteria 3632
581 Ga0466977_0013105 3300044666 Bacteria 4867
582 Ga0453683_0000047 3300044673 Bacteria 207763
583 Ga0453683_0006123 3300044673 Bacteria 8290
584 Ga0466966_0015691 3300044684 Bacteria 5008
585 Ga0466966_0018170 3300044684 Bacteria 4639
586 Ga0466966_0026512 3300044684 Bacteria 3783
587 Ga0466966_0036339 3300044684 Bacteria 3180
588 Ga0466961_0001701 3300044693 Bacteria 13704
589 Ga0466961_0019077 3300044693 Bacteria 4412
590 Ga0466961_0020792 3300044693 Bacteria 4224
591 Ga0466964_0000097 3300044706 Bacteria 21037
592 Ga0466964_0011111 3300044706 Bacteria 3400
593 Ga0453684_0000273 3300044712 Bacteria 222658
594 Ga0453684_0000276 3300044712 Bacteria 222326
595 Ga0453684_0000302 3300044712 Bacteria 207763
596 Ga0453684_0004162 3300044712 Bacteria 31248
597 Ga0453684_0034104 3300044712 Bacteria 7074
598 Ga0453684_0036639 3300044712 Bacteria 6755
599 Ga0453684_0038837 3300044712 Bacteria 6496
600 Ga0466968_0000838 3300044735 Bacteria 10735
601 Ga0466968_0045031 3300044735 Bacteria 1871
602 Ga0466970_0002355 3300044765 Bacteria 9130
603 Ga0466957_0001772 3300044842 Bacteria 11366
604 Ga0466957_0006017 3300044842 Bacteria 6844
605 Ga0466957_0047230 3300044842 Bacteria 2615
606 Ga0466957_0098808 3300044842 Bacteria 1837
607 Ga0466959_0016980 3300045049 Bacteria 5327
608 Ga0466959_0038347 3300045049 Bacteria 3540
609 Ga0451576_0000003 3300045051 Bacteria 1550573
610 Ga0451576_0000006 3300045051 Bacteria 949698
611 Ga0451576_0000096 3300045051 Bacteria 221078
612 Ga0451576_0000116 3300045051 Bacteria 207763
613 Ga0451576_0000147 3300045051 Bacteria 179223
614 Ga0451576_0001472 3300045051 Bacteria 39908
615 Ga0451576_0002503 3300045051 Bacteria 27266
616 Ga0451576_0002526 3300045051 Bacteria 27094
617 Ga0451576_0004790 3300045051 Bacteria 17343
618 Ga0451576_0008254 3300045051 Bacteria 12246
619 Ga0451576_0019294 3300045051 Bacteria 7444
620 Ga0451576_0019765 3300045051 Bacteria 7350
621 Ga0451576_0021263 3300045051 Bacteria 7054
622 Ga0451576_0025801 3300045051 Bacteria 6330
623 Ga0451576_0071239 3300045051 Bacteria 3617
624 Ga0451576_0103230 3300045051 Bacteria 2966
625 Ga0451576_0204093 3300045051 Bacteria 2064
626 Ga0451576_0237968 3300045051 Unclassified 1901
627 Ga0466958_0052313 3300045836 Bacteria 2475
628 Ga0466967_0005183 3300045976 Bacteria 8975
629 Ga0466967_0011484 3300045976 Bacteria 6712
630 Ga0466967_0057073 3300045976 Bacteria 3445
631 Ga0495617_000125 3300046452 Bacteria 50630
632 Ga0495592_0020784 3300046454 Bacteria 4994
633 Ga0495590_0002849 3300046457 Bacteria 7124
634 Ga0495651_0084410 3300046462 Bacteria 2393
635 Ga0495653_0041728 3300046463 Bacteria 3579
636 Ga0495653_0116134 3300046463 Bacteria 1914
637 Ga0495580_0036217 3300046472 Bacteria 3543
638 Ga0495582_0000662 3300046473 Bacteria 18974
639 Ga0495605_0000725 3300046474 Bacteria 24295
640 Ga0495605_0000845 3300046474 Bacteria 21424
641 Ga0495584_0000417 3300046491 Bacteria 29344
642 Ga0495584_0032982 3300046491 Bacteria 2619
643 Ga0495585_0003922 3300046492 Bacteria 9850
644 Ga0495585_0004000 3300046492 Bacteria 9711
645 Ga0495585_0020428 3300046492 Bacteria 3809
646 Ga0495594_0006120 3300046499 Bacteria 6188
647 Ga0495594_0038603 3300046499 Bacteria 2608
648 Ga0495594_0060699 3300046499 Bacteria 2091
649 Ga0495596_0001761 3300046500 Bacteria 12120
650 Ga0495596_0004535 3300046500 Bacteria 6748
651 Ga0495596_0005727 3300046500 Bacteria 5832
652 Ga0495607_0000004 3300046501 Bacteria 317271
653 Ga0495607_0001408 3300046501 Bacteria 21405
654 Ga0495607_0003124 3300046501 Bacteria 12858
655 Ga0495607_0036047 3300046501 Bacteria 2985
656 Ga0495583_0000222 3300046506 Bacteria 95964
657 Ga0495583_0006001 3300046506 Bacteria 8055
658 Ga0495606_0018114 3300046507 Bacteria 5294
659 Ga0495606_0019130 3300046507 Bacteria 5106
660 Ga0495608_0023686 3300046511 Bacteria 4205
661 Ga0495631_0001168 3300046518 Bacteria 16231
662 Ga0495643_0002098 3300046522 Bacteria 16504
663 Ga0495643_0002952 3300046522 Bacteria 12877
664 Ga0495644_0019602 3300046523 Bacteria 2582
665 Ga0495644_0022177 3300046523 Bacteria 2420
666 Ga0495648_0000612 3300046524 Bacteria 38167
667 Ga0495648_0002837 3300046524 Bacteria 15598
668 Ga0495666_0000791 3300046526 Bacteria 14659
669 Ga0495666_0006131 3300046526 Bacteria 6047
670 Ga0495642_0000515 3300046528 Bacteria 19938
671 Ga0495642_0013263 3300046528 Bacteria 3185
672 Ga0495652_0064084 3300046529 Bacteria 3092
673 Ga0495665_0003210 3300046531 Bacteria 8842
674 Ga0495586_0028232 3300046535 Bacteria 3003
675 Ga0495587_0062895 3300046536 Bacteria 2172
676 Ga0495587_0072105 3300046536 Bacteria 2008
677 Ga0495587_0087071 3300046536 Bacteria 1807
678 Ga0495622_0010883 3300046557 Bacteria 4196
679 Ga0495633_0006611 3300046558 Bacteria 6844
680 Ga0495667_0091051 3300046559 Bacteria 1976
681 Ga0495656_0004470 3300046615 Bacteria 4793
682 Ga0495634_0106344 3300046642 Bacteria 1808
683 Ga0495611_0002853 3300046648 Bacteria 7726
684 Ga0495661_0000805 3300046665 Bacteria 29621
685 Ga0495661_0004703 3300046665 Bacteria 9801
686 Ga0495661_0005396 3300046665 Bacteria 9088
687 Ga0495661_0007618 3300046665 Bacteria 7543
688 Ga0495661_0053002 3300046665 Bacteria 2441
689 Ga0495588_0002016 3300046674 Bacteria 8685
690 Ga0495588_0013718 3300046674 Bacteria 3864
691 Ga0495657_0060037 3300046675 Bacteria 2521
692 Ga0495623_0018146 3300046679 Bacteria 4543
693 Ga0495670_0005460 3300046691 Bacteria 6240
694 Ga0495670_0019346 3300046691 Bacteria 3354
695 Ga0495649_0020690 3300046694 Bacteria 3688
696 Ga0495589_0000309 3300046794 Bacteria 38979
697 Ga0495589_0001297 3300046794 Bacteria 14743
698 Ga0495600_0021920 3300046809 Bacteria 4097
699 Ga0495660_0000734 3300046810 Bacteria 24893
700 Ga0495581_0001061 3300047315 Bacteria 14904
701 Ga0495581_0005818 3300047315 Bacteria 7149
702 Ga0495604_0040469 3300047317 Bacteria 3659
703 Ga0495636_0023321 3300047318 Bacteria 2504
704 Ga0495672_0000865 3300047320 Bacteria 31951
705 Ga0495680_0061285 3300047322 Bacteria 2895
706 Ga0495687_000656 3300047443 Bacteria 39649
707 Ga0495687_000829 3300047443 Bacteria 33057
708 Ga0495687_000866 3300047443 Bacteria 32045
709 Ga0495687_007801 3300047443 Bacteria 6230
710 Ga0495677_0003090 3300047445 Bacteria 6481
711 Ga0495677_0004391 3300047445 Bacteria 5421
712 Ga0495677_0007440 3300047445 Bacteria 4093
713 Ga0495681_0000511 3300047470 Bacteria 29544
714 Ga0495681_0003757 3300047470 Bacteria 10528
715 Ga0495686_0000285 3300047472 Bacteria 88880
716 Ga0495686_0002310 3300047472 Bacteria 18237
717 Ga0495602_0001988 3300048088 Bacteria 20511
718 Ga0495614_0008722 3300048089 Bacteria 4505
719 Ga0495626_0000292 3300048091 Bacteria 53923
720 Ga0495626_0000613 3300048091 Bacteria 34843
721 Ga0496100_0074995 3300048903 Bacteria 2267
722 Ga0496102_0000544 3300048905 Bacteria 40620
723 Ga0496103_0006831 3300048906 Bacteria 6810
724 Ga0496104_0019038 3300048907 Bacteria 6272
725 Ga0496104_0085381 3300048907 Bacteria 3013
726 Ga0496105_0152772 3300048908 Bacteria 1897
727 Ga0496109_0006786 3300048912 Bacteria 9645
728 Ga0496109_0057917 3300048912 Bacteria 3539
729 Ga0496109_0113160 3300048912 Bacteria 2524
730 Ga0496110_0047848 3300048913 Bacteria 3747
731 Ga0496110_0070412 3300048913 Bacteria 3099
732 Ga0496111_0004898 3300048914 Bacteria 8505
733 Ga0496112_0069132 3300048915 Bacteria 3489
734 Ga0496113_0009852 3300048916 Bacteria 6291
735 Ga0496116_0007586 3300048919 Bacteria 9588
736 Ga0496116_0030764 3300048919 Bacteria 3852
737 Ga0496121_0044676 3300048924 Bacteria 3817
738 Ga0496121_0099040 3300048924 Bacteria 2254
739 Ga0496121_0123323 3300048924 Bacteria 1953
740 Ga0496122_0001645 3300048925 Bacteria 34677
741 Ga0496122_0006420 3300048925 Bacteria 13505
742 Ga0496123_0002540 3300048926 Bacteria 22349
743 Ga0496123_0005186 3300048926 Bacteria 13249
744 Ga0496125_0001339 3300048928 Bacteria 36299
745 Ga0496125_0083060 3300048928 Bacteria 2438
746 Ga0495678_007426 3300049459 Bacteria 5680
747 Ga0501290_000202 3300049513 Bacteria 9807
748 Ga0501291_000129 3300049514 Bacteria 9241
749 Ga0501292_000544 3300049515 Bacteria 4667
750 Ga0501294_000270 3300049517 Bacteria 6383
751 Ga0501296_000163 3300049519 Bacteria 7078
752 Ga0501297_000961 3300049520 Bacteria 2607
753 Ga0501298_000125 3300049521 Bacteria 9223
754 Ga0501299_000033 3300049522 Bacteria 16414
755 Ga0501300_000111 3300049523 Bacteria 11859
756 Ga0501300_005855 3300049523 Bacteria 1809
757 Ga0501301_000402 3300049524 Bacteria 2576
758 Ga0501303_000044 3300049526 Bacteria 9779
759 Ga0501031_0009138 3300049568 Bacteria 6445
760 Ga0501031_0045375 3300049568 Bacteria 2868
761 Ga0501032_0100497 3300049569 Unclassified 1916
762 Ga0501034_0008163 3300049571 Bacteria 11100
763 Ga0501034_0050002 3300049571 Bacteria 4217
764 Ga0501034_0105734 3300049571 Bacteria 2807
765 Ga0501036_0019186 3300049572 Bacteria 5737
766 Ga0501037_0020623 3300049573 Bacteria 4866
767 Ga0501037_0061841 3300049573 Unclassified 2731
768 Ga0501038_0000129 3300049574 Bacteria 64365
769 Ga0501038_0084344 3300049574 Unclassified 2673
770 Ga0501039_0005040 3300049575 Bacteria 10015
771 Ga0501039_0036031 3300049575 Bacteria 3817
772 Ga0501039_0052723 3300049575 Bacteria 3146
773 Ga0501039_0056686 3300049575 Bacteria 3035
774 Ga0501039_0075842 3300049575 Bacteria 2614
775 Ga0501039_0141383 3300049575 Unclassified 1890
776 Ga0501041_0018228 3300049577 Unclassified 4181
777 Ga0501041_0032501 3300049577 Bacteria 3153
778 Ga0501042_0045024 3300049578 Bacteria 3144
779 Ga0501042_0053358 3300049578 Unclassified 2884
780 Ga0501043_0069412 3300049579 Bacteria 2768
781 Ga0501043_0224578 3300049579 Bacteria 1452
782 Ga0501046_0001975 3300049580 Bacteria 19485
783 Ga0501046_0020030 3300049580 Bacteria 5539
784 Ga0501046_0065302 3300049580 Bacteria 2839
785 Ga0501047_0109279 3300049581 Bacteria 2648
786 Ga0501047_0160923 3300049581 Bacteria 2117
787 Ga0501048_0045866 3300049582 Unclassified 3120
788 Ga0501048_0068156 3300049582 Bacteria 2514
789 Ga0501048_0117174 3300049582 Bacteria 1881
790 Ga0501068_0029264 3300049584 Bacteria 3261
791 Ga0501068_0056185 3300049584 Bacteria 2386
792 Ga0501069_0055790 3300049585 Unclassified 2201
793 Ga0501071_0045472 3300049587 Bacteria 3152
794 Ga0501072_0083304 3300049588 Bacteria 2535
795 Ga0501074_0033222 3300049590 Bacteria 3738
796 Ga0501075_0037193 3300049591 Bacteria 3635
797 Ga0501076_0002131 3300049592 Bacteria 13585
798 Ga0501076_0082045 3300049592 Bacteria 2588
799 Ga0501077_0019179 3300049593 Bacteria 4325
800 Ga0501199_000202 3300049650 Bacteria 5090
801 Ga0501201_000008 3300049651 Bacteria 11752
802 Ga0501206_001086 3300049653 Bacteria 3382
803 Ga0501208_000079 3300049655 Bacteria 5609
804 Ga0501209_001129 3300049656 Bacteria 3629
805 Ga0501209_002581 3300049656 Bacteria 2823
806 Ga0501211_003374 3300049658 Bacteria 1649
807 Ga0501216_000568 3300049660 Bacteria 4450
808 Ga0501217_000716 3300049661 Bacteria 5715
809 Ga0501227_005905 3300049665 Bacteria 2626
810 Ga0501233_001847 3300049668 Bacteria 3673
811 Ga0501239_000151 3300049672 Bacteria 4835
812 Ga0501243_001478 3300049675 Bacteria 3364
813 Ga0501246_000473 3300049676 Bacteria 2919
814 Ga0501247_003826 3300049677 Bacteria 1628
815 Ga0501249_000311 3300049679 Bacteria 13576
816 Ga0501252_001635 3300049682 Bacteria 2110
817 Ga0501253_000151 3300049683 Bacteria 5070
818 Ga0501257_000887 3300049686 Bacteria 6039
819 Ga0501260_000071 3300049689 Bacteria 6904
820 Ga0501261_000153 3300049690 Bacteria 9883
821 Ga0501219_001509 3300049703 Bacteria 2180
822 Ga0501221_000243 3300049704 Bacteria 7907
823 Ga0501225_0001799 3300049705 Bacteria 6709
824 Ga0501229_000181 3300049706 Bacteria 6695
825 Ga0501229_000367 3300049706 Bacteria 5103
826 Ga0501245_001642 3300049708 Bacteria 2916
827 Ga0501079_0032234 3300049741 Bacteria 4028
828 Ga0501080_0060090 3300049742 Bacteria 3537
829 Ga0501081_0000696 3300049743 Bacteria 19414
830 Ga0501232_001562 3300049757 Bacteria 1849
831 Ga0501241_003767 3300049758 Bacteria 2856
832 Ga0501266_000300 3300049763 Bacteria 6560
833 Ga0501270_000102 3300049767 Bacteria 6639
834 Ga0501271_000064 3300049768 Bacteria 8080
835 Ga0501272_000006 3300049769 Bacteria 14613
836 Ga0501278_000064 3300049774 Bacteria 7151
837 Ga0501279_000060 3300049775 Bacteria 19728
838 Ga0501280_003287 3300049776 Bacteria 2510
839 Ga0501281_00372 3300049777 Bacteria 4506
840 Ga0501282_002430 3300049778 Bacteria 2026
841 Ga0501283_000255 3300049779 Bacteria 7004
842 Ga0501035_0005765 3300049822 Bacteria 11675
843 Ga0501035_0008524 3300049822 Bacteria 9543
844 Ga0501035_0032289 3300049822 Bacteria 4764
845 Ga0501035_0075320 3300049822 Unclassified 2985
846 Ga0501035_0160598 3300049822 Unclassified 1945
847 Ga0501044_0111665 3300049823 Bacteria 2741
848 Ga0501045_0138021 3300049824 Bacteria 1813
849 Ga0501226_000463 3300049853 Bacteria 5709
850 nmdc:mga00v17_26544_c1 3300050491 Bacteria 3376
851 nmdc:mga0k408_12676_c1 3300050493 Bacteria 4611
852 nmdc:mga0k408_33506_c1 3300050493 Bacteria 2938
853 nmdc:mga0k408_3408_c1 3300050493 Bacteria 8421
854 nmdc:mga05p37_11314_c1 3300050507 Bacteria 10614
855 nmdc:mga05p37_21279_c1 3300050507 Bacteria 7852
856 nmdc:mga05p37_28711_c1 3300050507 Bacteria 6787
857 nmdc:mga05p37_55990_c1 3300050507 Bacteria 4854
858 nmdc:mga09592_1679_c1 3300050508 Bacteria 17838
859 nmdc:mga09592_84091_c1 3300050508 Bacteria 2713
860 nmdc:mga0qj67_4478_c1 3300050509 Bacteria 10121
861 nmdc:mga0qj67_4787_c1 3300050509 Bacteria 9842
862 nmdc:mga0qj67_56868_c1 3300050509 Bacteria 3102
863 nmdc:mga06r32_111951_c1 3300050510 Bacteria 2686
864 nmdc:mga06r32_82324_c1 3300050510 Bacteria 3135
865 nmdc:mga08y16_2953_c1 3300050511 Bacteria 17518
866 nmdc:mga08y16_5521_c1 3300050511 Bacteria 13236
867 nmdc:mga0n895_42530_c1 3300050512 Bacteria 4421
868 nmdc:mga0rr50_14167_c1 3300050513 Bacteria 5221
869 nmdc:mga0rr50_215891_c1 3300050513 Bacteria 1582
870 nmdc:mga08x19_8249_c1 3300050514 Bacteria 6193
871 nmdc:mga0a205_10309_c1 3300050515 Bacteria 8589
872 nmdc:mga0a205_119880_c1 3300050515 Bacteria 2530
873 nmdc:mga0sz30_14682_c1 3300050516 Bacteria 3087
874 Ga0495619_0047189 3300053085 Bacteria 2836
875 Ga0495619_0108036 3300053085 Unclassified 1898
876 Ga0500646_0000154 3300053090 Bacteria 20271
877 Ga0500641_0054808 3300053096 Bacteria 1649
878 Ga0500636_0000250 3300053177 Bacteria 29581
879 Ga0501084_0011541 3300054114 Bacteria 7315
880 Ga0590077_008026 3300059426 Bacteria 2162
881 Ga0501082_0000754 3300060353 Bacteria 28420
882 Ga0466962_0002290 3300061719 Bacteria 9078
883 Ga0466962_0005722 3300061719 Bacteria 5973
884 2511248687 2511231003 Bacteria 5606035
885 2511384922 2511231026 Bacteria 5225445
886 2513953929 2513237150 Bacteria 6553639
887 2514040064 2513237165 Bacteria 6771773
888 2521560947 2521172590 Bacteria 5047645
889 2548846380 2547132512 Bacteria 3416496
890 2550693494 2548876994 Bacteria 4904866
891 2553006168 2551306416 Bacteria 6152985
892 2574432118 2574179768 Bacteria 4907129
893 2597030830 2596583598 Bacteria 5251611
894 2599447060 2599185178 Bacteria 5365746
895 2643743826 2643221544 Bacteria 5886209
896 2643800528 2643221556 Bacteria 7251154
897 2643937216 2643221585 Bacteria 5812563
898 2644027150 2643221603 Bacteria 6147767
899 2644318381 2643221656 Bacteria 5809961
900 2644470437 2643221684 Bacteria 7145183
901 2688391132 2687453341 Bacteria 6534136
902 2739056453 2738541337 Bacteria 6183410
903 2765567376 2765235838 Bacteria 5445269
904 2808985031 2808606386 Bacteria 4471946
905 2809132178 2808606415 Bacteria 4576710
906 2809144042 2808606418 Bacteria 6724496
907 2809151803 2808606419 Bacteria 4576925
908 2819594916 2818991445 Bacteria 4955017
909 2819617332 2818991449 Bacteria 5518009
910 2834641195 2834641062 Bacteria 5559922
911 2839095282 2839094727 Bacteria 5534556
912 2843691366 2843690924 Bacteria 5169057
913 2852621911 2852618963 Bacteria 4577824
914 2857578848 2857576091 Bacteria 5465855
915 2884816143 2884811622 Bacteria 5552861
916 2884838231 2884836552 Bacteria 5219991
917 2884854523 2884852848 Bacteria 5221161
918 2885268996 2885266251 Bacteria 4796748
919 2891633621 2891633521 Bacteria 4602265
920 2896159220 2896154374 Bacteria 5221518
921 2900582237 2900577576 Bacteria 5438534
922 2901309945 2901300506 Bacteria 8463898
923 2904442434 2904439833 Bacteria 5931679
924 2904533701 2904530477 Bacteria 5876334
925 2904586658 2904584206 Bacteria 6028872
926 2904591528 2904589729 Bacteria 6113573
927 2904602334 2904601388 Bacteria 5884906
928 2910250707 2910245624 Bacteria 6935613
929 2919050681 2919046199 Bacteria 5567169
930 2919083341 2919079590 Bacteria 5946433
931 2923514786 2923510766 Bacteria 5926163
932 2928061237 2928058823 Bacteria 5520022
933 2928133709 2928130867 Bacteria 5467269
934 2939634185 2939631187 Bacteria 6118131
935 639785485 639633007 Bacteria 4376040
936 644746724 644736347 Bacteria 6476522
937 8003403938 8003400568 Bacteria 5535898
938 8047678833 8047673197 Bacteria 7395230
939 Ga0207688_10042921
940 JGI24741J21665_1000120
941 JGI25155J39150_1000205
942 JGI25155J39150_1000224
943 JGI25155J39150_1000386
944 JGI25156J39149_1000357
945 JGI25156J39149_1002757
946 JGI25156J39149_1003165
947 JGI25154J39366_1000298
948 JGI25154J39366_1000314
949 JGI25154J39366_1001626
950 JGI25157J39369_1000262
951 JGI25157J39369_1000702
952 JGI25151J46595_10002295
953 rootH2_10038054
954 JGI26145J50221_1000448
955 Ga0006562J51391_1127957
956 Ga0055538_1000110
957 Ga0055539_1000094
958 Ga0055539_1000159
959 Ga0055533_1000161
960 Ga0055532_1000006
961 Ga0055532_1000059
962 Ga0055525_1000081
963 Ga0055525_1000214
964 Ga0055525_1000323
965 Ga0055527_1003007
966 Ga0055535_1000004
967 Ga0055542_1000940
968 Ga0055529_1000022
969 Ga0055526_1000651
970 Ga0055526_1003073
971 Ga0055526_1004090
972 Ga0055526_1006100
973 Ga0055537_1001420
974 Ga0055524_1000642
975 Ga0055524_1006682
976 Ga0055536_1000094
977 Ga0055536_1000110
978 Ga0055534_1000656
979 Ga0055534_1001751
980 Ga0055531_10000007
981 Ga0055541_1000105
982 Ga0055541_1000464
983 Ga0065704_10077577
984 Ga0065712_10096373
985 Ga0065707_10082548
986 Ga0070676_10008985
987 Ga0070683_100015466
988 Ga0070690_100001012
989 Ga0070690_100012031
990 Ga0070670_100000054
991 Ga0070670_100007425
992 Ga0070670_100024257
993 Ga0070677_10001872
994 Ga0068869_100124717
995 Ga0070666_10008897
996 Ga0070666_10015909
997 Ga0070682_100039419
998 Ga0070682_100078636
999 Ga0070682_100096002
1000 Ga0068868_100045184
1001 Ga0068868_100086366
1002 Ga0068868_100160142
1003 Ga0070660_100003556
1004 Ga0070660_100004636
1005 Ga0070660_100100823
1006 Ga0070689_100000070
1007 Ga0070689_100040742
1008 Ga0070689_100042986
1009 Ga0070691_10000598
1010 Ga0070687_100013134
1011 Ga0070661_100000012
1012 Ga0070661_100005481
1013 Ga0070668_100005970
1014 Ga0070669_100000779
1015 Ga0070669_100002303
1016 Ga0070675_100013140
1017 Ga0070671_100000037
1018 Ga0070671_100053012
1019 Ga0070674_100001339
1020 Ga0070674_100006470
1021 Ga0070673_100000190
1022 Ga0070673_100001171
1023 Ga0070673_100153218
1024 Ga0070688_100000006
1025 Ga0070659_100001082
1026 Ga0070659_100001965
1027 Ga0070659_100006729
1028 Ga0070659_100053140
1029 Ga0070667_100000002
1030 Ga0070667_100121803
1031 Ga0070701_10000161
1032 Ga0070700_100000390
1033 Ga0070700_100053233
1034 Ga0070694_100029065
1035 Ga0070694_100075087
1036 Ga0070663_100000003
1037 Ga0070663_100014804
1038 Ga0070678_100075262
1039 Ga0070662_100000059
1040 Ga0070662_100018115
1041 Ga0070662_100091708
1042 Ga0070681_10032587
1043 Ga0068867_100000588
1044 Ga0070685_10000014
1045 Ga0070685_10000693
1046 Ga0070706_100035202
1047 Ga0070707_100000032
1048 Ga0070707_100082597
1049 Ga0070707_100193040
1050 Ga0070698_100097369
1051 Ga0070699_100005467
1052 Ga0070699_100049858
1053 Ga0070684_100149560
1054 Ga0070697_100035617
1055 Ga0070697_100055367
1056 Ga0070672_100000116
1057 Ga0070672_100000683
1058 Ga0070672_100173255
1059 Ga0070686_100000897
1060 Ga0070686_100002011
1061 Ga0070695_100027086
1062 Ga0070695_100077990
1063 Ga0070696_100000917
1064 Ga0070696_100002873
1065 Ga0070665_100079228
1066 Ga0070665_100252100
1067 Ga0070704_100025964
1068 Ga0070704_100131554
1069 Ga0068855_100002313
1070 Ga0068855_100296172
1071 Ga0070664_100000003
1072 Ga0070664_100002039
1073 Ga0070664_100018224
1074 Ga0068857_100004739
1075 Ga0068857_100130134
1076 Ga0068854_100000063
1077 Ga0068854_100014150
1078 Ga0068854_100028452
1079 Ga0068856_100000256
1080 Ga0068856_100150656
1081 Ga0070702_100047359
1082 Ga0068852_100002180
1083 Ga0068852_100022134
1084 Ga0068859_100046115
1085 Ga0068859_100187125
1086 Ga0068864_100000002
1087 Ga0068866_10019056
1088 Ga0068861_100050758
1089 Ga0068861_100057108
1090 Ga0068851_10056120
1091 Ga0068858_100001596
1092 Ga0068858_100003164
1093 Ga0068858_100026292
1094 Ga0068858_100084998
1095 Ga0068860_100000844
1096 Ga0068860_100014459
1097 Ga0081455_10000900
1098 Ga0081539_10042221
1099 Ga0075363_100034682
1100 Ga0075364_10051700
1101 Ga0075432_10000012
1102 Ga0075366_10008423
1103 Ga0075366_10020793
1104 Ga0075366_10036985
1105 Ga0097621_100021171
1106 Ga0097621_100021799
1107 Ga0097621_100041534
1108 Ga0097621_100173286
1109 Ga0068871_100012101
1110 Ga0068871_100019039
1111 Ga0068871_100075038
1112 Ga0075428_100051320
1113 Ga0075430_100002760
1114 Ga0075430_100005824
1115 Ga0075431_100004053
1116 Ga0075431_100021196
1117 Ga0075431_100090819
1118 Ga0075431_100092175
1119 Ga0075433_10006279
1120 Ga0075429_100028503
1121 Ga0075429_100041774
1122 Ga0068865_100003182
1123 Ga0097620_100046114
1124 Ga0097620_100187119
1125 Ga0079104_1002487
1126 Ga0099826_10000014
1127 Ga0075435_100022656
1128 Ga0075435_100054284
1129 Ga0105244_10036312
1130 Ga0105244_10063047
1131 Ga0105240_10002549
1132 Ga0105240_10006370
1133 Ga0105240_10052544
1134 Ga0105240_10067174
1135 Ga0111539_10000106
1136 Ga0111539_10006915
1137 Ga0111539_10013844
1138 Ga0111539_10125488
1139 Ga0105245_10016534
1140 Ga0105245_10067537
1141 Ga0105247_10042854
1142 Ga0114129_10003723
1143 Ga0114129_10016942
1144 Ga0114129_10020244
1145 Ga0114129_10041544
1146 Ga0114129_10081280
1147 Ga0114129_10395888
1148 Ga0105243_10001690
1149 Ga0105243_10029824
1150 Ga0105243_10034506
1151 Ga0105243_10083206
1152 Ga0105241_10021227
1153 Ga0105242_10000115
1154 Ga0105242_10000834
1155 Ga0105242_10033981
1156 Ga0105242_10156871
1157 Ga0105248_10004494
1158 Ga0105248_10020966
1159 Ga0105248_10042075
1160 Ga0105237_10014545
1161 Ga0105237_10040376
1162 Ga0105238_10000258
1163 Ga0105238_10000537
1164 Ga0105249_10107901
1165 Ga0105239_10003482
1166 Ga0105239_10012398
1167 Ga0105246_10000428
1168 Ga0157373_10037002
1169 Ga0157373_10042627
1170 Ga0157371_10000755
1171 Ga0157370_10000921
1172 Ga0157369_10026862
1173 Ga0157369_10111531
1174 Ga0157374_10003255
1175 Ga0157374_10005053
1176 Ga0157374_10110758
1177 Ga0157374_10201938
1178 Ga0157378_10005614
1179 Ga0157378_10056594
1180 Ga0163162_10013512
1181 Ga0157372_10002524
1182 Ga0157375_10072169
1183 Ga0157375_10096306
1184 Ga0163163_10004619
1185 Ga0157380_10003948
1186 Ga0157380_10033827
1187 Ga0157380_10090109
1188 Ga0182008_10013237
1189 Ga0157377_10055886
1190 Ga0157376_10005228
1191 Ga0157376_10024880
1192 Ga0182006_1002915
1193 Ga0182007_10009681
1194 Ga0154015_1057316
1195 Ga0213872_10000093
1196 Ga0213872_10002967
1197 Ga0213872_10003726
1198 Ga0213872_10027058
1199 Ga0209435_100032
1200 Ga0209435_100146
1201 Ga0209784_100035
1202 Ga0209784_100223
1203 Ga0209784_100389
1204 Ga0209566_100002
1205 Ga0209566_100040
1206 Ga0209566_100597
1207 Ga0209566_102325
1208 Ga0209674_100010
1209 Ga0209674_100050
1210 Ga0209674_100057
1211 Ga0209674_100262
1212 Ga0209672_100111
1213 Ga0209147_100015
1214 Ga0209147_100109
1215 Ga0209563_100004
1216 Ga0209563_100015
1217 Ga0209563_100026
1218 Ga0209563_100059
1219 Ga0209437_100512
1220 Ga0209258_100021
1221 Ga0209258_100190
1222 Ga0209646_1000055
1223 Ga0209646_1000113
1224 Ga0209646_1000327
1225 Ga0209026_1000102
1226 Ga0209026_1003686
1227 Ga0209677_100007
1228 Ga0209677_100036
1229 Ga0209677_102096
1230 Ga0209677_104484
1231 Ga0209148_1000109
1232 Ga0209759_1000104
1233 Ga0209759_1001940
1234 Ga0209759_1001952
1235 Ga0209565_1000045
1236 Ga0209565_1010345
1237 Ga0209455_1000028
1238 Ga0209455_1005292
1239 Ga0209675_1000661
1240 Ga0209676_1000064
1241 Ga0209025_1000371
1242 Ga0209025_1001907
1243 Ga0209025_1004682
1244 Ga0209025_1008213
1245 Ga0209564_1001969
1246 Ga0209564_1003010
1247 Ga0209564_1003370
1248 Ga0209758_1016413
1249 Ga0209050_1010447
1250 Ga0209256_1000287
1251 Ga0209256_1000835
1252 Ga0209051_1016564
1253 Ga0209051_1020107
1254 Ga0209257_1000021
1255 Ga0207656_10002178
1256 Ga0207682_10002916
1257 Ga0207642_10011312
1258 Ga0207642_10038230
1259 Ga0207710_10029853
1260 Ga0207688_10007275
1261 Ga0207680_10008088
1262 Ga0207680_10017073
1263 Ga0207680_10021987
1264 Ga0207645_10000009
1265 Ga0207645_10009334
1266 Ga0207645_10016845
1267 Ga0207643_10018377
1268 Ga0207684_10041172
1269 Ga0207707_10106442
1270 Ga0207695_10001571
1271 Ga0207695_10003997
1272 Ga0207695_10021978
1273 Ga0207695_10241708
1274 Ga0207671_10006562
1275 Ga0207660_10005324
1276 Ga0207660_10032198
1277 Ga0207662_10015073
1278 Ga0207662_10020619
1279 Ga0207657_10005067
1280 Ga0207657_10102751
1281 Ga0207649_10000408
1282 Ga0207649_10009607
1283 Ga0207649_10013648
1284 Ga0207646_10000032
1285 Ga0207646_10063723
1286 Ga0207646_10081509
1287 Ga0207681_10001771
1288 Ga0207681_10001840
1289 Ga0207694_10000384
1290 Ga0207650_10000002
1291 Ga0207650_10001415
1292 Ga0207650_10011570
1293 Ga0207650_10026204
1294 Ga0207650_10034544
1295 Ga0207659_10001981
1296 Ga0207659_10002634
1297 Ga0207687_10063307
1298 Ga0207644_10000114
1299 Ga0207644_10054530
1300 Ga0207690_10001518
1301 Ga0207690_10006028
1302 Ga0207706_10000134
1303 Ga0207706_10024959
1304 Ga0207706_10026965
1305 Ga0207706_10052507
1306 Ga0207706_10067903
1307 Ga0207686_10006468
1308 Ga0207686_10033668
1309 Ga0207709_10028889
1310 Ga0207709_10095548
1311 Ga0207709_10123125
1312 Ga0207670_10000160
1313 Ga0207670_10011882
1314 Ga0207670_10019416
1315 Ga0207669_10042504
1316 Ga0207704_10009221
1317 Ga0207665_10095622
1318 Ga0207691_10000015
1319 Ga0207691_10000066
1320 Ga0207691_10047442
1321 Ga0207691_10151284
1322 Ga0207711_10005430
1323 Ga0207711_10192370
1324 Ga0207689_10004460
1325 Ga0207661_10085137
1326 Ga0207679_10000007
1327 Ga0207679_10000931
1328 Ga0207679_10010190
1329 Ga0207679_10015279
1330 Ga0207679_10037901
1331 Ga0207667_10002083
1332 Ga0207667_10023865
1333 Ga0207651_10000209
1334 Ga0207651_10013780
1335 Ga0207712_10118138
1336 Ga0207668_10067417
1337 Ga0207640_10000132
1338 Ga0207640_10029086
1339 Ga0207640_10062780
1340 Ga0207658_10000001
1341 Ga0207658_10017783
1342 Ga0207677_10027785
1343 Ga0207703_10007101
1344 Ga0207703_10036652
1345 Ga0207678_10000011
1346 Ga0207678_10004674
1347 Ga0207678_10059322
1348 Ga0207678_10135373
1349 Ga0207708_10000336
1350 Ga0207708_10001429
1351 Ga0207708_10015389
1352 Ga0207708_10063040
1353 Ga0207708_10071162
1354 Ga0207702_10000018
1355 Ga0207702_10116246
1356 Ga0207641_10010053
1357 Ga0207641_10010055
1358 Ga0207648_10000049
1359 Ga0207648_10003565
1360 Ga0207648_10007583
1361 Ga0207676_10000001
1362 Ga0207676_10008539
1363 Ga0207674_10001844
1364 Ga0207674_10031517
1365 Ga0207674_10037920
1366 Ga0207674_10086447
1367 Ga0207674_10095295
1368 Ga0207674_10148254
1369 Ga0207683_10000023
1370 Ga0207683_10000501
1371 Ga0207698_10000462
1372 Ga0207698_10000553
1373 Ga0207698_10081542
1374 Ga0207698_10110019
1375 Ga0209281_1003184
1376 Ga0209969_1000683
1377 Ga0209969_1001115
1378 Ga0209967_1000047
1379 Ga0209981_1000336
1380 Ga0209996_1000225
1381 Ga0209984_1000396
1382 Ga0210000_1000180
1383 Ga0209995_1000150
1384 Ga0209968_1000036
1385 Ga0209970_1000719
1386 Ga0209282_1000048
1387 Ga0209971_1000062
1388 Ga0209966_1000210
1389 Ga0209998_10000030
1390 Ga0209974_10000386
1391 Ga0209974_10000506
1392 Ga0207428_10001516
1393 Ga0207428_10006322
1394 Ga0207428_10007796
1395 Ga0268266_10023623
1396 Ga0268266_10056565
1397 Ga0268266_10085640
1398 Ga0268265_10009824
1399 Ga0268264_10000004
1400 Ga0265318_10001430
1401 Ga0265336_10000511
1402 Ga0307515_10009616
1403 Ga0265338_10093773
1404 Ga0265324_10000011
1405 Ga0265324_10000340
1406 Ga0265324_10024393
1407 Ga0307511_10000022
1408 Ga0265328_10000447
1409 Ga0265328_10002460
1410 Ga0265328_10005254
1411 Ga0265328_10006977
1412 Ga0265325_10000125
1413 Ga0265325_10007301
1414 Ga0265329_10004482
1415 Ga0265331_10000070
1416 Ga0265331_10003188
1417 Ga0265331_10022219
1418 Ga0265327_10000068
1419 Ga0265327_10000156
1420 Ga0265327_10000205
1421 Ga0265327_10000706
1422 Ga0265327_10000719
1423 Ga0265327_10001333
1424 Ga0265327_10003120
1425 Ga0265327_10003549
1426 Ga0265327_10006214
1427 Ga0265327_10006520
1428 Ga0265327_10008435
1429 Ga0265327_10020927
1430 Ga0265327_10044401
1431 Ga0265327_10073494
1432 Ga0265316_10000005
1433 Ga0265316_10059298
1434 Ga0307408_100000023
1435 Ga0307408_100023759
1436 Ga0316575_10005752
1437 Ga0316579_10000015
1438 Ga0265314_10000134
1439 Ga0265314_10007756
1440 Ga0265314_10020023
1441 Ga0307516_10002741
1442 Ga0307405_10018136
1443 Ga0307413_10002623
1444 Ga0307407_10030521
1445 Ga0307412_10030943
1446 Ga0307412_10057247
1447 Ga0307416_100006355
1448 Ga0307416_100050238
1449 Ga0307416_100126947
1450 Ga0307411_10090392
1451 Ga0307415_100000756
1452 Ga0316583_10000483
1453 Ga0316583_10004823
1454 Ga0307507_10047428
1455 Ga0373952_0000324
1456 Ga0373923_0094106
1457 Ga0373956_0036076
1458 Ga0373957_0045731
1459 Ga0373960_0019946
1460 Ga0373955_0013547
1461 Ga0373955_0078224
1462 Ga0373924_0007992
1463 Ga0373935_0086873
1464 Ga0373933_0002452
1465 Ga0373937_0028631
1466 Ga0373937_0045752
1467 Ga0316582_0003674
1468 Ga0373925_0114893
1469 Ga0395899_0002272
1470 Ga0395899_0023327
1471 Ga0395899_0024592
1472 Ga0395899_0042010
1473 Ga0395899_0097786
1474 Ga0395899_0108211
1475 Ga0395900_0001906
1476 Ga0395900_0004368
1477 Ga0395900_0040940
1478 Ga0395900_0058716
1479 Ga0395900_0167746
1480 Ga0395905_0000043
1481 Ga0395905_0000242
1482 Ga0395905_0008311
1483 Ga0395905_0014548
1484 Ga0395905_0016517
1485 Ga0395905_0056374
1486 Ga0395905_0087784
1487 Ga0395905_0242384
1488 Ga0395901_0000307
1489 Ga0395901_0002559
1490 Ga0395901_0005833
1491 Ga0395901_0060610
1492 Ga0395901_0077433
1493 Ga0395901_0169831
1494 Ga0400490_21110
1495 Ga0436361_0100960
1496 Ga0436361_0257895
1497 Ga0436361_0545153
1498 Ga0436361_0773293
1499 Ga0436361_1049300
1500 Ga0439436_0024218
1501 Ga0439438_010003
1502 Ga0450911_004719
1503 Ga0450888_000035
1504 Ga0450890_000572
1505 Ga0450891_000065
1506 Ga0450889_000145
1507 Ga0439458_0003049
1508 Ga0450909_002848
1509 Ga0450893_0001962
1510 Ga0451577_0000085
1511 Ga0451577_0008429
1512 Ga0451577_0008841
1513 Ga0451577_0018842
1514 Ga0451577_0019578
1515 Ga0466969_0019979
1516 Ga0466969_0039336
1517 Ga0466972_0000359
1518 Ga0466972_0017061
1519 Ga0466977_0013105
1520 Ga0453683_0000047
1521 Ga0453683_0006123
1522 Ga0466966_0015691
1523 Ga0466966_0018170
1524 Ga0466966_0026512
1525 Ga0466966_0036339
1526 Ga0466961_0001701
1527 Ga0466961_0019077
1528 Ga0466961_0020792
1529 Ga0466964_0000097
1530 Ga0466964_0011111
1531 Ga0453684_0000273
1532 Ga0453684_0000276
1533 Ga0453684_0000302
1534 Ga0453684_0004162
1535 Ga0453684_0034104
1536 Ga0453684_0036639
1537 Ga0453684_0038837
1538 Ga0466968_0000838
1539 Ga0466968_0045031
1540 Ga0466970_0002355
1541 Ga0466957_0001772
1542 Ga0466957_0006017
1543 Ga0466957_0047230
1544 Ga0466957_0098808
1545 Ga0466959_0016980
1546 Ga0466959_0038347
1547 Ga0451576_0000003
1548 Ga0451576_0000006
1549 Ga0451576_0000096
1550 Ga0451576_0000116
1551 Ga0451576_0000147
1552 Ga0451576_0001472
1553 Ga0451576_0002503
1554 Ga0451576_0002526
1555 Ga0451576_0004790
1556 Ga0451576_0008254
1557 Ga0451576_0019294
1558 Ga0451576_0019765
1559 Ga0451576_0021263
1560 Ga0451576_0025801
1561 Ga0451576_0071239
1562 Ga0451576_0103230
1563 Ga0451576_0204093
1564 Ga0451576_0237968
1565 Ga0466958_0052313
1566 Ga0466967_0005183
1567 Ga0466967_0011484
1568 Ga0466967_0057073
1569 Ga0495617_000125
1570 Ga0495592_0020784
1571 Ga0495590_0002849
1572 Ga0495651_0084410
1573 Ga0495653_0041728
1574 Ga0495653_0116134
1575 Ga0495580_0036217
1576 Ga0495582_0000662
1577 Ga0495605_0000725
1578 Ga0495605_0000845
1579 Ga0495584_0000417
1580 Ga0495584_0032982
1581 Ga0495585_0003922
1582 Ga0495585_0004000
1583 Ga0495585_0020428
1584 Ga0495594_0006120
1585 Ga0495594_0038603
1586 Ga0495594_0060699
1587 Ga0495596_0001761
1588 Ga0495596_0004535
1589 Ga0495596_0005727
1590 Ga0495607_0000004
1591 Ga0495607_0001408
1592 Ga0495607_0003124
1593 Ga0495607_0036047
1594 Ga0495583_0000222
1595 Ga0495583_0006001
1596 Ga0495606_0018114
1597 Ga0495606_0019130
1598 Ga0495608_0023686
1599 Ga0495631_0001168
1600 Ga0495643_0002098
1601 Ga0495643_0002952
1602 Ga0495644_0019602
1603 Ga0495644_0022177
1604 Ga0495648_0000612
1605 Ga0495648_0002837
1606 Ga0495666_0000791
1607 Ga0495666_0006131
1608 Ga0495642_0000515
1609 Ga0495642_0013263
1610 Ga0495652_0064084
1611 Ga0495665_0003210
1612 Ga0495586_0028232
1613 Ga0495587_0062895
1614 Ga0495587_0072105
1615 Ga0495587_0087071
1616 Ga0495622_0010883
1617 Ga0495633_0006611
1618 Ga0495667_0091051
1619 Ga0495656_0004470
1620 Ga0495634_0106344
1621 Ga0495611_0002853
1622 Ga0495661_0000805
1623 Ga0495661_0004703
1624 Ga0495661_0005396
1625 Ga0495661_0007618
1626 Ga0495661_0053002
1627 Ga0495588_0002016
1628 Ga0495588_0013718
1629 Ga0495657_0060037
1630 Ga0495623_0018146
1631 Ga0495670_0005460
1632 Ga0495670_0019346
1633 Ga0495649_0020690
1634 Ga0495589_0000309
1635 Ga0495589_0001297
1636 Ga0495600_0021920
1637 Ga0495660_0000734
1638 Ga0495581_0001061
1639 Ga0495581_0005818
1640 Ga0495604_0040469
1641 Ga0495636_0023321
1642 Ga0495672_0000865
1643 Ga0495680_0061285
1644 Ga0495687_000656
1645 Ga0495687_000829
1646 Ga0495687_000866
1647 Ga0495687_007801
1648 Ga0495677_0003090
1649 Ga0495677_0004391
1650 Ga0495677_0007440
1651 Ga0495681_0000511
1652 Ga0495681_0003757
1653 Ga0495686_0000285
1654 Ga0495686_0002310
1655 Ga0495602_0001988
1656 Ga0495614_0008722
1657 Ga0495626_0000292
1658 Ga0495626_0000613
1659 Ga0496100_0074995
1660 Ga0496102_0000544
1661 Ga0496103_0006831
1662 Ga0496104_0019038
1663 Ga0496104_0085381
1664 Ga0496105_0152772
1665 Ga0496109_0006786
1666 Ga0496109_0057917
1667 Ga0496109_0113160
1668 Ga0496110_0047848
1669 Ga0496110_0070412
1670 Ga0496111_0004898
1671 Ga0496112_0069132
1672 Ga0496113_0009852
1673 Ga0496116_0007586
1674 Ga0496116_0030764
1675 Ga0496121_0044676
1676 Ga0496121_0099040
1677 Ga0496121_0123323
1678 Ga0496122_0001645
1679 Ga0496122_0006420
1680 Ga0496123_0002540
1681 Ga0496123_0005186
1682 Ga0496125_0001339
1683 Ga0496125_0083060
1684 Ga0495678_007426
1685 Ga0501290_000202
1686 Ga0501291_000129
1687 Ga0501292_000544
1688 Ga0501294_000270
1689 Ga0501296_000163
1690 Ga0501297_000961
1691 Ga0501298_000125
1692 Ga0501299_000033
1693 Ga0501300_000111
1694 Ga0501300_005855
1695 Ga0501301_000402
1696 Ga0501303_000044
1697 Ga0501031_0009138
1698 Ga0501031_0045375
1699 Ga0501032_0100497
1700 Ga0501034_0008163
1701 Ga0501034_0050002
1702 Ga0501034_0105734
1703 Ga0501036_0019186
1704 Ga0501037_0020623
1705 Ga0501037_0061841
1706 Ga0501038_0000129
1707 Ga0501038_0084344
1708 Ga0501039_0005040
1709 Ga0501039_0036031
1710 Ga0501039_0052723
1711 Ga0501039_0056686
1712 Ga0501039_0075842
1713 Ga0501039_0141383
1714 Ga0501041_0018228
1715 Ga0501041_0032501
1716 Ga0501042_0045024
1717 Ga0501042_0053358
1718 Ga0501043_0069412
1719 Ga0501043_0224578
1720 Ga0501046_0001975
1721 Ga0501046_0020030
1722 Ga0501046_0065302
1723 Ga0501047_0109279
1724 Ga0501047_0160923
1725 Ga0501048_0045866
1726 Ga0501048_0068156
1727 Ga0501048_0117174
1728 Ga0501068_0029264
1729 Ga0501068_0056185
1730 Ga0501069_0055790
1731 Ga0501071_0045472
1732 Ga0501072_0083304
1733 Ga0501074_0033222
1734 Ga0501075_0037193
1735 Ga0501076_0002131
1736 Ga0501076_0082045
1737 Ga0501077_0019179
1738 Ga0501199_000202
1739 Ga0501201_000008
1740 Ga0501206_001086
1741 Ga0501208_000079
1742 Ga0501209_001129
1743 Ga0501209_002581
1744 Ga0501211_003374
1745 Ga0501216_000568
1746 Ga0501217_000716
1747 Ga0501227_005905
1748 Ga0501233_001847
1749 Ga0501239_000151
1750 Ga0501243_001478
1751 Ga0501246_000473
1752 Ga0501247_003826
1753 Ga0501249_000311
1754 Ga0501252_001635
1755 Ga0501253_000151
1756 Ga0501257_000887
1757 Ga0501260_000071
1758 Ga0501261_000153
1759 Ga0501219_001509
1760 Ga0501221_000243
1761 Ga0501225_0001799
1762 Ga0501229_000181
1763 Ga0501229_000367
1764 Ga0501245_001642
1765 Ga0501079_0032234
1766 Ga0501080_0060090
1767 Ga0501081_0000696
1768 Ga0501232_001562
1769 Ga0501241_003767
1770 Ga0501266_000300
1771 Ga0501270_000102
1772 Ga0501271_000064
1773 Ga0501272_000006
1774 Ga0501278_000064
1775 Ga0501279_000060
1776 Ga0501280_003287
1777 Ga0501281_00372
1778 Ga0501282_002430
1779 Ga0501283_000255
1780 Ga0501035_0005765
1781 Ga0501035_0008524
1782 Ga0501035_0032289
1783 Ga0501035_0075320
1784 Ga0501035_0160598
1785 Ga0501044_0111665
1786 Ga0501045_0138021
1787 Ga0501226_000463
1788 nmdc:mga00v17_26544_c1
1789 nmdc:mga0k408_12676_c1
1790 nmdc:mga0k408_33506_c1
1791 nmdc:mga0k408_3408_c1
1792 nmdc:mga05p37_11314_c1
1793 nmdc:mga05p37_21279_c1
1794 nmdc:mga05p37_28711_c1
1795 nmdc:mga05p37_55990_c1
1796 nmdc:mga09592_1679_c1
1797 nmdc:mga09592_84091_c1
1798 nmdc:mga0qj67_4478_c1
1799 nmdc:mga0qj67_4787_c1
1800 nmdc:mga0qj67_56868_c1
1801 nmdc:mga06r32_111951_c1
1802 nmdc:mga06r32_82324_c1
1803 nmdc:mga08y16_2953_c1
1804 nmdc:mga08y16_5521_c1
1805 nmdc:mga0n895_42530_c1
1806 nmdc:mga0rr50_14167_c1
1807 nmdc:mga0rr50_215891_c1
1808 nmdc:mga08x19_8249_c1
1809 nmdc:mga0a205_10309_c1
1810 nmdc:mga0a205_119880_c1
1811 nmdc:mga0sz30_14682_c1
1812 Ga0495619_0047189
1813 Ga0495619_0108036
1814 Ga0500646_0000154
1815 Ga0500641_0054808
1816 Ga0500636_0000250
1817 Ga0501084_0011541
1818 Ga0590077_008026
1819 Ga0501082_0000754
1820 Ga0466962_0002290
1821 Ga0466962_0005722
1822 2511248687
1823 2511384922
1824 2513953929
1825 2514040064
1826 2521560947
1827 2548846380
1828 2550693494
1829 2553006168
1830 2574432118
1831 2597030830
1832 2599447060
1833 2643743826
1834 2643800528
1835 2643937216
1836 2644027150
1837 2644318381
1838 2644470437
1839 2688391132
1840 2739056453
1841 2765567376
1842 2808985031
1843 2809132178
1844 2809144042
1845 2809151803
1846 2819594916
1847 2819617332
1848 2834641195
1849 2839095282
1850 2843691366
1851 2852621911
1852 2857578848
1853 2884816143
1854 2884838231
1855 2884854523
1856 2885268996
1857 2891633621
1858 2896159220
1859 2900582237
1860 2901309945
1861 2904442434
1862 2904533701
1863 2904586658
1864 2904591528
1865 2904602334
1866 2910250707
1867 2919050681
1868 2919083341
1869 2923514786
1870 2928061237
1871 2928133709
1872 2939634185
1873 639785485
1874 644746724
1875 8003403938
1876 8047678833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

30

429

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hdh-assembly1.cif.gz_A structure of human sglt2-map17 complex with canagliflozin 0.8683 2 461
8hez-assembly1.cif.gz_A structure of human sglt2-map17 complex with dapagliflozin 0.8554 2 461
7vsi-assembly1.cif.gz_A structure of human sglt2-map17 complex bound with empagliflozin 0.8528 2 467
7wmv-assembly1.cif.gz_A structure of human sglt1-map17 complex bound with lx2761 0.8498 2 461
7ynj-assembly1.cif.gz_A structure of human sglt2-map17 complex bound with substrate amg in the occluded conformation 0.8395 5 461
ID Description Score Start End Superfamily
af_Q2FWY7_34_506_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8862 19 460 1.20.1730.10
af_Q1EHB4_32_596_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8821 26 461 1.20.1730.10
af_P32705_52_542_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8806 19 460 1.20.1730.10
af_P07117_23_496_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.877 20 461 1.20.1730.10
af_Q9VE46_30_497_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8757 26 460 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A258M527-F1-model_v4 Sodium:solute symporter 0.9936 1 459 GO:0005886
GO:0022857
AF-A0A5S9BP82-F1-model_v4 deleted 0.9898 1 468
AF-A0A258M527-F1-model_v4 Sodium:solute symporter 0.9893 1 459 GO:0005886
GO:0022857
AF-A0A7X0CFM7-F1-model_v4 SSS family transporter 0.9876 2 469 GO:0005886
GO:0022857
AF-A0A819B154-F1-model_v4 ABC transporter domain-containing protein 0.9652 18 470 GO:0005524
GO:0016887
GO:0019867
GO:0022857
GO:0043190
GO:0046942

Map