F486261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 346 | 1876 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0115166|Ga0495606_0115166_414_1397 |
| Length | 327 |
| Sequence | MPRILPHPRAFLNEGFPQPAFVPAEGTLKAPMRFDLVDLQLFLHVVEAGSITGGATRAYLSLASASERIHGMEDSLGVPLLLRARRGVTPTPAGEALVRHARLVFQQLQRMRAELGEHAQGLKGTVRLLCNTAALSEYLPDALAGFLARHPNVDVALEERTSHEVAKAVREGAADVGILSDAVDLSQLERFPFRPDRLVAVATPELAQLLAPAGGPVDFVRLLAFDHVGLAGDSALFNYLELQARRLGRSLHARVRVRGFDAICRMVEAGVGIGIVPEPAARRCAQTMGIAAMEVADGWALRQLSICVRSFDALPKHAQQLVDALRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 112 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 123 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 124 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 125 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 126 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 127 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 131 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 132 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 133 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 134 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 135 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 136 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 137 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 138 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 139 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 140 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 141 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 142 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 143 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 144 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 248 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 261 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 263 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 264 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 265 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 266 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 267 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 268 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 269 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 270 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 271 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 272 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 273 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 274 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 275 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 276 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 277 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 278 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 279 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 280 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 281 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 282 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 283 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 284 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 285 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 286 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 287 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 288 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 289 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 290 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 291 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 292 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 293 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 294 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 295 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 296 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 297 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 298 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 299 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 300 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 301 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 302 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 303 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 304 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 305 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 306 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 307 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 308 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 309 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 310 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 311 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 312 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 313 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 314 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 315 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 316 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 317 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 318 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 319 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 320 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 321 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 322 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 323 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 324 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 325 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 326 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 327 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 328 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 329 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 330 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 331 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 332 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 333 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 334 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 335 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 336 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 337 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 338 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 339 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 340 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 341 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 342 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 343 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 344 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 345 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 346 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.36 |
| Metatranscriptomes | 0 |
| Isolates | 8.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.57 |
| Nodule | 0.75 |
| Rhizoplane | 4.26 |
| Rhizosphere | 73.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495606_0115166 | 3300046507 | Bacteria | 1616 |
| 2 | JGI24739J22299_10004445 | 3300001989 | Bacteria | 5371 |
| 3 | JGI24739J22299_10016364 | 3300001989 | Bacteria | 2684 |
| 4 | JGI24739J22299_10022427 | 3300001989 | Bacteria | 2240 |
| 5 | JGI25150J39212_1012329 | 3300002774 | Bacteria | 1517 |
| 6 | rootL2_10032663 | 3300003322 | Bacteria | 4336 |
| 7 | rootL2_10034981 | 3300003322 | Bacteria | 2683 |
| 8 | rootL2_10066887 | 3300003322 | Bacteria | 1927 |
| 9 | rootL2_10207153 | 3300003322 | Bacteria | 1006 |
| 10 | rootL2_10332452 | 3300003322 | Bacteria | 3612 |
| 11 | rootH1_10137222 | 3300003323 | Bacteria | 3466 |
| 12 | Ga0055532_1000682 | 3300003758 | Bacteria | 12805 |
| 13 | Ga0055532_1000754 | 3300003758 | Bacteria | 11614 |
| 14 | Ga0055532_1001348 | 3300003758 | Bacteria | 7017 |
| 15 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 16 | Ga0055527_1000578 | 3300003760 | Bacteria | 11977 |
| 17 | Ga0055527_1000930 | 3300003760 | Bacteria | 7225 |
| 18 | Ga0055535_1001502 | 3300003761 | Bacteria | 11614 |
| 19 | Ga0055535_1001505 | 3300003761 | Bacteria | 11588 |
| 20 | Ga0055542_1001468 | 3300003762 | Bacteria | 11603 |
| 21 | Ga0055542_1004495 | 3300003762 | Bacteria | 3374 |
| 22 | Ga0055529_1000181 | 3300003763 | Bacteria | 86692 |
| 23 | Ga0055529_1000392 | 3300003763 | Bacteria | 46822 |
| 24 | Ga0055529_1001827 | 3300003763 | Bacteria | 5061 |
| 25 | Ga0055526_1000074 | 3300003771 | Bacteria | 92854 |
| 26 | Ga0055526_1000092 | 3300003771 | Bacteria | 82076 |
| 27 | Ga0055526_1000729 | 3300003771 | Bacteria | 24835 |
| 28 | Ga0055537_1000078 | 3300003773 | Bacteria | 70140 |
| 29 | Ga0055524_1000053 | 3300003775 | Bacteria | 144892 |
| 30 | Ga0055524_1005701 | 3300003775 | Bacteria | 5519 |
| 31 | Ga0055534_1000070 | 3300003784 | Bacteria | 80000 |
| 32 | Ga0055534_1000105 | 3300003784 | Bacteria | 64494 |
| 33 | Ga0055528_1000224 | 3300003790 | Bacteria | 47488 |
| 34 | Ga0055528_1001957 | 3300003790 | Bacteria | 11644 |
| 35 | Ga0055541_1009217 | 3300003841 | Bacteria | 1537 |
| 36 | Ga0065165_1000677 | 3300005262 | Bacteria | 49085 |
| 37 | Ga0065165_1033071 | 3300005262 | Bacteria | 1613 |
| 38 | Ga0065704_10072806 | 3300005289 | Bacteria | 7981 |
| 39 | Ga0065704_10075896 | 3300005289 | Bacteria | 5364 |
| 40 | Ga0070658_10040332 | 3300005327 | Bacteria | 3766 |
| 41 | Ga0070670_100001744 | 3300005331 | Bacteria | 17710 |
| 42 | Ga0070666_10182737 | 3300005335 | Bacteria | 1471 |
| 43 | Ga0070660_100000013 | 3300005339 | Bacteria | 116814 |
| 44 | Ga0070660_100161357 | 3300005339 | Bacteria | 1806 |
| 45 | Ga0070671_100209294 | 3300005355 | Bacteria | 1654 |
| 46 | Ga0070659_100000028 | 3300005366 | Bacteria | 140665 |
| 47 | Ga0070667_100034706 | 3300005367 | Bacteria | 4222 |
| 48 | Ga0070667_100321030 | 3300005367 | Bacteria | 1397 |
| 49 | Ga0070663_100040363 | 3300005455 | Bacteria | 3267 |
| 50 | Ga0070678_100023362 | 3300005456 | Bacteria | 4119 |
| 51 | Ga0068853_100126047 | 3300005539 | Bacteria | 2287 |
| 52 | Ga0070672_100463714 | 3300005543 | Bacteria | 1092 |
| 53 | Ga0068855_100057985 | 3300005563 | Bacteria | 4537 |
| 54 | Ga0068855_100203278 | 3300005563 | Bacteria | 2229 |
| 55 | Ga0070664_100062125 | 3300005564 | Bacteria | 3184 |
| 56 | Ga0068852_100067926 | 3300005616 | Bacteria | 3118 |
| 57 | Ga0068852_100621619 | 3300005616 | Bacteria | 1086 |
| 58 | Ga0068858_100059624 | 3300005842 | Bacteria | 3527 |
| 59 | Ga0068860_100173343 | 3300005843 | Bacteria | 2084 |
| 60 | Ga0075364_10013194 | 3300006051 | Bacteria | 5072 |
| 61 | Ga0075362_10085390 | 3300006177 | Bacteria | 1459 |
| 62 | Ga0075369_10078426 | 3300006186 | Bacteria | 1462 |
| 63 | Ga0099823_1000188 | 3300006944 | Bacteria | 34181 |
| 64 | Ga0079104_1003296 | 3300006946 | Bacteria | 7681 |
| 65 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 66 | Ga0105251_10000623 | 3300009011 | Bacteria | 32586 |
| 67 | Ga0105251_10001933 | 3300009011 | Bacteria | 16960 |
| 68 | Ga0105251_10007562 | 3300009011 | Bacteria | 6671 |
| 69 | Ga0105251_10026669 | 3300009011 | Bacteria | 2940 |
| 70 | Ga0105251_10048315 | 3300009011 | Bacteria | 2040 |
| 71 | Ga0105244_10001306 | 3300009036 | Bacteria | 20398 |
| 72 | Ga0105244_10001737 | 3300009036 | Bacteria | 17153 |
| 73 | Ga0105244_10002830 | 3300009036 | Bacteria | 12874 |
| 74 | Ga0105244_10004135 | 3300009036 | Bacteria | 10107 |
| 75 | Ga0105244_10007475 | 3300009036 | Bacteria | 6940 |
| 76 | Ga0105244_10022995 | 3300009036 | Bacteria | 3425 |
| 77 | Ga0105244_10046885 | 3300009036 | Bacteria | 2218 |
| 78 | Ga0105244_10065908 | 3300009036 | Bacteria | 1814 |
| 79 | Ga0105250_10000222 | 3300009092 | Bacteria | 47479 |
| 80 | Ga0105250_10042939 | 3300009092 | Bacteria | 1812 |
| 81 | Ga0105250_10108438 | 3300009092 | Bacteria | 1136 |
| 82 | Ga0105240_10000393 | 3300009093 | Bacteria | 81664 |
| 83 | Ga0105243_10007339 | 3300009148 | Bacteria | 8474 |
| 84 | Ga0105243_10041517 | 3300009148 | Bacteria | 3598 |
| 85 | Ga0105241_10004855 | 3300009174 | Bacteria | 9915 |
| 86 | Ga0105242_10028696 | 3300009176 | Bacteria | 4432 |
| 87 | Ga0105237_10005816 | 3300009545 | Bacteria | 13833 |
| 88 | Ga0105237_10311635 | 3300009545 | Bacteria | 1577 |
| 89 | Ga0105238_10018213 | 3300009551 | Bacteria | 7143 |
| 90 | Ga0105238_10486992 | 3300009551 | Bacteria | 1233 |
| 91 | Ga0105239_10003889 | 3300010375 | Bacteria | 18095 |
| 92 | Ga0157373_10008160 | 3300013100 | Bacteria | 7785 |
| 93 | Ga0157373_10122558 | 3300013100 | Bacteria | 1827 |
| 94 | Ga0157370_10124572 | 3300013104 | Bacteria | 2406 |
| 95 | Ga0157369_10027361 | 3300013105 | Bacteria | 6321 |
| 96 | Ga0157369_10346696 | 3300013105 | Bacteria | 1543 |
| 97 | Ga0163162_10044544 | 3300013306 | Bacteria | 4444 |
| 98 | Ga0157372_10475911 | 3300013307 | Bacteria | 1456 |
| 99 | Ga0157375_10217409 | 3300013308 | Bacteria | 2069 |
| 100 | Ga0157375_10514023 | 3300013308 | Bacteria | 1361 |
| 101 | Ga0182008_10002217 | 3300014497 | Bacteria | 12310 |
| 102 | Ga0182008_10028309 | 3300014497 | Bacteria | 2834 |
| 103 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 104 | Ga0182006_1000511 | 3300015261 | Bacteria | 29588 |
| 105 | Ga0182006_1004027 | 3300015261 | Bacteria | 7334 |
| 106 | Ga0182006_1041261 | 3300015261 | Bacteria | 1813 |
| 107 | Ga0182007_10000037 | 3300015262 | Bacteria | 123677 |
| 108 | Ga0182007_10000918 | 3300015262 | Bacteria | 16302 |
| 109 | Ga0182007_10002310 | 3300015262 | Bacteria | 9578 |
| 110 | Ga0182007_10003199 | 3300015262 | Bacteria | 7815 |
| 111 | Ga0182007_10044032 | 3300015262 | Bacteria | 1482 |
| 112 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 113 | Ga0182005_1000021 | 3300015265 | Bacteria | 272185 |
| 114 | Ga0182005_1010923 | 3300015265 | Bacteria | 2602 |
| 115 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 116 | Ga0163161_10031248 | 3300017792 | Bacteria | 3793 |
| 117 | Ga0163161_10044365 | 3300017792 | Bacteria | 3202 |
| 118 | Ga0163161_10062850 | 3300017792 | Bacteria | 2705 |
| 119 | Ga0163161_10065978 | 3300017792 | Bacteria | 2642 |
| 120 | Ga0209566_100293 | 3300025225 | Bacteria | 45453 |
| 121 | Ga0209674_101016 | 3300025226 | Bacteria | 8597 |
| 122 | Ga0209672_100067 | 3300025228 | Bacteria | 180819 |
| 123 | Ga0209672_100079 | 3300025228 | Bacteria | 156875 |
| 124 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 125 | Ga0209147_100061 | 3300025229 | Bacteria | 248809 |
| 126 | Ga0209147_100107 | 3300025229 | Bacteria | 156875 |
| 127 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 128 | Ga0209258_100030 | 3300025242 | Bacteria | 470208 |
| 129 | Ga0209258_100340 | 3300025242 | Bacteria | 69044 |
| 130 | Ga0207425_1000192 | 3300025245 | Bacteria | 49765 |
| 131 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 132 | Ga0209026_1004971 | 3300025250 | Bacteria | 3730 |
| 133 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 134 | Ga0209148_1000439 | 3300025254 | Bacteria | 45709 |
| 135 | Ga0209148_1000957 | 3300025254 | Bacteria | 18874 |
| 136 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 137 | Ga0209565_1004074 | 3300025263 | Bacteria | 4553 |
| 138 | Ga0209565_1008777 | 3300025263 | Bacteria | 2617 |
| 139 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 140 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 141 | Ga0209455_1000243 | 3300025272 | Bacteria | 67283 |
| 142 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 143 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 144 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 145 | Ga0209676_1000805 | 3300025292 | Bacteria | 41142 |
| 146 | Ga0209025_1009132 | 3300025294 | Bacteria | 6972 |
| 147 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 148 | Ga0209564_1000033 | 3300025295 | Bacteria | 446200 |
| 149 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 150 | Ga0209564_1022670 | 3300025295 | Bacteria | 2209 |
| 151 | Ga0209758_1000227 | 3300025297 | Bacteria | 120073 |
| 152 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 153 | Ga0209256_1000322 | 3300025299 | Bacteria | 82681 |
| 154 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 155 | Ga0207696_1000265 | 3300025711 | Bacteria | 66603 |
| 156 | Ga0207696_1026989 | 3300025711 | Bacteria | 1774 |
| 157 | Ga0207696_1054074 | 3300025711 | Bacteria | 1142 |
| 158 | Ga0207655_1000162 | 3300025728 | Bacteria | 122768 |
| 159 | Ga0207655_1000383 | 3300025728 | Bacteria | 61839 |
| 160 | Ga0207655_1002794 | 3300025728 | Bacteria | 13559 |
| 161 | Ga0207655_1003043 | 3300025728 | Bacteria | 12801 |
| 162 | Ga0207655_1040598 | 3300025728 | Bacteria | 2005 |
| 163 | Ga0207713_1000238 | 3300025735 | Bacteria | 73507 |
| 164 | Ga0207713_1000481 | 3300025735 | Bacteria | 41406 |
| 165 | Ga0207713_1003042 | 3300025735 | Bacteria | 11684 |
| 166 | Ga0207713_1003804 | 3300025735 | Bacteria | 10108 |
| 167 | Ga0207713_1072423 | 3300025735 | Bacteria | 1268 |
| 168 | Ga0207647_10005613 | 3300025904 | Bacteria | 9165 |
| 169 | Ga0207705_10003154 | 3300025909 | Bacteria | 12544 |
| 170 | Ga0207695_10000255 | 3300025913 | Bacteria | 136470 |
| 171 | Ga0207671_10037053 | 3300025914 | Bacteria | 3616 |
| 172 | Ga0207657_10000017 | 3300025919 | Bacteria | 173373 |
| 173 | Ga0207649_10210127 | 3300025920 | Bacteria | 1380 |
| 174 | Ga0207694_10045738 | 3300025924 | Bacteria | 3381 |
| 175 | Ga0207694_10302920 | 3300025924 | Bacteria | 1316 |
| 176 | Ga0207694_10322750 | 3300025924 | Bacteria | 1274 |
| 177 | Ga0207650_10000276 | 3300025925 | Bacteria | 53717 |
| 178 | Ga0207690_10000009 | 3300025932 | Bacteria | 366044 |
| 179 | Ga0207690_10027008 | 3300025932 | Bacteria | 3623 |
| 180 | Ga0207686_10027759 | 3300025934 | Bacteria | 3318 |
| 181 | Ga0207709_10013448 | 3300025935 | Bacteria | 4516 |
| 182 | Ga0207709_10063090 | 3300025935 | Bacteria | 2322 |
| 183 | Ga0207691_10084306 | 3300025940 | Bacteria | 2853 |
| 184 | Ga0207691_10458002 | 3300025940 | Bacteria | 1085 |
| 185 | Ga0207658_10013681 | 3300025986 | Bacteria | 5549 |
| 186 | Ga0207658_10222442 | 3300025986 | Bacteria | 1589 |
| 187 | Ga0207703_10052595 | 3300026035 | Bacteria | 3308 |
| 188 | Ga0207678_10011303 | 3300026067 | Bacteria | 7836 |
| 189 | Ga0207674_10107181 | 3300026116 | Bacteria | 2771 |
| 190 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 191 | Ga0209371_1000128 | 3300027312 | Bacteria | 124861 |
| 192 | Ga0209371_1000409 | 3300027312 | Bacteria | 44442 |
| 193 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 194 | Ga0307515_10003602 | 3300028794 | Bacteria | 32529 |
| 195 | Ga0265324_10037821 | 3300029957 | Bacteria | 1676 |
| 196 | Ga0268256_1000152 | 3300030500 | Bacteria | 92565 |
| 197 | Ga0268256_1000350 | 3300030500 | Bacteria | 44442 |
| 198 | Ga0307512_10098188 | 3300030522 | Bacteria | 2000 |
| 199 | Ga0265327_10000777 | 3300031251 | Bacteria | 49259 |
| 200 | Ga0307513_10014794 | 3300031456 | Bacteria | 9490 |
| 201 | Ga0307514_10000408 | 3300031649 | Bacteria | 95961 |
| 202 | Ga0307518_10030063 | 3300031838 | Bacteria | 3933 |
| 203 | Ga0307414_10051354 | 3300032004 | Bacteria | 2862 |
| 204 | Ga0373939_0048876 | 3300035114 | Bacteria | 1305 |
| 205 | Ga0395899_0003015 | 3300037312 | Bacteria | 13443 |
| 206 | Ga0395899_0011765 | 3300037312 | Bacteria | 6697 |
| 207 | Ga0395899_0125179 | 3300037312 | Bacteria | 1838 |
| 208 | Ga0395899_0141345 | 3300037312 | Bacteria | 1712 |
| 209 | Ga0395899_0153461 | 3300037312 | Bacteria | 1631 |
| 210 | Ga0395900_0004698 | 3300037418 | Bacteria | 14397 |
| 211 | Ga0395900_0054726 | 3300037418 | Bacteria | 4108 |
| 212 | Ga0395900_0056356 | 3300037418 | Bacteria | 4045 |
| 213 | Ga0395900_0057570 | 3300037418 | Bacteria | 4001 |
| 214 | Ga0395900_0116179 | 3300037418 | Bacteria | 2745 |
| 215 | Ga0395900_0321488 | 3300037418 | Bacteria | 1527 |
| 216 | Ga0395900_0513843 | 3300037418 | Bacteria | 1147 |
| 217 | Ga0395898_0200862 | 3300037466 | Bacteria | 1903 |
| 218 | Ga0395905_0000666 | 3300037471 | Bacteria | 45623 |
| 219 | Ga0395905_0125394 | 3300037471 | Bacteria | 2414 |
| 220 | Ga0395905_0358154 | 3300037471 | Bacteria | 1351 |
| 221 | Ga0395901_0000084 | 3300038443 | Bacteria | 127737 |
| 222 | Ga0395901_0182133 | 3300038443 | Bacteria | 2203 |
| 223 | Ga0395901_0182267 | 3300038443 | Bacteria | 2202 |
| 224 | Ga0436365_1246322 | 3300039437 | Bacteria | 2313 |
| 225 | Ga0439436_0001618 | 3300041404 | Bacteria | 6553 |
| 226 | Ga0439439_0016478 | 3300041406 | Bacteria | 1810 |
| 227 | Ga0439447_007586 | 3300041407 | Bacteria | 3425 |
| 228 | Ga0439461_0005413 | 3300041410 | Bacteria | 2173 |
| 229 | Ga0439466_0018680 | 3300041411 | Bacteria | 2486 |
| 230 | Ga0439433_0010314 | 3300041999 | Bacteria | 2039 |
| 231 | Ga0439448_0002114 | 3300042005 | Bacteria | 5347 |
| 232 | Ga0439432_002855 | 3300042006 | Bacteria | 6441 |
| 233 | Ga0439432_006062 | 3300042006 | Bacteria | 4336 |
| 234 | Ga0439449_0010235 | 3300042007 | Bacteria | 3542 |
| 235 | Ga0439449_0033170 | 3300042007 | Bacteria | 1924 |
| 236 | Ga0439450_037288 | 3300042008 | Bacteria | 1116 |
| 237 | Ga0439452_009145 | 3300042010 | Bacteria | 2935 |
| 238 | Ga0439455_0007580 | 3300042012 | Bacteria | 2299 |
| 239 | Ga0439456_000013 | 3300042013 | Bacteria | 72544 |
| 240 | Ga0439463_000115 | 3300042016 | Bacteria | 19848 |
| 241 | Ga0450911_000128 | 3300042115 | Bacteria | 30127 |
| 242 | Ga0450923_000481 | 3300042125 | Bacteria | 4380 |
| 243 | Ga0450902_003715 | 3300042137 | Bacteria | 2246 |
| 244 | Ga0450905_000328 | 3300042142 | Bacteria | 5690 |
| 245 | Ga0450905_000588 | 3300042142 | Bacteria | 4499 |
| 246 | Ga0450907_014675 | 3300042146 | Bacteria | 1308 |
| 247 | Ga0439446_0019725 | 3300042156 | Bacteria | 1896 |
| 248 | Ga0439458_0004763 | 3300042157 | Bacteria | 3085 |
| 249 | Ga0450908_014599 | 3300042184 | Bacteria | 1410 |
| 250 | Ga0439434_0027885 | 3300042435 | Bacteria | 1709 |
| 251 | Ga0450901_000315 | 3300042533 | Bacteria | 5923 |
| 252 | Ga0466972_0057135 | 3300044658 | Bacteria | 1874 |
| 253 | Ga0466972_0184859 | 3300044658 | Bacteria | 977 |
| 254 | Ga0466965_0006059 | 3300044683 | Bacteria | 5465 |
| 255 | Ga0466965_0009849 | 3300044683 | Bacteria | 4443 |
| 256 | Ga0466965_0018929 | 3300044683 | Bacteria | 3304 |
| 257 | Ga0466965_0050036 | 3300044683 | Bacteria | 2071 |
| 258 | Ga0466965_0204187 | 3300044683 | Bacteria | 1049 |
| 259 | Ga0466966_0002542 | 3300044684 | Bacteria | 11953 |
| 260 | Ga0466966_0049221 | 3300044684 | Bacteria | 2684 |
| 261 | Ga0466966_0184921 | 3300044684 | Bacteria | 1263 |
| 262 | Ga0466961_0060004 | 3300044693 | Bacteria | 2418 |
| 263 | Ga0466961_0074359 | 3300044693 | Bacteria | 2154 |
| 264 | Ga0466961_0128358 | 3300044693 | Bacteria | 1589 |
| 265 | Ga0466963_0023995 | 3300044694 | Bacteria | 3879 |
| 266 | Ga0466964_0000831 | 3300044706 | Bacteria | 10096 |
| 267 | Ga0466964_0001625 | 3300044706 | Bacteria | 7761 |
| 268 | Ga0466964_0029511 | 3300044706 | Bacteria | 2166 |
| 269 | Ga0466964_0045087 | 3300044706 | Bacteria | 1793 |
| 270 | Ga0466964_0136943 | 3300044706 | Bacteria | 1121 |
| 271 | Ga0466968_0005562 | 3300044735 | Bacteria | 4720 |
| 272 | Ga0466970_0015384 | 3300044765 | Bacteria | 3933 |
| 273 | Ga0466970_0071724 | 3300044765 | Bacteria | 1863 |
| 274 | Ga0466970_0108495 | 3300044765 | Bacteria | 1515 |
| 275 | Ga0466970_0119307 | 3300044765 | Bacteria | 1444 |
| 276 | Ga0466957_0009190 | 3300044842 | Bacteria | 5638 |
| 277 | Ga0466957_0020696 | 3300044842 | Bacteria | 3872 |
| 278 | Ga0466957_0089845 | 3300044842 | Bacteria | 1923 |
| 279 | Ga0466960_0032635 | 3300044901 | Unclassified | 2413 |
| 280 | Ga0466959_0013616 | 3300045049 | Bacteria | 5898 |
| 281 | Ga0466959_0040982 | 3300045049 | Bacteria | 3420 |
| 282 | Ga0466959_0099079 | 3300045049 | Bacteria | 2087 |
| 283 | Ga0466958_0130257 | 3300045836 | Bacteria | 1579 |
| 284 | Ga0466958_0233552 | 3300045836 | Bacteria | 1174 |
| 285 | Ga0466967_0108414 | 3300045976 | Bacteria | 2548 |
| 286 | Ga0466967_0152776 | 3300045976 | Bacteria | 2159 |
| 287 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 288 | Ga0495617_000037 | 3300046452 | Bacteria | 134553 |
| 289 | Ga0495617_007530 | 3300046452 | Bacteria | 3776 |
| 290 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 291 | Ga0495627_000373 | 3300046453 | Bacteria | 41470 |
| 292 | Ga0495627_002596 | 3300046453 | Bacteria | 8532 |
| 293 | Ga0495627_023921 | 3300046453 | Bacteria | 1996 |
| 294 | Ga0495627_046028 | 3300046453 | Bacteria | 1327 |
| 295 | Ga0495603_0003904 | 3300046455 | Bacteria | 8879 |
| 296 | Ga0495603_0033289 | 3300046455 | Bacteria | 3101 |
| 297 | Ga0495590_0031597 | 3300046457 | Bacteria | 1853 |
| 298 | Ga0495590_0104002 | 3300046457 | Bacteria | 1010 |
| 299 | Ga0495591_000640 | 3300046458 | Bacteria | 25873 |
| 300 | Ga0495591_000907 | 3300046458 | Bacteria | 20617 |
| 301 | Ga0495591_001426 | 3300046458 | Bacteria | 14882 |
| 302 | Ga0495591_002894 | 3300046458 | Bacteria | 9209 |
| 303 | Ga0495591_004334 | 3300046458 | Bacteria | 6988 |
| 304 | Ga0495638_0000184 | 3300046460 | Bacteria | 95341 |
| 305 | Ga0495638_0073465 | 3300046460 | Bacteria | 2087 |
| 306 | Ga0495638_0116509 | 3300046460 | Bacteria | 1582 |
| 307 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 308 | Ga0495650_0000166 | 3300046471 | Bacteria | 146047 |
| 309 | Ga0495650_0000442 | 3300046471 | Bacteria | 66640 |
| 310 | Ga0495650_0001380 | 3300046471 | Bacteria | 23944 |
| 311 | Ga0495650_0003807 | 3300046471 | Bacteria | 10736 |
| 312 | Ga0495650_0005435 | 3300046471 | Bacteria | 8275 |
| 313 | Ga0495650_0006785 | 3300046471 | Bacteria | 7067 |
| 314 | Ga0495650_0026847 | 3300046471 | Bacteria | 2670 |
| 315 | Ga0495650_0027956 | 3300046471 | Bacteria | 2597 |
| 316 | Ga0495650_0051431 | 3300046471 | Bacteria | 1697 |
| 317 | Ga0495605_0000087 | 3300046474 | Bacteria | 120256 |
| 318 | Ga0495605_0000367 | 3300046474 | Bacteria | 42879 |
| 319 | Ga0495605_0000890 | 3300046474 | Bacteria | 20558 |
| 320 | Ga0495605_0002562 | 3300046474 | Bacteria | 11177 |
| 321 | Ga0495605_0002755 | 3300046474 | Bacteria | 10731 |
| 322 | Ga0495605_0009952 | 3300046474 | Bacteria | 5328 |
| 323 | Ga0495605_0015662 | 3300046474 | Bacteria | 4120 |
| 324 | Ga0495605_0016867 | 3300046474 | Bacteria | 3945 |
| 325 | Ga0495605_0019249 | 3300046474 | Bacteria | 3651 |
| 326 | Ga0495605_0021524 | 3300046474 | Bacteria | 3414 |
| 327 | Ga0495605_0055290 | 3300046474 | Bacteria | 1918 |
| 328 | Ga0495639_0008939 | 3300046475 | Bacteria | 4292 |
| 329 | Ga0495639_0054578 | 3300046475 | Bacteria | 1821 |
| 330 | Ga0495584_0000813 | 3300046491 | Bacteria | 20549 |
| 331 | Ga0495584_0003990 | 3300046491 | Bacteria | 7963 |
| 332 | Ga0495584_0006470 | 3300046491 | Bacteria | 6128 |
| 333 | Ga0495584_0008070 | 3300046491 | Bacteria | 5472 |
| 334 | Ga0495584_0009304 | 3300046491 | Bacteria | 5062 |
| 335 | Ga0495584_0025716 | 3300046491 | Bacteria | 2984 |
| 336 | Ga0495584_0069803 | 3300046491 | Bacteria | 1765 |
| 337 | Ga0495585_0002212 | 3300046492 | Bacteria | 14101 |
| 338 | Ga0495585_0007671 | 3300046492 | Bacteria | 6581 |
| 339 | Ga0495585_0009643 | 3300046492 | Bacteria | 5781 |
| 340 | Ga0495585_0012937 | 3300046492 | Bacteria | 4903 |
| 341 | Ga0495585_0013686 | 3300046492 | Bacteria | 4742 |
| 342 | Ga0495585_0023082 | 3300046492 | Bacteria | 3570 |
| 343 | Ga0495585_0042498 | 3300046492 | Bacteria | 2545 |
| 344 | Ga0495585_0084259 | 3300046492 | Bacteria | 1719 |
| 345 | Ga0495594_0033420 | 3300046499 | Bacteria | 2796 |
| 346 | Ga0495594_0079676 | 3300046499 | Bacteria | 1828 |
| 347 | Ga0495594_0123118 | 3300046499 | Bacteria | 1466 |
| 348 | Ga0495596_0003236 | 3300046500 | Bacteria | 8337 |
| 349 | Ga0495596_0009635 | 3300046500 | Bacteria | 4244 |
| 350 | Ga0495596_0009703 | 3300046500 | Bacteria | 4225 |
| 351 | Ga0495596_0011050 | 3300046500 | Bacteria | 3908 |
| 352 | Ga0495596_0018395 | 3300046500 | Bacteria | 2880 |
| 353 | Ga0495596_0022437 | 3300046500 | Bacteria | 2570 |
| 354 | Ga0495596_0023437 | 3300046500 | Bacteria | 2504 |
| 355 | Ga0495596_0044175 | 3300046500 | Bacteria | 1754 |
| 356 | Ga0495607_0000424 | 3300046501 | Bacteria | 42978 |
| 357 | Ga0495607_0001898 | 3300046501 | Bacteria | 17719 |
| 358 | Ga0495607_0006062 | 3300046501 | Bacteria | 8561 |
| 359 | Ga0495607_0006478 | 3300046501 | Bacteria | 8235 |
| 360 | Ga0495607_0008162 | 3300046501 | Bacteria | 7177 |
| 361 | Ga0495607_0011677 | 3300046501 | Bacteria | 5833 |
| 362 | Ga0495607_0013881 | 3300046501 | Bacteria | 5264 |
| 363 | Ga0495607_0014028 | 3300046501 | Bacteria | 5231 |
| 364 | Ga0495607_0014483 | 3300046501 | Bacteria | 5127 |
| 365 | Ga0495607_0018956 | 3300046501 | Bacteria | 4375 |
| 366 | Ga0495607_0025339 | 3300046501 | Bacteria | 3690 |
| 367 | Ga0495607_0047224 | 3300046501 | Bacteria | 2524 |
| 368 | Ga0495607_0080931 | 3300046501 | Bacteria | 1784 |
| 369 | Ga0495583_0000119 | 3300046506 | Bacteria | 133447 |
| 370 | Ga0495583_0001037 | 3300046506 | Bacteria | 31392 |
| 371 | Ga0495583_0001346 | 3300046506 | Bacteria | 25457 |
| 372 | Ga0495583_0001911 | 3300046506 | Bacteria | 19262 |
| 373 | Ga0495583_0004301 | 3300046506 | Bacteria | 10295 |
| 374 | Ga0495583_0004613 | 3300046506 | Bacteria | 9744 |
| 375 | Ga0495583_0005862 | 3300046506 | Bacteria | 8188 |
| 376 | Ga0495583_0006437 | 3300046506 | Bacteria | 7680 |
| 377 | Ga0495583_0007028 | 3300046506 | Bacteria | 7198 |
| 378 | Ga0495583_0010347 | 3300046506 | Bacteria | 5446 |
| 379 | Ga0495583_0016846 | 3300046506 | Bacteria | 3906 |
| 380 | Ga0495583_0030615 | 3300046506 | Bacteria | 2618 |
| 381 | Ga0495583_0037187 | 3300046506 | Bacteria | 2309 |
| 382 | Ga0495583_0053960 | 3300046506 | Bacteria | 1822 |
| 383 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 384 | Ga0495606_0000156 | 3300046507 | Bacteria | 118821 |
| 385 | Ga0495606_0000500 | 3300046507 | Bacteria | 63908 |
| 386 | Ga0495606_0000924 | 3300046507 | Bacteria | 43266 |
| 387 | Ga0495606_0001158 | 3300046507 | Bacteria | 37308 |
| 388 | Ga0495606_0001576 | 3300046507 | Bacteria | 29890 |
| 389 | Ga0495606_0001948 | 3300046507 | Bacteria | 25504 |
| 390 | Ga0495606_0005955 | 3300046507 | Bacteria | 11442 |
| 391 | Ga0495606_0043260 | 3300046507 | Bacteria | 3005 |
| 392 | Ga0495606_0062724 | 3300046507 | Bacteria | 2371 |
| 393 | Ga0495606_0171348 | 3300046507 | Bacteria | 1259 |
| 394 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 395 | Ga0495610_0000798 | 3300046512 | Bacteria | 29546 |
| 396 | Ga0495610_0003717 | 3300046512 | Bacteria | 11679 |
| 397 | Ga0495610_0008898 | 3300046512 | Bacteria | 6428 |
| 398 | Ga0495610_0014886 | 3300046512 | Bacteria | 4548 |
| 399 | Ga0495610_0017344 | 3300046512 | Bacteria | 4108 |
| 400 | Ga0495610_0020972 | 3300046512 | Bacteria | 3606 |
| 401 | Ga0495610_0034419 | 3300046512 | Bacteria | 2609 |
| 402 | Ga0495610_0037766 | 3300046512 | Bacteria | 2455 |
| 403 | Ga0495610_0045222 | 3300046512 | Bacteria | 2179 |
| 404 | Ga0495610_0124398 | 3300046512 | Bacteria | 1126 |
| 405 | Ga0495616_0005612 | 3300046513 | Bacteria | 7678 |
| 406 | Ga0495616_0009688 | 3300046513 | Bacteria | 5616 |
| 407 | Ga0495616_0011654 | 3300046513 | Bacteria | 5029 |
| 408 | Ga0495616_0015292 | 3300046513 | Bacteria | 4268 |
| 409 | Ga0495616_0034391 | 3300046513 | Bacteria | 2632 |
| 410 | Ga0495616_0038572 | 3300046513 | Bacteria | 2452 |
| 411 | Ga0495616_0042851 | 3300046513 | Bacteria | 2301 |
| 412 | Ga0495616_0053968 | 3300046513 | Bacteria | 1995 |
| 413 | Ga0495616_0072843 | 3300046513 | Bacteria | 1658 |
| 414 | Ga0495616_0091211 | 3300046513 | Bacteria | 1442 |
| 415 | Ga0495616_0163251 | 3300046513 | Bacteria | 1000 |
| 416 | Ga0495620_0000052 | 3300046515 | Bacteria | 103693 |
| 417 | Ga0495620_0001435 | 3300046515 | Bacteria | 14263 |
| 418 | Ga0495620_0002464 | 3300046515 | Bacteria | 10728 |
| 419 | Ga0495620_0016129 | 3300046515 | Bacteria | 3758 |
| 420 | Ga0495620_0093520 | 3300046515 | Bacteria | 1204 |
| 421 | Ga0495631_0001768 | 3300046518 | Bacteria | 12802 |
| 422 | Ga0495631_0006939 | 3300046518 | Bacteria | 5803 |
| 423 | Ga0495631_0009335 | 3300046518 | Bacteria | 4901 |
| 424 | Ga0495631_0009951 | 3300046518 | Bacteria | 4728 |
| 425 | Ga0495631_0018957 | 3300046518 | Bacteria | 3232 |
| 426 | Ga0495631_0022959 | 3300046518 | Bacteria | 2896 |
| 427 | Ga0495631_0026427 | 3300046518 | Bacteria | 2666 |
| 428 | Ga0495631_0040688 | 3300046518 | Bacteria | 2058 |
| 429 | Ga0495632_0000040 | 3300046519 | Bacteria | 149644 |
| 430 | Ga0495632_0000540 | 3300046519 | Bacteria | 35597 |
| 431 | Ga0495632_0001781 | 3300046519 | Bacteria | 17374 |
| 432 | Ga0495632_0002113 | 3300046519 | Bacteria | 15523 |
| 433 | Ga0495632_0003013 | 3300046519 | Bacteria | 12294 |
| 434 | Ga0495632_0004754 | 3300046519 | Bacteria | 9153 |
| 435 | Ga0495632_0009283 | 3300046519 | Bacteria | 5941 |
| 436 | Ga0495632_0013510 | 3300046519 | Bacteria | 4657 |
| 437 | Ga0495632_0046813 | 3300046519 | Bacteria | 2147 |
| 438 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 439 | Ga0495637_0000346 | 3300046520 | Bacteria | 35690 |
| 440 | Ga0495637_0010752 | 3300046520 | Bacteria | 4414 |
| 441 | Ga0495637_0011359 | 3300046520 | Bacteria | 4281 |
| 442 | Ga0495637_0013284 | 3300046520 | Bacteria | 3912 |
| 443 | Ga0495637_0025972 | 3300046520 | Bacteria | 2635 |
| 444 | Ga0495637_0026217 | 3300046520 | Bacteria | 2619 |
| 445 | Ga0495643_0000282 | 3300046522 | Bacteria | 72496 |
| 446 | Ga0495643_0001593 | 3300046522 | Bacteria | 20127 |
| 447 | Ga0495643_0001686 | 3300046522 | Bacteria | 19265 |
| 448 | Ga0495643_0001974 | 3300046522 | Bacteria | 17209 |
| 449 | Ga0495643_0002102 | 3300046522 | Bacteria | 16487 |
| 450 | Ga0495643_0002637 | 3300046522 | Bacteria | 13917 |
| 451 | Ga0495643_0006661 | 3300046522 | Bacteria | 7571 |
| 452 | Ga0495643_0008756 | 3300046522 | Bacteria | 6379 |
| 453 | Ga0495643_0016451 | 3300046522 | Bacteria | 4343 |
| 454 | Ga0495643_0056561 | 3300046522 | Bacteria | 2093 |
| 455 | Ga0495644_0001218 | 3300046523 | Bacteria | 10523 |
| 456 | Ga0495644_0005269 | 3300046523 | Bacteria | 5053 |
| 457 | Ga0495644_0011094 | 3300046523 | Bacteria | 3473 |
| 458 | Ga0495644_0012232 | 3300046523 | Bacteria | 3299 |
| 459 | Ga0495644_0055915 | 3300046523 | Bacteria | 1482 |
| 460 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 461 | Ga0495648_0000611 | 3300046524 | Bacteria | 38272 |
| 462 | Ga0495648_0003910 | 3300046524 | Bacteria | 12908 |
| 463 | Ga0495648_0008953 | 3300046524 | Bacteria | 7821 |
| 464 | Ga0495648_0011629 | 3300046524 | Bacteria | 6612 |
| 465 | Ga0495648_0014218 | 3300046524 | Bacteria | 5837 |
| 466 | Ga0495648_0030301 | 3300046524 | Bacteria | 3579 |
| 467 | Ga0495648_0042160 | 3300046524 | Bacteria | 2873 |
| 468 | Ga0495648_0058903 | 3300046524 | Bacteria | 2294 |
| 469 | Ga0495648_0064887 | 3300046524 | Bacteria | 2149 |
| 470 | Ga0495648_0089725 | 3300046524 | Bacteria | 1724 |
| 471 | Ga0495648_0184944 | 3300046524 | Bacteria | 1056 |
| 472 | Ga0495666_0002189 | 3300046526 | Bacteria | 9736 |
| 473 | Ga0495642_0000710 | 3300046528 | Bacteria | 16583 |
| 474 | Ga0495642_0004317 | 3300046528 | Bacteria | 5521 |
| 475 | Ga0495642_0005367 | 3300046528 | Bacteria | 4917 |
| 476 | Ga0495642_0006326 | 3300046528 | Bacteria | 4540 |
| 477 | Ga0495642_0007109 | 3300046528 | Bacteria | 4292 |
| 478 | Ga0495642_0008224 | 3300046528 | Bacteria | 3990 |
| 479 | Ga0495642_0020914 | 3300046528 | Bacteria | 2572 |
| 480 | Ga0495642_0030059 | 3300046528 | Bacteria | 2172 |
| 481 | Ga0495642_0036727 | 3300046528 | Bacteria | 1980 |
| 482 | Ga0495642_0053658 | 3300046528 | Bacteria | 1661 |
| 483 | Ga0495654_0003846 | 3300046530 | Bacteria | 9067 |
| 484 | Ga0495654_0008721 | 3300046530 | Bacteria | 5585 |
| 485 | Ga0495654_0011039 | 3300046530 | Bacteria | 4905 |
| 486 | Ga0495654_0027659 | 3300046530 | Bacteria | 2905 |
| 487 | Ga0495654_0029439 | 3300046530 | Bacteria | 2800 |
| 488 | Ga0495654_0032023 | 3300046530 | Bacteria | 2666 |
| 489 | Ga0495654_0040385 | 3300046530 | Bacteria | 2325 |
| 490 | Ga0495654_0041430 | 3300046530 | Bacteria | 2290 |
| 491 | Ga0495665_0178464 | 3300046531 | Bacteria | 1104 |
| 492 | Ga0495586_0090024 | 3300046535 | Bacteria | 1694 |
| 493 | Ga0495586_0103417 | 3300046535 | Bacteria | 1582 |
| 494 | Ga0495609_0000096 | 3300046538 | Bacteria | 104135 |
| 495 | Ga0495609_0000106 | 3300046538 | Bacteria | 98302 |
| 496 | Ga0495609_0000164 | 3300046538 | Bacteria | 69576 |
| 497 | Ga0495609_0000401 | 3300046538 | Bacteria | 36473 |
| 498 | Ga0495609_0000783 | 3300046538 | Bacteria | 23759 |
| 499 | Ga0495609_0006196 | 3300046538 | Bacteria | 6150 |
| 500 | Ga0495609_0012497 | 3300046538 | Bacteria | 4027 |
| 501 | Ga0495609_0017746 | 3300046538 | Bacteria | 3302 |
| 502 | Ga0495609_0018943 | 3300046538 | Bacteria | 3188 |
| 503 | Ga0495609_0057557 | 3300046538 | Bacteria | 1720 |
| 504 | Ga0495609_0076875 | 3300046538 | Bacteria | 1462 |
| 505 | Ga0495609_0077675 | 3300046538 | Bacteria | 1453 |
| 506 | Ga0495621_0019608 | 3300046539 | Bacteria | 2210 |
| 507 | Ga0495597_0000726 | 3300046542 | Bacteria | 26335 |
| 508 | Ga0495597_0001884 | 3300046542 | Bacteria | 14308 |
| 509 | Ga0495597_0004773 | 3300046542 | Bacteria | 7329 |
| 510 | Ga0495597_0007749 | 3300046542 | Bacteria | 5426 |
| 511 | Ga0495597_0035118 | 3300046542 | Bacteria | 2262 |
| 512 | Ga0495597_0054866 | 3300046542 | Bacteria | 1749 |
| 513 | Ga0495597_0080369 | 3300046542 | Bacteria | 1395 |
| 514 | Ga0495597_0122875 | 3300046542 | Bacteria | 1081 |
| 515 | Ga0495645_0032588 | 3300046543 | Bacteria | 3802 |
| 516 | Ga0495645_0175708 | 3300046543 | Bacteria | 1471 |
| 517 | Ga0495622_0000087 | 3300046557 | Bacteria | 82912 |
| 518 | Ga0495622_0002777 | 3300046557 | Bacteria | 8362 |
| 519 | Ga0495622_0021426 | 3300046557 | Bacteria | 3008 |
| 520 | Ga0495633_0000171 | 3300046558 | Bacteria | 86031 |
| 521 | Ga0495633_0000188 | 3300046558 | Bacteria | 80806 |
| 522 | Ga0495633_0001420 | 3300046558 | Bacteria | 18628 |
| 523 | Ga0495633_0003725 | 3300046558 | Bacteria | 10039 |
| 524 | Ga0495633_0007930 | 3300046558 | Bacteria | 6053 |
| 525 | Ga0495633_0009859 | 3300046558 | Bacteria | 5250 |
| 526 | Ga0495633_0011990 | 3300046558 | Bacteria | 4633 |
| 527 | Ga0495633_0012148 | 3300046558 | Bacteria | 4594 |
| 528 | Ga0495633_0013787 | 3300046558 | Bacteria | 4246 |
| 529 | Ga0495633_0020207 | 3300046558 | Bacteria | 3353 |
| 530 | Ga0495633_0035964 | 3300046558 | Bacteria | 2375 |
| 531 | Ga0495633_0102999 | 3300046558 | Bacteria | 1325 |
| 532 | Ga0495656_0006134 | 3300046615 | Bacteria | 4197 |
| 533 | Ga0495656_0038760 | 3300046615 | Bacteria | 1976 |
| 534 | Ga0495668_0000185 | 3300046616 | Bacteria | 92731 |
| 535 | Ga0495668_0000363 | 3300046616 | Bacteria | 60009 |
| 536 | Ga0495668_0001751 | 3300046616 | Bacteria | 19890 |
| 537 | Ga0495668_0003117 | 3300046616 | Bacteria | 12810 |
| 538 | Ga0495668_0003629 | 3300046616 | Bacteria | 11430 |
| 539 | Ga0495668_0007464 | 3300046616 | Bacteria | 6986 |
| 540 | Ga0495668_0010202 | 3300046616 | Bacteria | 5707 |
| 541 | Ga0495668_0014738 | 3300046616 | Bacteria | 4577 |
| 542 | Ga0495668_0018078 | 3300046616 | Bacteria | 4079 |
| 543 | Ga0495668_0045422 | 3300046616 | Bacteria | 2442 |
| 544 | Ga0495668_0047075 | 3300046616 | Bacteria | 2394 |
| 545 | Ga0495668_0076908 | 3300046616 | Bacteria | 1832 |
| 546 | Ga0495668_0086579 | 3300046616 | Bacteria | 1718 |
| 547 | Ga0495611_0000526 | 3300046648 | Bacteria | 22757 |
| 548 | Ga0495611_0002775 | 3300046648 | Bacteria | 7857 |
| 549 | Ga0495611_0003272 | 3300046648 | Bacteria | 7159 |
| 550 | Ga0495611_0019963 | 3300046648 | Bacteria | 2881 |
| 551 | Ga0495611_0030761 | 3300046648 | Bacteria | 2361 |
| 552 | Ga0495611_0045229 | 3300046648 | Bacteria | 1971 |
| 553 | Ga0495611_0057585 | 3300046648 | Bacteria | 1761 |
| 554 | Ga0495611_0079017 | 3300046648 | Bacteria | 1510 |
| 555 | Ga0495625_0000050 | 3300046660 | Bacteria | 197065 |
| 556 | Ga0495625_0000164 | 3300046660 | Bacteria | 103037 |
| 557 | Ga0495625_0000372 | 3300046660 | Bacteria | 68695 |
| 558 | Ga0495625_0043244 | 3300046660 | Bacteria | 3268 |
| 559 | Ga0495625_0057367 | 3300046660 | Bacteria | 2769 |
| 560 | Ga0495625_0072838 | 3300046660 | Bacteria | 2409 |
| 561 | Ga0495625_0093704 | 3300046660 | Bacteria | 2073 |
| 562 | Ga0495625_0094147 | 3300046660 | Bacteria | 2067 |
| 563 | Ga0495625_0151063 | 3300046660 | Bacteria | 1561 |
| 564 | Ga0495625_0164871 | 3300046660 | Bacteria | 1482 |
| 565 | Ga0495625_0167763 | 3300046660 | Bacteria | 1467 |
| 566 | Ga0495635_0005894 | 3300046663 | Bacteria | 8543 |
| 567 | Ga0495659_0013305 | 3300046664 | Bacteria | 2679 |
| 568 | Ga0495661_0000164 | 3300046665 | Bacteria | 78742 |
| 569 | Ga0495661_0000309 | 3300046665 | Bacteria | 55308 |
| 570 | Ga0495661_0000614 | 3300046665 | Bacteria | 36352 |
| 571 | Ga0495661_0002216 | 3300046665 | Bacteria | 15128 |
| 572 | Ga0495661_0002296 | 3300046665 | Bacteria | 14763 |
| 573 | Ga0495661_0010755 | 3300046665 | Bacteria | 6230 |
| 574 | Ga0495661_0011758 | 3300046665 | Bacteria | 5929 |
| 575 | Ga0495661_0022220 | 3300046665 | Bacteria | 4127 |
| 576 | Ga0495661_0040413 | 3300046665 | Bacteria | 2892 |
| 577 | Ga0495661_0043635 | 3300046665 | Bacteria | 2755 |
| 578 | Ga0495661_0080843 | 3300046665 | Bacteria | 1874 |
| 579 | Ga0495661_0106905 | 3300046665 | Bacteria | 1565 |
| 580 | Ga0495661_0113293 | 3300046665 | Bacteria | 1508 |
| 581 | Ga0495661_0116795 | 3300046665 | Bacteria | 1479 |
| 582 | Ga0495661_0187070 | 3300046665 | Bacteria | 1093 |
| 583 | Ga0495661_0201940 | 3300046665 | Bacteria | 1040 |
| 584 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 585 | Ga0495588_0039682 | 3300046674 | Bacteria | 2399 |
| 586 | Ga0495588_0137390 | 3300046674 | Bacteria | 1290 |
| 587 | Ga0495669_0000098 | 3300046684 | Bacteria | 54514 |
| 588 | Ga0495669_0003738 | 3300046684 | Bacteria | 6259 |
| 589 | Ga0495669_0004576 | 3300046684 | Bacteria | 5725 |
| 590 | Ga0495669_0005091 | 3300046684 | Bacteria | 5471 |
| 591 | Ga0495669_0016763 | 3300046684 | Bacteria | 3141 |
| 592 | Ga0495669_0029797 | 3300046684 | Bacteria | 2394 |
| 593 | Ga0495669_0134013 | 3300046684 | Bacteria | 1167 |
| 594 | Ga0495669_0135256 | 3300046684 | Bacteria | 1162 |
| 595 | Ga0495613_0117145 | 3300046689 | Bacteria | 1915 |
| 596 | Ga0495670_0005657 | 3300046691 | Bacteria | 6127 |
| 597 | Ga0495670_0013792 | 3300046691 | Bacteria | 3974 |
| 598 | Ga0495670_0041694 | 3300046691 | Bacteria | 2290 |
| 599 | Ga0495670_0044741 | 3300046691 | Bacteria | 2210 |
| 600 | Ga0495670_0051685 | 3300046691 | Bacteria | 2057 |
| 601 | Ga0495670_0128413 | 3300046691 | Bacteria | 1320 |
| 602 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 603 | Ga0495671_0005249 | 3300046692 | Bacteria | 7607 |
| 604 | Ga0495671_0010836 | 3300046692 | Bacteria | 5039 |
| 605 | Ga0495671_0025089 | 3300046692 | Bacteria | 3100 |
| 606 | Ga0495671_0037701 | 3300046692 | Bacteria | 2443 |
| 607 | Ga0495671_0092472 | 3300046692 | Bacteria | 1480 |
| 608 | Ga0495649_0001815 | 3300046694 | Bacteria | 15676 |
| 609 | Ga0495649_0002551 | 3300046694 | Bacteria | 12760 |
| 610 | Ga0495649_0002569 | 3300046694 | Bacteria | 12714 |
| 611 | Ga0495649_0009456 | 3300046694 | Bacteria | 5793 |
| 612 | Ga0495649_0013356 | 3300046694 | Bacteria | 4738 |
| 613 | Ga0495649_0034656 | 3300046694 | Bacteria | 2777 |
| 614 | Ga0495649_0040018 | 3300046694 | Bacteria | 2568 |
| 615 | Ga0495649_0043028 | 3300046694 | Bacteria | 2466 |
| 616 | Ga0495649_0046819 | 3300046694 | Bacteria | 2354 |
| 617 | Ga0495649_0065045 | 3300046694 | Bacteria | 1957 |
| 618 | Ga0495649_0065269 | 3300046694 | Bacteria | 1954 |
| 619 | Ga0495649_0066415 | 3300046694 | Bacteria | 1936 |
| 620 | Ga0495649_0122810 | 3300046694 | Bacteria | 1372 |
| 621 | Ga0495649_0166040 | 3300046694 | Bacteria | 1156 |
| 622 | Ga0495589_0000036 | 3300046794 | Bacteria | 153299 |
| 623 | Ga0495589_0000092 | 3300046794 | Bacteria | 85372 |
| 624 | Ga0495589_0004004 | 3300046794 | Bacteria | 7901 |
| 625 | Ga0495589_0005614 | 3300046794 | Bacteria | 6615 |
| 626 | Ga0495589_0008837 | 3300046794 | Bacteria | 5240 |
| 627 | Ga0495589_0038033 | 3300046794 | Bacteria | 2410 |
| 628 | Ga0495589_0038115 | 3300046794 | Bacteria | 2407 |
| 629 | Ga0495589_0062376 | 3300046794 | Bacteria | 1828 |
| 630 | Ga0495660_0000117 | 3300046810 | Bacteria | 85237 |
| 631 | Ga0495660_0000215 | 3300046810 | Bacteria | 58954 |
| 632 | Ga0495660_0002403 | 3300046810 | Bacteria | 11946 |
| 633 | Ga0495660_0009049 | 3300046810 | Bacteria | 5815 |
| 634 | Ga0495660_0014900 | 3300046810 | Bacteria | 4496 |
| 635 | Ga0495660_0015540 | 3300046810 | Bacteria | 4396 |
| 636 | Ga0495660_0015664 | 3300046810 | Bacteria | 4378 |
| 637 | Ga0495660_0015865 | 3300046810 | Bacteria | 4347 |
| 638 | Ga0495660_0018174 | 3300046810 | Bacteria | 4042 |
| 639 | Ga0495660_0044048 | 3300046810 | Bacteria | 2457 |
| 640 | Ga0495660_0088433 | 3300046810 | Bacteria | 1614 |
| 641 | Ga0495660_0137782 | 3300046810 | Bacteria | 1217 |
| 642 | Ga0495660_0204384 | 3300046810 | Bacteria | 941 |
| 643 | Ga0495581_0032837 | 3300047315 | Bacteria | 3004 |
| 644 | Ga0495636_0082485 | 3300047318 | Bacteria | 1386 |
| 645 | Ga0495672_0000086 | 3300047320 | Bacteria | 155010 |
| 646 | Ga0495672_0000187 | 3300047320 | Bacteria | 89789 |
| 647 | Ga0495672_0002132 | 3300047320 | Bacteria | 18542 |
| 648 | Ga0495672_0003870 | 3300047320 | Bacteria | 12583 |
| 649 | Ga0495672_0004394 | 3300047320 | Bacteria | 11565 |
| 650 | Ga0495672_0051155 | 3300047320 | Bacteria | 2435 |
| 651 | Ga0495672_0103501 | 3300047320 | Bacteria | 1540 |
| 652 | Ga0495672_0110252 | 3300047320 | Bacteria | 1478 |
| 653 | Ga0495676_0000035 | 3300047321 | Bacteria | 120519 |
| 654 | Ga0495676_0000377 | 3300047321 | Bacteria | 36426 |
| 655 | Ga0495676_0017698 | 3300047321 | Bacteria | 6293 |
| 656 | Ga0495680_0080561 | 3300047322 | Bacteria | 2460 |
| 657 | Ga0495683_0000080 | 3300047323 | Bacteria | 95388 |
| 658 | Ga0495683_0007215 | 3300047323 | Bacteria | 6032 |
| 659 | Ga0495683_0011985 | 3300047323 | Bacteria | 4555 |
| 660 | Ga0495683_0063128 | 3300047323 | Bacteria | 1830 |
| 661 | Ga0495683_0141247 | 3300047323 | Bacteria | 1128 |
| 662 | Ga0495683_0163446 | 3300047323 | Bacteria | 1028 |
| 663 | Ga0495687_000074 | 3300047443 | Bacteria | 153464 |
| 664 | Ga0495687_000154 | 3300047443 | Bacteria | 104740 |
| 665 | Ga0495687_001753 | 3300047443 | Bacteria | 19181 |
| 666 | Ga0495687_002544 | 3300047443 | Bacteria | 14438 |
| 667 | Ga0495687_002568 | 3300047443 | Bacteria | 14327 |
| 668 | Ga0495687_006358 | 3300047443 | Bacteria | 7262 |
| 669 | Ga0495675_0022159 | 3300047444 | Bacteria | 4048 |
| 670 | Ga0495677_0000037 | 3300047445 | Bacteria | 78595 |
| 671 | Ga0495677_0002039 | 3300047445 | Bacteria | 8056 |
| 672 | Ga0495677_0003775 | 3300047445 | Bacteria | 5857 |
| 673 | Ga0495677_0004085 | 3300047445 | Bacteria | 5636 |
| 674 | Ga0495677_0037715 | 3300047445 | Bacteria | 1765 |
| 675 | Ga0495679_000299 | 3300047446 | Bacteria | 39909 |
| 676 | Ga0495679_002040 | 3300047446 | Bacteria | 10669 |
| 677 | Ga0495679_003539 | 3300047446 | Bacteria | 7464 |
| 678 | Ga0495679_007583 | 3300047446 | Bacteria | 4510 |
| 679 | Ga0495685_002172 | 3300047447 | Bacteria | 6095 |
| 680 | Ga0495685_025478 | 3300047447 | Bacteria | 2034 |
| 681 | Ga0495685_037677 | 3300047447 | Bacteria | 1657 |
| 682 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 683 | Ga0495673_0000097 | 3300047469 | Bacteria | 182247 |
| 684 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 685 | Ga0495673_0000395 | 3300047469 | Bacteria | 51238 |
| 686 | Ga0495673_0000396 | 3300047469 | Bacteria | 51189 |
| 687 | Ga0495673_0006224 | 3300047469 | Bacteria | 7059 |
| 688 | Ga0495673_0006451 | 3300047469 | Bacteria | 6889 |
| 689 | Ga0495681_0002173 | 3300047470 | Bacteria | 14206 |
| 690 | Ga0495681_0007151 | 3300047470 | Bacteria | 7181 |
| 691 | Ga0495681_0008429 | 3300047470 | Bacteria | 6468 |
| 692 | Ga0495681_0010334 | 3300047470 | Bacteria | 5651 |
| 693 | Ga0495681_0011942 | 3300047470 | Bacteria | 5132 |
| 694 | Ga0495681_0012679 | 3300047470 | Bacteria | 4939 |
| 695 | Ga0495681_0012695 | 3300047470 | Bacteria | 4934 |
| 696 | Ga0495681_0031686 | 3300047470 | Bacteria | 2672 |
| 697 | Ga0495681_0037048 | 3300047470 | Bacteria | 2406 |
| 698 | Ga0495681_0041881 | 3300047470 | Bacteria | 2220 |
| 699 | Ga0495681_0067139 | 3300047470 | Bacteria | 1635 |
| 700 | Ga0495681_0110414 | 3300047470 | Bacteria | 1191 |
| 701 | Ga0495681_0121841 | 3300047470 | Bacteria | 1118 |
| 702 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 703 | Ga0495686_0000987 | 3300047472 | Bacteria | 34762 |
| 704 | Ga0495686_0001906 | 3300047472 | Bacteria | 20827 |
| 705 | Ga0495686_0008973 | 3300047472 | Bacteria | 7258 |
| 706 | Ga0495686_0010237 | 3300047472 | Bacteria | 6679 |
| 707 | Ga0495686_0033660 | 3300047472 | Bacteria | 3307 |
| 708 | Ga0495686_0045075 | 3300047472 | Bacteria | 2791 |
| 709 | Ga0495686_0062495 | 3300047472 | Bacteria | 2309 |
| 710 | Ga0495593_0011137 | 3300047673 | Bacteria | 5174 |
| 711 | Ga0495614_0003662 | 3300048089 | Bacteria | 6892 |
| 712 | Ga0495614_0033016 | 3300048089 | Bacteria | 2227 |
| 713 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 714 | Ga0495626_0000600 | 3300048091 | Bacteria | 35252 |
| 715 | Ga0495626_0004120 | 3300048091 | Bacteria | 9030 |
| 716 | Ga0495626_0007465 | 3300048091 | Bacteria | 6084 |
| 717 | Ga0495626_0014843 | 3300048091 | Bacteria | 4004 |
| 718 | Ga0495626_0017504 | 3300048091 | Bacteria | 3615 |
| 719 | Ga0495626_0048741 | 3300048091 | Bacteria | 1964 |
| 720 | Ga0495626_0064012 | 3300048091 | Bacteria | 1666 |
| 721 | Ga0495626_0087447 | 3300048091 | Bacteria | 1375 |
| 722 | Ga0495626_0142073 | 3300048091 | Bacteria | 1017 |
| 723 | Ga0496100_0006427 | 3300048903 | Bacteria | 6406 |
| 724 | Ga0496100_0022301 | 3300048903 | Bacteria | 3831 |
| 725 | Ga0496100_0089620 | 3300048903 | Bacteria | 2096 |
| 726 | Ga0496101_0015959 | 3300048904 | Bacteria | 5067 |
| 727 | Ga0496101_0257198 | 3300048904 | Bacteria | 1361 |
| 728 | Ga0496102_0000152 | 3300048905 | Bacteria | 94042 |
| 729 | Ga0496102_0001102 | 3300048905 | Bacteria | 24871 |
| 730 | Ga0496102_0015513 | 3300048905 | Bacteria | 6636 |
| 731 | Ga0496102_0506840 | 3300048905 | Bacteria | 1129 |
| 732 | Ga0496103_0002518 | 3300048906 | Bacteria | 11480 |
| 733 | Ga0496103_0070892 | 3300048906 | Bacteria | 2180 |
| 734 | Ga0496103_0218562 | 3300048906 | Bacteria | 1226 |
| 735 | Ga0496104_0142955 | 3300048907 | Bacteria | 2299 |
| 736 | Ga0496104_0522943 | 3300048907 | Bacteria | 1097 |
| 737 | Ga0496105_0119217 | 3300048908 | Bacteria | 2177 |
| 738 | Ga0496106_0069488 | 3300048909 | Bacteria | 2688 |
| 739 | Ga0496106_0338308 | 3300048909 | Bacteria | 1208 |
| 740 | Ga0496107_0017162 | 3300048910 | Bacteria | 5092 |
| 741 | Ga0496107_0128885 | 3300048910 | Bacteria | 1867 |
| 742 | Ga0496108_0082384 | 3300048911 | Bacteria | 2728 |
| 743 | Ga0496108_0128925 | 3300048911 | Bacteria | 2174 |
| 744 | Ga0496109_0056995 | 3300048912 | Bacteria | 3565 |
| 745 | Ga0496109_0158650 | 3300048912 | Bacteria | 2119 |
| 746 | Ga0496109_0255555 | 3300048912 | Bacteria | 1650 |
| 747 | Ga0496110_0081513 | 3300048913 | Bacteria | 2884 |
| 748 | Ga0496110_0083667 | 3300048913 | Bacteria | 2847 |
| 749 | Ga0496110_0334110 | 3300048913 | Bacteria | 1380 |
| 750 | Ga0496111_0015421 | 3300048914 | Bacteria | 5245 |
| 751 | Ga0496112_0622091 | 3300048915 | Bacteria | 1011 |
| 752 | Ga0496113_0094541 | 3300048916 | Bacteria | 2309 |
| 753 | Ga0496114_0001680 | 3300048917 | Bacteria | 16792 |
| 754 | Ga0496114_0003874 | 3300048917 | Bacteria | 11531 |
| 755 | Ga0496114_0172339 | 3300048917 | Bacteria | 1886 |
| 756 | Ga0496114_0287696 | 3300048917 | Bacteria | 1450 |
| 757 | Ga0496116_0003215 | 3300048919 | Bacteria | 16308 |
| 758 | Ga0496116_0024112 | 3300048919 | Bacteria | 4509 |
| 759 | Ga0496116_0038067 | 3300048919 | Bacteria | 3345 |
| 760 | Ga0496116_0038438 | 3300048919 | Bacteria | 3323 |
| 761 | Ga0496117_0000056 | 3300048920 | Bacteria | 271417 |
| 762 | Ga0496117_0001733 | 3300048920 | Bacteria | 30190 |
| 763 | Ga0496117_0001893 | 3300048920 | Bacteria | 28078 |
| 764 | Ga0496117_0003106 | 3300048920 | Bacteria | 19860 |
| 765 | Ga0496117_0054998 | 3300048920 | Bacteria | 2784 |
| 766 | Ga0496118_0000047 | 3300048921 | Bacteria | 271417 |
| 767 | Ga0496118_0002944 | 3300048921 | Bacteria | 22125 |
| 768 | Ga0496118_0005238 | 3300048921 | Bacteria | 14828 |
| 769 | Ga0496118_0038630 | 3300048921 | Bacteria | 3822 |
| 770 | Ga0496118_0039107 | 3300048921 | Bacteria | 3790 |
| 771 | Ga0496118_0166426 | 3300048921 | Bacteria | 1354 |
| 772 | Ga0496119_0000199 | 3300048922 | Bacteria | 84539 |
| 773 | Ga0496119_0045772 | 3300048922 | Bacteria | 2740 |
| 774 | Ga0496120_0000840 | 3300048923 | Bacteria | 43691 |
| 775 | Ga0496121_0001906 | 3300048924 | Bacteria | 33394 |
| 776 | Ga0496121_0003376 | 3300048924 | Bacteria | 22880 |
| 777 | Ga0496121_0009023 | 3300048924 | Bacteria | 11554 |
| 778 | Ga0496121_0016973 | 3300048924 | Bacteria | 7476 |
| 779 | Ga0496121_0021646 | 3300048924 | Bacteria | 6287 |
| 780 | Ga0496121_0023195 | 3300048924 | Bacteria | 5988 |
| 781 | Ga0496121_0033480 | 3300048924 | Bacteria | 4649 |
| 782 | Ga0496121_0091303 | 3300048924 | Bacteria | 2378 |
| 783 | Ga0496121_0113056 | 3300048924 | Bacteria | 2067 |
| 784 | Ga0496121_0128826 | 3300048924 | Bacteria | 1898 |
| 785 | Ga0496121_0146500 | 3300048924 | Bacteria | 1744 |
| 786 | Ga0496122_0000298 | 3300048925 | Bacteria | 109839 |
| 787 | Ga0496122_0001315 | 3300048925 | Bacteria | 40732 |
| 788 | Ga0496122_0006167 | 3300048925 | Bacteria | 13940 |
| 789 | Ga0496122_0019287 | 3300048925 | Bacteria | 6239 |
| 790 | Ga0496122_0030520 | 3300048925 | Bacteria | 4514 |
| 791 | Ga0496122_0031942 | 3300048925 | Bacteria | 4365 |
| 792 | Ga0496122_0032248 | 3300048925 | Bacteria | 4337 |
| 793 | Ga0496122_0062963 | 3300048925 | Bacteria | 2712 |
| 794 | Ga0496122_0125750 | 3300048925 | Bacteria | 1641 |
| 795 | Ga0496123_0000080 | 3300048926 | Bacteria | 190247 |
| 796 | Ga0496123_0000851 | 3300048926 | Bacteria | 48703 |
| 797 | Ga0496123_0001824 | 3300048926 | Bacteria | 27989 |
| 798 | Ga0496123_0015045 | 3300048926 | Bacteria | 6371 |
| 799 | Ga0496123_0018392 | 3300048926 | Bacteria | 5562 |
| 800 | Ga0496123_0019006 | 3300048926 | Bacteria | 5429 |
| 801 | Ga0496123_0028518 | 3300048926 | Bacteria | 4130 |
| 802 | Ga0496123_0067313 | 3300048926 | Bacteria | 2263 |
| 803 | Ga0496123_0106297 | 3300048926 | Bacteria | 1617 |
| 804 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 805 | Ga0496124_0001065 | 3300048927 | Bacteria | 43363 |
| 806 | Ga0496124_0006805 | 3300048927 | Bacteria | 12341 |
| 807 | Ga0496124_0022612 | 3300048927 | Bacteria | 5758 |
| 808 | Ga0496124_0026320 | 3300048927 | Bacteria | 5246 |
| 809 | Ga0496124_0028685 | 3300048927 | Bacteria | 4975 |
| 810 | Ga0496124_0047187 | 3300048927 | Bacteria | 3686 |
| 811 | Ga0496124_0061207 | 3300048927 | Bacteria | 3156 |
| 812 | Ga0496124_0062130 | 3300048927 | Bacteria | 3127 |
| 813 | Ga0496124_0062912 | 3300048927 | Bacteria | 3103 |
| 814 | Ga0496124_0115756 | 3300048927 | Bacteria | 2150 |
| 815 | Ga0496124_0145268 | 3300048927 | Bacteria | 1867 |
| 816 | Ga0496124_0151010 | 3300048927 | Bacteria | 1822 |
| 817 | Ga0496125_0000240 | 3300048928 | Bacteria | 112092 |
| 818 | Ga0496125_0000826 | 3300048928 | Bacteria | 49960 |
| 819 | Ga0496125_0010518 | 3300048928 | Bacteria | 9356 |
| 820 | Ga0496125_0024295 | 3300048928 | Bacteria | 5576 |
| 821 | Ga0496125_0026908 | 3300048928 | Bacteria | 5224 |
| 822 | Ga0496125_0071692 | 3300048928 | Bacteria | 2705 |
| 823 | Ga0496125_0092889 | 3300048928 | Bacteria | 2254 |
| 824 | Ga0496125_0102010 | 3300048928 | Bacteria | 2109 |
| 825 | Ga0496126_0025933 | 3300048929 | Bacteria | 5628 |
| 826 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 827 | Ga0495678_000226 | 3300049459 | Bacteria | 65083 |
| 828 | Ga0495678_001072 | 3300049459 | Bacteria | 23117 |
| 829 | Ga0495678_003443 | 3300049459 | Bacteria | 9805 |
| 830 | Ga0495678_003543 | 3300049459 | Bacteria | 9574 |
| 831 | Ga0495678_003967 | 3300049459 | Bacteria | 8848 |
| 832 | Ga0495678_005143 | 3300049459 | Bacteria | 7335 |
| 833 | Ga0495678_009918 | 3300049459 | Bacteria | 4669 |
| 834 | Ga0495678_028661 | 3300049459 | Bacteria | 2347 |
| 835 | Ga0495678_030309 | 3300049459 | Bacteria | 2264 |
| 836 | Ga0495678_038882 | 3300049459 | Bacteria | 1921 |
| 837 | Ga0495678_084503 | 3300049459 | Bacteria | 1132 |
| 838 | Ga0495682_0000501 | 3300049460 | Bacteria | 27136 |
| 839 | Ga0495682_0002360 | 3300049460 | Bacteria | 8972 |
| 840 | Ga0495682_0003356 | 3300049460 | Bacteria | 7146 |
| 841 | Ga0495682_0009849 | 3300049460 | Bacteria | 3719 |
| 842 | Ga0495682_0038006 | 3300049460 | Bacteria | 1769 |
| 843 | Ga0501034_0000330 | 3300049571 | Bacteria | 82994 |
| 844 | Ga0501037_0262536 | 3300049573 | Bacteria | 1206 |
| 845 | Ga0501269_000023 | 3300049766 | Bacteria | 53029 |
| 846 | Ga0501035_0003423 | 3300049822 | Bacteria | 15171 |
| 847 | Ga0501044_0579939 | 3300049823 | Bacteria | 1016 |
| 848 | nmdc:mga00v17_90164_c1 | 3300050491 | Bacteria | 1924 |
| 849 | Ga0500594_0004979 | 3300053118 | Bacteria | 2937 |
| 850 | Ga0500618_001435 | 3300053125 | Bacteria | 10601 |
| 851 | Ga0500618_002592 | 3300053125 | Bacteria | 6672 |
| 852 | Ga0500659_0001851 | 3300053135 | Bacteria | 13161 |
| 853 | Ga0500586_000036 | 3300053145 | Bacteria | 23841 |
| 854 | Ga0500586_000610 | 3300053145 | Bacteria | 7269 |
| 855 | Ga0500586_073843 | 3300053145 | Bacteria | 1195 |
| 856 | Ga0500634_0072763 | 3300053161 | Unclassified | 1793 |
| 857 | Ga0466962_0008940 | 3300061719 | Bacteria | 4799 |
| 858 | 2511375170 | 2511231024 | Bacteria | 5835885 |
| 859 | 2519461377 | 2519103095 | Bacteria | 6629912 |
| 860 | 2555245637 | 2554235231 | Bacteria | 5215788 |
| 861 | 2585290843 | 2582581311 | Bacteria | 6763856 |
| 862 | 2599734638 | 2599185239 | Bacteria | 8686614 |
| 863 | 2599745541 | 2599185240 | Bacteria | 7968121 |
| 864 | 2599974342 | 2599185307 | Bacteria | 6194719 |
| 865 | 2600207448 | 2599185355 | Bacteria | 7968906 |
| 866 | 2601671882 | 2600255292 | Bacteria | 6300551 |
| 867 | 2643797745 | 2643221556 | Bacteria | 7251154 |
| 868 | 2644062997 | 2643221609 | Bacteria | 6756331 |
| 869 | 2644074302 | 2643221611 | Bacteria | 6820941 |
| 870 | 2644470473 | 2643221684 | Bacteria | 7145183 |
| 871 | 2676741264 | 2675903129 | Bacteria | 7964495 |
| 872 | 2738829335 | 2738541297 | Bacteria | 6549566 |
| 873 | 2739153131 | 2738541357 | Bacteria | 6549408 |
| 874 | 2739195051 | 2738543003 | Bacteria | 6549560 |
| 875 | 2739246582 | 2738543012 | Bacteria | 7115078 |
| 876 | 2739285929 | 2738543020 | Bacteria | 5718238 |
| 877 | 2739291242 | 2738543021 | Bacteria | 5718241 |
| 878 | 2739321527 | 2738543026 | Bacteria | 6549408 |
| 879 | 2739339917 | 2738543029 | Bacteria | 6549249 |
| 880 | 2739613104 | 2739367655 | Bacteria | 4051151 |
| 881 | 2765585995 | 2765235841 | Bacteria | 6137024 |
| 882 | 2807410309 | 2806310737 | Bacteria | 5751088 |
| 883 | 2807458657 | 2806310745 | Bacteria | 5742165 |
| 884 | 2808969327 | 2808606384 | Bacteria | 8474373 |
| 885 | 2809004158 | 2808606390 | Bacteria | 8476311 |
| 886 | 2816476113 | 2816332133 | Bacteria | 7249298 |
| 887 | 2817258282 | 2816332253 | Bacteria | 6764532 |
| 888 | 2817281304 | 2816332256 | Bacteria | 6891714 |
| 889 | 2817452008 | 2816332286 | Bacteria | 6853759 |
| 890 | 2819634437 | 2818991452 | Bacteria | 8442785 |
| 891 | 2821131484 | 2821131069 | Bacteria | 6108407 |
| 892 | 2834034306 | 2834028612 | Bacteria | 6354979 |
| 893 | 2842714162 | 2842711865 | Bacteria | 7155354 |
| 894 | 2842736145 | 2842733646 | Bacteria | 5716726 |
| 895 | 2857552244 | 2857547612 | Bacteria | 6179999 |
| 896 | 2857554372 | 2857553236 | Bacteria | 6166726 |
| 897 | 2857559975 | 2857558681 | Bacteria | 6617694 |
| 898 | 2857564857 | 2857564685 | Bacteria | 6290584 |
| 899 | 2863426751 | 2863421361 | Bacteria | 7300805 |
| 900 | 2870075226 | 2870068957 | Bacteria | 8925310 |
| 901 | 2885086522 | 2885080285 | Bacteria | 6355622 |
| 902 | 2887376014 | 2887375801 | Bacteria | 5334027 |
| 903 | 2904426140 | 2904424332 | Bacteria | 7633521 |
| 904 | 2904570651 | 2904564687 | Bacteria | 7609577 |
| 905 | 2904577828 | 2904571731 | Bacteria | 7608790 |
| 906 | 2912964445 | 2912963787 | Bacteria | 5646108 |
| 907 | 2919156505 | 2919155634 | Bacteria | 4860545 |
| 908 | 2919478521 | 2919476304 | Bacteria | 5888696 |
| 909 | 2928159003 | 2928157003 | Bacteria | 7522202 |
| 910 | 2928167826 | 2928163908 | Bacteria | 7561269 |
| 911 | 2928178098 | 2928170801 | Bacteria | 8785406 |
| 912 | 2928537983 | 2928536128 | Bacteria | 7657547 |
| 913 | 2929203765 | 2929199973 | Bacteria | 7260745 |
| 914 | 2932415072 | 2932410948 | Bacteria | 6312192 |
| 915 | 2932421280 | 2932416698 | Bacteria | 6315112 |
| 916 | 2939651953 | 2939651529 | Bacteria | 5895393 |
| 917 | 2981992380 | 2981990288 | Bacteria | 7590678 |
| 918 | 3007807128 | 3007803356 | Bacteria | 5931491 |
| 919 | 642419967 | 641736154 | Bacteria | 7689995 |
| 920 | 8018846602 | 8018845410 | Bacteria | 8933938 |
| 921 | 8020810333 | 8020807995 | Bacteria | 6801506 |
| 922 | 8020941768 | 8020938398 | Bacteria | 7472757 |
| 923 | 8020945666 | 8020945358 | Bacteria | 8467355 |
| 924 | 8020958757 | 8020953355 | Bacteria | 7439080 |
| 925 | 8021121668 | 8021120328 | Bacteria | 8782274 |
| 926 | 8039103854 | 8039098773 | Bacteria | 6602928 |
| 927 | 8040167376 | 8040167225 | Bacteria | 6542727 |
| 928 | 8040175387 | 8040173305 | Bacteria | 6827067 |
| 929 | 8047679050 | 8047673197 | Bacteria | 7395230 |
| 930 | 8052495435 | 8052494512 | Bacteria | 5765634 |
| 931 | 8054932792 | 8054929484 | Bacteria | 5599761 |
| 932 | 8055823199 | 8055817908 | Bacteria | 6609162 |
| 933 | 8055882037 | 8055878733 | Bacteria | 5907058 |
| 934 | 8055915937 | 8055909800 | Bacteria | 7278581 |
| 935 | 8056116982 | 8056115690 | Bacteria | 5527654 |
| 936 | 8056121454 | 8056120720 | Bacteria | 5758328 |
| 937 | 8056136612 | 8056131705 | Bacteria | 6107031 |
| 938 | 8056142302 | 8056137416 | Bacteria | 6147080 |
| 939 | Ga0495606_0115166 | |||
| 940 | JGI24739J22299_10004445 | |||
| 941 | JGI24739J22299_10016364 | |||
| 942 | JGI24739J22299_10022427 | |||
| 943 | JGI25150J39212_1012329 | |||
| 944 | rootL2_10032663 | |||
| 945 | rootL2_10034981 | |||
| 946 | rootL2_10066887 | |||
| 947 | rootL2_10207153 | |||
| 948 | rootL2_10332452 | |||
| 949 | rootH1_10137222 | |||
| 950 | Ga0055532_1000682 | |||
| 951 | Ga0055532_1000754 | |||
| 952 | Ga0055532_1001348 | |||
| 953 | Ga0055525_1000009 | |||
| 954 | Ga0055527_1000578 | |||
| 955 | Ga0055527_1000930 | |||
| 956 | Ga0055535_1001502 | |||
| 957 | Ga0055535_1001505 | |||
| 958 | Ga0055542_1001468 | |||
| 959 | Ga0055542_1004495 | |||
| 960 | Ga0055529_1000181 | |||
| 961 | Ga0055529_1000392 | |||
| 962 | Ga0055529_1001827 | |||
| 963 | Ga0055526_1000074 | |||
| 964 | Ga0055526_1000092 | |||
| 965 | Ga0055526_1000729 | |||
| 966 | Ga0055537_1000078 | |||
| 967 | Ga0055524_1000053 | |||
| 968 | Ga0055524_1005701 | |||
| 969 | Ga0055534_1000070 | |||
| 970 | Ga0055534_1000105 | |||
| 971 | Ga0055528_1000224 | |||
| 972 | Ga0055528_1001957 | |||
| 973 | Ga0055541_1009217 | |||
| 974 | Ga0065165_1000677 | |||
| 975 | Ga0065165_1033071 | |||
| 976 | Ga0065704_10072806 | |||
| 977 | Ga0065704_10075896 | |||
| 978 | Ga0070658_10040332 | |||
| 979 | Ga0070670_100001744 | |||
| 980 | Ga0070666_10182737 | |||
| 981 | Ga0070660_100000013 | |||
| 982 | Ga0070660_100161357 | |||
| 983 | Ga0070671_100209294 | |||
| 984 | Ga0070659_100000028 | |||
| 985 | Ga0070667_100034706 | |||
| 986 | Ga0070667_100321030 | |||
| 987 | Ga0070663_100040363 | |||
| 988 | Ga0070678_100023362 | |||
| 989 | Ga0068853_100126047 | |||
| 990 | Ga0070672_100463714 | |||
| 991 | Ga0068855_100057985 | |||
| 992 | Ga0068855_100203278 | |||
| 993 | Ga0070664_100062125 | |||
| 994 | Ga0068852_100067926 | |||
| 995 | Ga0068852_100621619 | |||
| 996 | Ga0068858_100059624 | |||
| 997 | Ga0068860_100173343 | |||
| 998 | Ga0075364_10013194 | |||
| 999 | Ga0075362_10085390 | |||
| 1000 | Ga0075369_10078426 | |||
| 1001 | Ga0099823_1000188 | |||
| 1002 | Ga0079104_1003296 | |||
| 1003 | Ga0099826_10000006 | |||
| 1004 | Ga0105251_10000623 | |||
| 1005 | Ga0105251_10001933 | |||
| 1006 | Ga0105251_10007562 | |||
| 1007 | Ga0105251_10026669 | |||
| 1008 | Ga0105251_10048315 | |||
| 1009 | Ga0105244_10001306 | |||
| 1010 | Ga0105244_10001737 | |||
| 1011 | Ga0105244_10002830 | |||
| 1012 | Ga0105244_10004135 | |||
| 1013 | Ga0105244_10007475 | |||
| 1014 | Ga0105244_10022995 | |||
| 1015 | Ga0105244_10046885 | |||
| 1016 | Ga0105244_10065908 | |||
| 1017 | Ga0105250_10000222 | |||
| 1018 | Ga0105250_10042939 | |||
| 1019 | Ga0105250_10108438 | |||
| 1020 | Ga0105240_10000393 | |||
| 1021 | Ga0105243_10007339 | |||
| 1022 | Ga0105243_10041517 | |||
| 1023 | Ga0105241_10004855 | |||
| 1024 | Ga0105242_10028696 | |||
| 1025 | Ga0105237_10005816 | |||
| 1026 | Ga0105237_10311635 | |||
| 1027 | Ga0105238_10018213 | |||
| 1028 | Ga0105238_10486992 | |||
| 1029 | Ga0105239_10003889 | |||
| 1030 | Ga0157373_10008160 | |||
| 1031 | Ga0157373_10122558 | |||
| 1032 | Ga0157370_10124572 | |||
| 1033 | Ga0157369_10027361 | |||
| 1034 | Ga0157369_10346696 | |||
| 1035 | Ga0163162_10044544 | |||
| 1036 | Ga0157372_10475911 | |||
| 1037 | Ga0157375_10217409 | |||
| 1038 | Ga0157375_10514023 | |||
| 1039 | Ga0182008_10002217 | |||
| 1040 | Ga0182008_10028309 | |||
| 1041 | Ga0182006_1000026 | |||
| 1042 | Ga0182006_1000511 | |||
| 1043 | Ga0182006_1004027 | |||
| 1044 | Ga0182006_1041261 | |||
| 1045 | Ga0182007_10000037 | |||
| 1046 | Ga0182007_10000918 | |||
| 1047 | Ga0182007_10002310 | |||
| 1048 | Ga0182007_10003199 | |||
| 1049 | Ga0182007_10044032 | |||
| 1050 | Ga0182005_1000007 | |||
| 1051 | Ga0182005_1000021 | |||
| 1052 | Ga0182005_1010923 | |||
| 1053 | Ga0183362_10001 | |||
| 1054 | Ga0163161_10031248 | |||
| 1055 | Ga0163161_10044365 | |||
| 1056 | Ga0163161_10062850 | |||
| 1057 | Ga0163161_10065978 | |||
| 1058 | Ga0209566_100293 | |||
| 1059 | Ga0209674_101016 | |||
| 1060 | Ga0209672_100067 | |||
| 1061 | Ga0209672_100079 | |||
| 1062 | Ga0209147_100012 | |||
| 1063 | Ga0209147_100061 | |||
| 1064 | Ga0209147_100107 | |||
| 1065 | Ga0209563_100015 | |||
| 1066 | Ga0209258_100030 | |||
| 1067 | Ga0209258_100340 | |||
| 1068 | Ga0207425_1000192 | |||
| 1069 | Ga0209646_1000010 | |||
| 1070 | Ga0209026_1004971 | |||
| 1071 | Ga0209148_1000022 | |||
| 1072 | Ga0209148_1000439 | |||
| 1073 | Ga0209148_1000957 | |||
| 1074 | Ga0209565_1000035 | |||
| 1075 | Ga0209565_1004074 | |||
| 1076 | Ga0209565_1008777 | |||
| 1077 | Ga0209455_1000024 | |||
| 1078 | Ga0209455_1000037 | |||
| 1079 | Ga0209455_1000243 | |||
| 1080 | Ga0209673_1000006 | |||
| 1081 | Ga0209673_1000021 | |||
| 1082 | Ga0209675_1000005 | |||
| 1083 | Ga0209676_1000805 | |||
| 1084 | Ga0209025_1009132 | |||
| 1085 | Ga0209564_1000009 | |||
| 1086 | Ga0209564_1000033 | |||
| 1087 | Ga0209564_1000083 | |||
| 1088 | Ga0209564_1022670 | |||
| 1089 | Ga0209758_1000227 | |||
| 1090 | Ga0209256_1000035 | |||
| 1091 | Ga0209256_1000322 | |||
| 1092 | Ga0207696_1000022 | |||
| 1093 | Ga0207696_1000265 | |||
| 1094 | Ga0207696_1026989 | |||
| 1095 | Ga0207696_1054074 | |||
| 1096 | Ga0207655_1000162 | |||
| 1097 | Ga0207655_1000383 | |||
| 1098 | Ga0207655_1002794 | |||
| 1099 | Ga0207655_1003043 | |||
| 1100 | Ga0207655_1040598 | |||
| 1101 | Ga0207713_1000238 | |||
| 1102 | Ga0207713_1000481 | |||
| 1103 | Ga0207713_1003042 | |||
| 1104 | Ga0207713_1003804 | |||
| 1105 | Ga0207713_1072423 | |||
| 1106 | Ga0207647_10005613 | |||
| 1107 | Ga0207705_10003154 | |||
| 1108 | Ga0207695_10000255 | |||
| 1109 | Ga0207671_10037053 | |||
| 1110 | Ga0207657_10000017 | |||
| 1111 | Ga0207649_10210127 | |||
| 1112 | Ga0207694_10045738 | |||
| 1113 | Ga0207694_10302920 | |||
| 1114 | Ga0207694_10322750 | |||
| 1115 | Ga0207650_10000276 | |||
| 1116 | Ga0207690_10000009 | |||
| 1117 | Ga0207690_10027008 | |||
| 1118 | Ga0207686_10027759 | |||
| 1119 | Ga0207709_10013448 | |||
| 1120 | Ga0207709_10063090 | |||
| 1121 | Ga0207691_10084306 | |||
| 1122 | Ga0207691_10458002 | |||
| 1123 | Ga0207658_10013681 | |||
| 1124 | Ga0207658_10222442 | |||
| 1125 | Ga0207703_10052595 | |||
| 1126 | Ga0207678_10011303 | |||
| 1127 | Ga0207674_10107181 | |||
| 1128 | Ga0209389_1000002 | |||
| 1129 | Ga0209371_1000128 | |||
| 1130 | Ga0209371_1000409 | |||
| 1131 | Ga0209282_1000003 | |||
| 1132 | Ga0307515_10003602 | |||
| 1133 | Ga0265324_10037821 | |||
| 1134 | Ga0268256_1000152 | |||
| 1135 | Ga0268256_1000350 | |||
| 1136 | Ga0307512_10098188 | |||
| 1137 | Ga0265327_10000777 | |||
| 1138 | Ga0307513_10014794 | |||
| 1139 | Ga0307514_10000408 | |||
| 1140 | Ga0307518_10030063 | |||
| 1141 | Ga0307414_10051354 | |||
| 1142 | Ga0373939_0048876 | |||
| 1143 | Ga0395899_0003015 | |||
| 1144 | Ga0395899_0011765 | |||
| 1145 | Ga0395899_0125179 | |||
| 1146 | Ga0395899_0141345 | |||
| 1147 | Ga0395899_0153461 | |||
| 1148 | Ga0395900_0004698 | |||
| 1149 | Ga0395900_0054726 | |||
| 1150 | Ga0395900_0056356 | |||
| 1151 | Ga0395900_0057570 | |||
| 1152 | Ga0395900_0116179 | |||
| 1153 | Ga0395900_0321488 | |||
| 1154 | Ga0395900_0513843 | |||
| 1155 | Ga0395898_0200862 | |||
| 1156 | Ga0395905_0000666 | |||
| 1157 | Ga0395905_0125394 | |||
| 1158 | Ga0395905_0358154 | |||
| 1159 | Ga0395901_0000084 | |||
| 1160 | Ga0395901_0182133 | |||
| 1161 | Ga0395901_0182267 | |||
| 1162 | Ga0436365_1246322 | |||
| 1163 | Ga0439436_0001618 | |||
| 1164 | Ga0439439_0016478 | |||
| 1165 | Ga0439447_007586 | |||
| 1166 | Ga0439461_0005413 | |||
| 1167 | Ga0439466_0018680 | |||
| 1168 | Ga0439433_0010314 | |||
| 1169 | Ga0439448_0002114 | |||
| 1170 | Ga0439432_002855 | |||
| 1171 | Ga0439432_006062 | |||
| 1172 | Ga0439449_0010235 | |||
| 1173 | Ga0439449_0033170 | |||
| 1174 | Ga0439450_037288 | |||
| 1175 | Ga0439452_009145 | |||
| 1176 | Ga0439455_0007580 | |||
| 1177 | Ga0439456_000013 | |||
| 1178 | Ga0439463_000115 | |||
| 1179 | Ga0450911_000128 | |||
| 1180 | Ga0450923_000481 | |||
| 1181 | Ga0450902_003715 | |||
| 1182 | Ga0450905_000328 | |||
| 1183 | Ga0450905_000588 | |||
| 1184 | Ga0450907_014675 | |||
| 1185 | Ga0439446_0019725 | |||
| 1186 | Ga0439458_0004763 | |||
| 1187 | Ga0450908_014599 | |||
| 1188 | Ga0439434_0027885 | |||
| 1189 | Ga0450901_000315 | |||
| 1190 | Ga0466972_0057135 | |||
| 1191 | Ga0466972_0184859 | |||
| 1192 | Ga0466965_0006059 | |||
| 1193 | Ga0466965_0009849 | |||
| 1194 | Ga0466965_0018929 | |||
| 1195 | Ga0466965_0050036 | |||
| 1196 | Ga0466965_0204187 | |||
| 1197 | Ga0466966_0002542 | |||
| 1198 | Ga0466966_0049221 | |||
| 1199 | Ga0466966_0184921 | |||
| 1200 | Ga0466961_0060004 | |||
| 1201 | Ga0466961_0074359 | |||
| 1202 | Ga0466961_0128358 | |||
| 1203 | Ga0466963_0023995 | |||
| 1204 | Ga0466964_0000831 | |||
| 1205 | Ga0466964_0001625 | |||
| 1206 | Ga0466964_0029511 | |||
| 1207 | Ga0466964_0045087 | |||
| 1208 | Ga0466964_0136943 | |||
| 1209 | Ga0466968_0005562 | |||
| 1210 | Ga0466970_0015384 | |||
| 1211 | Ga0466970_0071724 | |||
| 1212 | Ga0466970_0108495 | |||
| 1213 | Ga0466970_0119307 | |||
| 1214 | Ga0466957_0009190 | |||
| 1215 | Ga0466957_0020696 | |||
| 1216 | Ga0466957_0089845 | |||
| 1217 | Ga0466960_0032635 | |||
| 1218 | Ga0466959_0013616 | |||
| 1219 | Ga0466959_0040982 | |||
| 1220 | Ga0466959_0099079 | |||
| 1221 | Ga0466958_0130257 | |||
| 1222 | Ga0466958_0233552 | |||
| 1223 | Ga0466967_0108414 | |||
| 1224 | Ga0466967_0152776 | |||
| 1225 | Ga0495617_000002 | |||
| 1226 | Ga0495617_000037 | |||
| 1227 | Ga0495617_007530 | |||
| 1228 | Ga0495627_000007 | |||
| 1229 | Ga0495627_000373 | |||
| 1230 | Ga0495627_002596 | |||
| 1231 | Ga0495627_023921 | |||
| 1232 | Ga0495627_046028 | |||
| 1233 | Ga0495603_0003904 | |||
| 1234 | Ga0495603_0033289 | |||
| 1235 | Ga0495590_0031597 | |||
| 1236 | Ga0495590_0104002 | |||
| 1237 | Ga0495591_000640 | |||
| 1238 | Ga0495591_000907 | |||
| 1239 | Ga0495591_001426 | |||
| 1240 | Ga0495591_002894 | |||
| 1241 | Ga0495591_004334 | |||
| 1242 | Ga0495638_0000184 | |||
| 1243 | Ga0495638_0073465 | |||
| 1244 | Ga0495638_0116509 | |||
| 1245 | Ga0495653_0000002 | |||
| 1246 | Ga0495650_0000166 | |||
| 1247 | Ga0495650_0000442 | |||
| 1248 | Ga0495650_0001380 | |||
| 1249 | Ga0495650_0003807 | |||
| 1250 | Ga0495650_0005435 | |||
| 1251 | Ga0495650_0006785 | |||
| 1252 | Ga0495650_0026847 | |||
| 1253 | Ga0495650_0027956 | |||
| 1254 | Ga0495650_0051431 | |||
| 1255 | Ga0495605_0000087 | |||
| 1256 | Ga0495605_0000367 | |||
| 1257 | Ga0495605_0000890 | |||
| 1258 | Ga0495605_0002562 | |||
| 1259 | Ga0495605_0002755 | |||
| 1260 | Ga0495605_0009952 | |||
| 1261 | Ga0495605_0015662 | |||
| 1262 | Ga0495605_0016867 | |||
| 1263 | Ga0495605_0019249 | |||
| 1264 | Ga0495605_0021524 | |||
| 1265 | Ga0495605_0055290 | |||
| 1266 | Ga0495639_0008939 | |||
| 1267 | Ga0495639_0054578 | |||
| 1268 | Ga0495584_0000813 | |||
| 1269 | Ga0495584_0003990 | |||
| 1270 | Ga0495584_0006470 | |||
| 1271 | Ga0495584_0008070 | |||
| 1272 | Ga0495584_0009304 | |||
| 1273 | Ga0495584_0025716 | |||
| 1274 | Ga0495584_0069803 | |||
| 1275 | Ga0495585_0002212 | |||
| 1276 | Ga0495585_0007671 | |||
| 1277 | Ga0495585_0009643 | |||
| 1278 | Ga0495585_0012937 | |||
| 1279 | Ga0495585_0013686 | |||
| 1280 | Ga0495585_0023082 | |||
| 1281 | Ga0495585_0042498 | |||
| 1282 | Ga0495585_0084259 | |||
| 1283 | Ga0495594_0033420 | |||
| 1284 | Ga0495594_0079676 | |||
| 1285 | Ga0495594_0123118 | |||
| 1286 | Ga0495596_0003236 | |||
| 1287 | Ga0495596_0009635 | |||
| 1288 | Ga0495596_0009703 | |||
| 1289 | Ga0495596_0011050 | |||
| 1290 | Ga0495596_0018395 | |||
| 1291 | Ga0495596_0022437 | |||
| 1292 | Ga0495596_0023437 | |||
| 1293 | Ga0495596_0044175 | |||
| 1294 | Ga0495607_0000424 | |||
| 1295 | Ga0495607_0001898 | |||
| 1296 | Ga0495607_0006062 | |||
| 1297 | Ga0495607_0006478 | |||
| 1298 | Ga0495607_0008162 | |||
| 1299 | Ga0495607_0011677 | |||
| 1300 | Ga0495607_0013881 | |||
| 1301 | Ga0495607_0014028 | |||
| 1302 | Ga0495607_0014483 | |||
| 1303 | Ga0495607_0018956 | |||
| 1304 | Ga0495607_0025339 | |||
| 1305 | Ga0495607_0047224 | |||
| 1306 | Ga0495607_0080931 | |||
| 1307 | Ga0495583_0000119 | |||
| 1308 | Ga0495583_0001037 | |||
| 1309 | Ga0495583_0001346 | |||
| 1310 | Ga0495583_0001911 | |||
| 1311 | Ga0495583_0004301 | |||
| 1312 | Ga0495583_0004613 | |||
| 1313 | Ga0495583_0005862 | |||
| 1314 | Ga0495583_0006437 | |||
| 1315 | Ga0495583_0007028 | |||
| 1316 | Ga0495583_0010347 | |||
| 1317 | Ga0495583_0016846 | |||
| 1318 | Ga0495583_0030615 | |||
| 1319 | Ga0495583_0037187 | |||
| 1320 | Ga0495583_0053960 | |||
| 1321 | Ga0495606_0000064 | |||
| 1322 | Ga0495606_0000156 | |||
| 1323 | Ga0495606_0000500 | |||
| 1324 | Ga0495606_0000924 | |||
| 1325 | Ga0495606_0001158 | |||
| 1326 | Ga0495606_0001576 | |||
| 1327 | Ga0495606_0001948 | |||
| 1328 | Ga0495606_0005955 | |||
| 1329 | Ga0495606_0043260 | |||
| 1330 | Ga0495606_0062724 | |||
| 1331 | Ga0495606_0171348 | |||
| 1332 | Ga0495610_0000003 | |||
| 1333 | Ga0495610_0000798 | |||
| 1334 | Ga0495610_0003717 | |||
| 1335 | Ga0495610_0008898 | |||
| 1336 | Ga0495610_0014886 | |||
| 1337 | Ga0495610_0017344 | |||
| 1338 | Ga0495610_0020972 | |||
| 1339 | Ga0495610_0034419 | |||
| 1340 | Ga0495610_0037766 | |||
| 1341 | Ga0495610_0045222 | |||
| 1342 | Ga0495610_0124398 | |||
| 1343 | Ga0495616_0005612 | |||
| 1344 | Ga0495616_0009688 | |||
| 1345 | Ga0495616_0011654 | |||
| 1346 | Ga0495616_0015292 | |||
| 1347 | Ga0495616_0034391 | |||
| 1348 | Ga0495616_0038572 | |||
| 1349 | Ga0495616_0042851 | |||
| 1350 | Ga0495616_0053968 | |||
| 1351 | Ga0495616_0072843 | |||
| 1352 | Ga0495616_0091211 | |||
| 1353 | Ga0495616_0163251 | |||
| 1354 | Ga0495620_0000052 | |||
| 1355 | Ga0495620_0001435 | |||
| 1356 | Ga0495620_0002464 | |||
| 1357 | Ga0495620_0016129 | |||
| 1358 | Ga0495620_0093520 | |||
| 1359 | Ga0495631_0001768 | |||
| 1360 | Ga0495631_0006939 | |||
| 1361 | Ga0495631_0009335 | |||
| 1362 | Ga0495631_0009951 | |||
| 1363 | Ga0495631_0018957 | |||
| 1364 | Ga0495631_0022959 | |||
| 1365 | Ga0495631_0026427 | |||
| 1366 | Ga0495631_0040688 | |||
| 1367 | Ga0495632_0000040 | |||
| 1368 | Ga0495632_0000540 | |||
| 1369 | Ga0495632_0001781 | |||
| 1370 | Ga0495632_0002113 | |||
| 1371 | Ga0495632_0003013 | |||
| 1372 | Ga0495632_0004754 | |||
| 1373 | Ga0495632_0009283 | |||
| 1374 | Ga0495632_0013510 | |||
| 1375 | Ga0495632_0046813 | |||
| 1376 | Ga0495637_0000006 | |||
| 1377 | Ga0495637_0000346 | |||
| 1378 | Ga0495637_0010752 | |||
| 1379 | Ga0495637_0011359 | |||
| 1380 | Ga0495637_0013284 | |||
| 1381 | Ga0495637_0025972 | |||
| 1382 | Ga0495637_0026217 | |||
| 1383 | Ga0495643_0000282 | |||
| 1384 | Ga0495643_0001593 | |||
| 1385 | Ga0495643_0001686 | |||
| 1386 | Ga0495643_0001974 | |||
| 1387 | Ga0495643_0002102 | |||
| 1388 | Ga0495643_0002637 | |||
| 1389 | Ga0495643_0006661 | |||
| 1390 | Ga0495643_0008756 | |||
| 1391 | Ga0495643_0016451 | |||
| 1392 | Ga0495643_0056561 | |||
| 1393 | Ga0495644_0001218 | |||
| 1394 | Ga0495644_0005269 | |||
| 1395 | Ga0495644_0011094 | |||
| 1396 | Ga0495644_0012232 | |||
| 1397 | Ga0495644_0055915 | |||
| 1398 | Ga0495648_0000001 | |||
| 1399 | Ga0495648_0000611 | |||
| 1400 | Ga0495648_0003910 | |||
| 1401 | Ga0495648_0008953 | |||
| 1402 | Ga0495648_0011629 | |||
| 1403 | Ga0495648_0014218 | |||
| 1404 | Ga0495648_0030301 | |||
| 1405 | Ga0495648_0042160 | |||
| 1406 | Ga0495648_0058903 | |||
| 1407 | Ga0495648_0064887 | |||
| 1408 | Ga0495648_0089725 | |||
| 1409 | Ga0495648_0184944 | |||
| 1410 | Ga0495666_0002189 | |||
| 1411 | Ga0495642_0000710 | |||
| 1412 | Ga0495642_0004317 | |||
| 1413 | Ga0495642_0005367 | |||
| 1414 | Ga0495642_0006326 | |||
| 1415 | Ga0495642_0007109 | |||
| 1416 | Ga0495642_0008224 | |||
| 1417 | Ga0495642_0020914 | |||
| 1418 | Ga0495642_0030059 | |||
| 1419 | Ga0495642_0036727 | |||
| 1420 | Ga0495642_0053658 | |||
| 1421 | Ga0495654_0003846 | |||
| 1422 | Ga0495654_0008721 | |||
| 1423 | Ga0495654_0011039 | |||
| 1424 | Ga0495654_0027659 | |||
| 1425 | Ga0495654_0029439 | |||
| 1426 | Ga0495654_0032023 | |||
| 1427 | Ga0495654_0040385 | |||
| 1428 | Ga0495654_0041430 | |||
| 1429 | Ga0495665_0178464 | |||
| 1430 | Ga0495586_0090024 | |||
| 1431 | Ga0495586_0103417 | |||
| 1432 | Ga0495609_0000096 | |||
| 1433 | Ga0495609_0000106 | |||
| 1434 | Ga0495609_0000164 | |||
| 1435 | Ga0495609_0000401 | |||
| 1436 | Ga0495609_0000783 | |||
| 1437 | Ga0495609_0006196 | |||
| 1438 | Ga0495609_0012497 | |||
| 1439 | Ga0495609_0017746 | |||
| 1440 | Ga0495609_0018943 | |||
| 1441 | Ga0495609_0057557 | |||
| 1442 | Ga0495609_0076875 | |||
| 1443 | Ga0495609_0077675 | |||
| 1444 | Ga0495621_0019608 | |||
| 1445 | Ga0495597_0000726 | |||
| 1446 | Ga0495597_0001884 | |||
| 1447 | Ga0495597_0004773 | |||
| 1448 | Ga0495597_0007749 | |||
| 1449 | Ga0495597_0035118 | |||
| 1450 | Ga0495597_0054866 | |||
| 1451 | Ga0495597_0080369 | |||
| 1452 | Ga0495597_0122875 | |||
| 1453 | Ga0495645_0032588 | |||
| 1454 | Ga0495645_0175708 | |||
| 1455 | Ga0495622_0000087 | |||
| 1456 | Ga0495622_0002777 | |||
| 1457 | Ga0495622_0021426 | |||
| 1458 | Ga0495633_0000171 | |||
| 1459 | Ga0495633_0000188 | |||
| 1460 | Ga0495633_0001420 | |||
| 1461 | Ga0495633_0003725 | |||
| 1462 | Ga0495633_0007930 | |||
| 1463 | Ga0495633_0009859 | |||
| 1464 | Ga0495633_0011990 | |||
| 1465 | Ga0495633_0012148 | |||
| 1466 | Ga0495633_0013787 | |||
| 1467 | Ga0495633_0020207 | |||
| 1468 | Ga0495633_0035964 | |||
| 1469 | Ga0495633_0102999 | |||
| 1470 | Ga0495656_0006134 | |||
| 1471 | Ga0495656_0038760 | |||
| 1472 | Ga0495668_0000185 | |||
| 1473 | Ga0495668_0000363 | |||
| 1474 | Ga0495668_0001751 | |||
| 1475 | Ga0495668_0003117 | |||
| 1476 | Ga0495668_0003629 | |||
| 1477 | Ga0495668_0007464 | |||
| 1478 | Ga0495668_0010202 | |||
| 1479 | Ga0495668_0014738 | |||
| 1480 | Ga0495668_0018078 | |||
| 1481 | Ga0495668_0045422 | |||
| 1482 | Ga0495668_0047075 | |||
| 1483 | Ga0495668_0076908 | |||
| 1484 | Ga0495668_0086579 | |||
| 1485 | Ga0495611_0000526 | |||
| 1486 | Ga0495611_0002775 | |||
| 1487 | Ga0495611_0003272 | |||
| 1488 | Ga0495611_0019963 | |||
| 1489 | Ga0495611_0030761 | |||
| 1490 | Ga0495611_0045229 | |||
| 1491 | Ga0495611_0057585 | |||
| 1492 | Ga0495611_0079017 | |||
| 1493 | Ga0495625_0000050 | |||
| 1494 | Ga0495625_0000164 | |||
| 1495 | Ga0495625_0000372 | |||
| 1496 | Ga0495625_0043244 | |||
| 1497 | Ga0495625_0057367 | |||
| 1498 | Ga0495625_0072838 | |||
| 1499 | Ga0495625_0093704 | |||
| 1500 | Ga0495625_0094147 | |||
| 1501 | Ga0495625_0151063 | |||
| 1502 | Ga0495625_0164871 | |||
| 1503 | Ga0495625_0167763 | |||
| 1504 | Ga0495635_0005894 | |||
| 1505 | Ga0495659_0013305 | |||
| 1506 | Ga0495661_0000164 | |||
| 1507 | Ga0495661_0000309 | |||
| 1508 | Ga0495661_0000614 | |||
| 1509 | Ga0495661_0002216 | |||
| 1510 | Ga0495661_0002296 | |||
| 1511 | Ga0495661_0010755 | |||
| 1512 | Ga0495661_0011758 | |||
| 1513 | Ga0495661_0022220 | |||
| 1514 | Ga0495661_0040413 | |||
| 1515 | Ga0495661_0043635 | |||
| 1516 | Ga0495661_0080843 | |||
| 1517 | Ga0495661_0106905 | |||
| 1518 | Ga0495661_0113293 | |||
| 1519 | Ga0495661_0116795 | |||
| 1520 | Ga0495661_0187070 | |||
| 1521 | Ga0495661_0201940 | |||
| 1522 | Ga0495588_0000070 | |||
| 1523 | Ga0495588_0039682 | |||
| 1524 | Ga0495588_0137390 | |||
| 1525 | Ga0495669_0000098 | |||
| 1526 | Ga0495669_0003738 | |||
| 1527 | Ga0495669_0004576 | |||
| 1528 | Ga0495669_0005091 | |||
| 1529 | Ga0495669_0016763 | |||
| 1530 | Ga0495669_0029797 | |||
| 1531 | Ga0495669_0134013 | |||
| 1532 | Ga0495669_0135256 | |||
| 1533 | Ga0495613_0117145 | |||
| 1534 | Ga0495670_0005657 | |||
| 1535 | Ga0495670_0013792 | |||
| 1536 | Ga0495670_0041694 | |||
| 1537 | Ga0495670_0044741 | |||
| 1538 | Ga0495670_0051685 | |||
| 1539 | Ga0495670_0128413 | |||
| 1540 | Ga0495671_0000001 | |||
| 1541 | Ga0495671_0005249 | |||
| 1542 | Ga0495671_0010836 | |||
| 1543 | Ga0495671_0025089 | |||
| 1544 | Ga0495671_0037701 | |||
| 1545 | Ga0495671_0092472 | |||
| 1546 | Ga0495649_0001815 | |||
| 1547 | Ga0495649_0002551 | |||
| 1548 | Ga0495649_0002569 | |||
| 1549 | Ga0495649_0009456 | |||
| 1550 | Ga0495649_0013356 | |||
| 1551 | Ga0495649_0034656 | |||
| 1552 | Ga0495649_0040018 | |||
| 1553 | Ga0495649_0043028 | |||
| 1554 | Ga0495649_0046819 | |||
| 1555 | Ga0495649_0065045 | |||
| 1556 | Ga0495649_0065269 | |||
| 1557 | Ga0495649_0066415 | |||
| 1558 | Ga0495649_0122810 | |||
| 1559 | Ga0495649_0166040 | |||
| 1560 | Ga0495589_0000036 | |||
| 1561 | Ga0495589_0000092 | |||
| 1562 | Ga0495589_0004004 | |||
| 1563 | Ga0495589_0005614 | |||
| 1564 | Ga0495589_0008837 | |||
| 1565 | Ga0495589_0038033 | |||
| 1566 | Ga0495589_0038115 | |||
| 1567 | Ga0495589_0062376 | |||
| 1568 | Ga0495660_0000117 | |||
| 1569 | Ga0495660_0000215 | |||
| 1570 | Ga0495660_0002403 | |||
| 1571 | Ga0495660_0009049 | |||
| 1572 | Ga0495660_0014900 | |||
| 1573 | Ga0495660_0015540 | |||
| 1574 | Ga0495660_0015664 | |||
| 1575 | Ga0495660_0015865 | |||
| 1576 | Ga0495660_0018174 | |||
| 1577 | Ga0495660_0044048 | |||
| 1578 | Ga0495660_0088433 | |||
| 1579 | Ga0495660_0137782 | |||
| 1580 | Ga0495660_0204384 | |||
| 1581 | Ga0495581_0032837 | |||
| 1582 | Ga0495636_0082485 | |||
| 1583 | Ga0495672_0000086 | |||
| 1584 | Ga0495672_0000187 | |||
| 1585 | Ga0495672_0002132 | |||
| 1586 | Ga0495672_0003870 | |||
| 1587 | Ga0495672_0004394 | |||
| 1588 | Ga0495672_0051155 | |||
| 1589 | Ga0495672_0103501 | |||
| 1590 | Ga0495672_0110252 | |||
| 1591 | Ga0495676_0000035 | |||
| 1592 | Ga0495676_0000377 | |||
| 1593 | Ga0495676_0017698 | |||
| 1594 | Ga0495680_0080561 | |||
| 1595 | Ga0495683_0000080 | |||
| 1596 | Ga0495683_0007215 | |||
| 1597 | Ga0495683_0011985 | |||
| 1598 | Ga0495683_0063128 | |||
| 1599 | Ga0495683_0141247 | |||
| 1600 | Ga0495683_0163446 | |||
| 1601 | Ga0495687_000074 | |||
| 1602 | Ga0495687_000154 | |||
| 1603 | Ga0495687_001753 | |||
| 1604 | Ga0495687_002544 | |||
| 1605 | Ga0495687_002568 | |||
| 1606 | Ga0495687_006358 | |||
| 1607 | Ga0495675_0022159 | |||
| 1608 | Ga0495677_0000037 | |||
| 1609 | Ga0495677_0002039 | |||
| 1610 | Ga0495677_0003775 | |||
| 1611 | Ga0495677_0004085 | |||
| 1612 | Ga0495677_0037715 | |||
| 1613 | Ga0495679_000299 | |||
| 1614 | Ga0495679_002040 | |||
| 1615 | Ga0495679_003539 | |||
| 1616 | Ga0495679_007583 | |||
| 1617 | Ga0495685_002172 | |||
| 1618 | Ga0495685_025478 | |||
| 1619 | Ga0495685_037677 | |||
| 1620 | Ga0495673_0000003 | |||
| 1621 | Ga0495673_0000097 | |||
| 1622 | Ga0495673_0000100 | |||
| 1623 | Ga0495673_0000395 | |||
| 1624 | Ga0495673_0000396 | |||
| 1625 | Ga0495673_0006224 | |||
| 1626 | Ga0495673_0006451 | |||
| 1627 | Ga0495681_0002173 | |||
| 1628 | Ga0495681_0007151 | |||
| 1629 | Ga0495681_0008429 | |||
| 1630 | Ga0495681_0010334 | |||
| 1631 | Ga0495681_0011942 | |||
| 1632 | Ga0495681_0012679 | |||
| 1633 | Ga0495681_0012695 | |||
| 1634 | Ga0495681_0031686 | |||
| 1635 | Ga0495681_0037048 | |||
| 1636 | Ga0495681_0041881 | |||
| 1637 | Ga0495681_0067139 | |||
| 1638 | Ga0495681_0110414 | |||
| 1639 | Ga0495681_0121841 | |||
| 1640 | Ga0495686_0000054 | |||
| 1641 | Ga0495686_0000987 | |||
| 1642 | Ga0495686_0001906 | |||
| 1643 | Ga0495686_0008973 | |||
| 1644 | Ga0495686_0010237 | |||
| 1645 | Ga0495686_0033660 | |||
| 1646 | Ga0495686_0045075 | |||
| 1647 | Ga0495686_0062495 | |||
| 1648 | Ga0495593_0011137 | |||
| 1649 | Ga0495614_0003662 | |||
| 1650 | Ga0495614_0033016 | |||
| 1651 | Ga0495626_0000006 | |||
| 1652 | Ga0495626_0000600 | |||
| 1653 | Ga0495626_0004120 | |||
| 1654 | Ga0495626_0007465 | |||
| 1655 | Ga0495626_0014843 | |||
| 1656 | Ga0495626_0017504 | |||
| 1657 | Ga0495626_0048741 | |||
| 1658 | Ga0495626_0064012 | |||
| 1659 | Ga0495626_0087447 | |||
| 1660 | Ga0495626_0142073 | |||
| 1661 | Ga0496100_0006427 | |||
| 1662 | Ga0496100_0022301 | |||
| 1663 | Ga0496100_0089620 | |||
| 1664 | Ga0496101_0015959 | |||
| 1665 | Ga0496101_0257198 | |||
| 1666 | Ga0496102_0000152 | |||
| 1667 | Ga0496102_0001102 | |||
| 1668 | Ga0496102_0015513 | |||
| 1669 | Ga0496102_0506840 | |||
| 1670 | Ga0496103_0002518 | |||
| 1671 | Ga0496103_0070892 | |||
| 1672 | Ga0496103_0218562 | |||
| 1673 | Ga0496104_0142955 | |||
| 1674 | Ga0496104_0522943 | |||
| 1675 | Ga0496105_0119217 | |||
| 1676 | Ga0496106_0069488 | |||
| 1677 | Ga0496106_0338308 | |||
| 1678 | Ga0496107_0017162 | |||
| 1679 | Ga0496107_0128885 | |||
| 1680 | Ga0496108_0082384 | |||
| 1681 | Ga0496108_0128925 | |||
| 1682 | Ga0496109_0056995 | |||
| 1683 | Ga0496109_0158650 | |||
| 1684 | Ga0496109_0255555 | |||
| 1685 | Ga0496110_0081513 | |||
| 1686 | Ga0496110_0083667 | |||
| 1687 | Ga0496110_0334110 | |||
| 1688 | Ga0496111_0015421 | |||
| 1689 | Ga0496112_0622091 | |||
| 1690 | Ga0496113_0094541 | |||
| 1691 | Ga0496114_0001680 | |||
| 1692 | Ga0496114_0003874 | |||
| 1693 | Ga0496114_0172339 | |||
| 1694 | Ga0496114_0287696 | |||
| 1695 | Ga0496116_0003215 | |||
| 1696 | Ga0496116_0024112 | |||
| 1697 | Ga0496116_0038067 | |||
| 1698 | Ga0496116_0038438 | |||
| 1699 | Ga0496117_0000056 | |||
| 1700 | Ga0496117_0001733 | |||
| 1701 | Ga0496117_0001893 | |||
| 1702 | Ga0496117_0003106 | |||
| 1703 | Ga0496117_0054998 | |||
| 1704 | Ga0496118_0000047 | |||
| 1705 | Ga0496118_0002944 | |||
| 1706 | Ga0496118_0005238 | |||
| 1707 | Ga0496118_0038630 | |||
| 1708 | Ga0496118_0039107 | |||
| 1709 | Ga0496118_0166426 | |||
| 1710 | Ga0496119_0000199 | |||
| 1711 | Ga0496119_0045772 | |||
| 1712 | Ga0496120_0000840 | |||
| 1713 | Ga0496121_0001906 | |||
| 1714 | Ga0496121_0003376 | |||
| 1715 | Ga0496121_0009023 | |||
| 1716 | Ga0496121_0016973 | |||
| 1717 | Ga0496121_0021646 | |||
| 1718 | Ga0496121_0023195 | |||
| 1719 | Ga0496121_0033480 | |||
| 1720 | Ga0496121_0091303 | |||
| 1721 | Ga0496121_0113056 | |||
| 1722 | Ga0496121_0128826 | |||
| 1723 | Ga0496121_0146500 | |||
| 1724 | Ga0496122_0000298 | |||
| 1725 | Ga0496122_0001315 | |||
| 1726 | Ga0496122_0006167 | |||
| 1727 | Ga0496122_0019287 | |||
| 1728 | Ga0496122_0030520 | |||
| 1729 | Ga0496122_0031942 | |||
| 1730 | Ga0496122_0032248 | |||
| 1731 | Ga0496122_0062963 | |||
| 1732 | Ga0496122_0125750 | |||
| 1733 | Ga0496123_0000080 | |||
| 1734 | Ga0496123_0000851 | |||
| 1735 | Ga0496123_0001824 | |||
| 1736 | Ga0496123_0015045 | |||
| 1737 | Ga0496123_0018392 | |||
| 1738 | Ga0496123_0019006 | |||
| 1739 | Ga0496123_0028518 | |||
| 1740 | Ga0496123_0067313 | |||
| 1741 | Ga0496123_0106297 | |||
| 1742 | Ga0496124_0000004 | |||
| 1743 | Ga0496124_0001065 | |||
| 1744 | Ga0496124_0006805 | |||
| 1745 | Ga0496124_0022612 | |||
| 1746 | Ga0496124_0026320 | |||
| 1747 | Ga0496124_0028685 | |||
| 1748 | Ga0496124_0047187 | |||
| 1749 | Ga0496124_0061207 | |||
| 1750 | Ga0496124_0062130 | |||
| 1751 | Ga0496124_0062912 | |||
| 1752 | Ga0496124_0115756 | |||
| 1753 | Ga0496124_0145268 | |||
| 1754 | Ga0496124_0151010 | |||
| 1755 | Ga0496125_0000240 | |||
| 1756 | Ga0496125_0000826 | |||
| 1757 | Ga0496125_0010518 | |||
| 1758 | Ga0496125_0024295 | |||
| 1759 | Ga0496125_0026908 | |||
| 1760 | Ga0496125_0071692 | |||
| 1761 | Ga0496125_0092889 | |||
| 1762 | Ga0496125_0102010 | |||
| 1763 | Ga0496126_0025933 | |||
| 1764 | Ga0495678_000004 | |||
| 1765 | Ga0495678_000226 | |||
| 1766 | Ga0495678_001072 | |||
| 1767 | Ga0495678_003443 | |||
| 1768 | Ga0495678_003543 | |||
| 1769 | Ga0495678_003967 | |||
| 1770 | Ga0495678_005143 | |||
| 1771 | Ga0495678_009918 | |||
| 1772 | Ga0495678_028661 | |||
| 1773 | Ga0495678_030309 | |||
| 1774 | Ga0495678_038882 | |||
| 1775 | Ga0495678_084503 | |||
| 1776 | Ga0495682_0000501 | |||
| 1777 | Ga0495682_0002360 | |||
| 1778 | Ga0495682_0003356 | |||
| 1779 | Ga0495682_0009849 | |||
| 1780 | Ga0495682_0038006 | |||
| 1781 | Ga0501034_0000330 | |||
| 1782 | Ga0501037_0262536 | |||
| 1783 | Ga0501269_000023 | |||
| 1784 | Ga0501035_0003423 | |||
| 1785 | Ga0501044_0579939 | |||
| 1786 | nmdc:mga00v17_90164_c1 | |||
| 1787 | Ga0500594_0004979 | |||
| 1788 | Ga0500618_001435 | |||
| 1789 | Ga0500618_002592 | |||
| 1790 | Ga0500659_0001851 | |||
| 1791 | Ga0500586_000036 | |||
| 1792 | Ga0500586_000610 | |||
| 1793 | Ga0500586_073843 | |||
| 1794 | Ga0500634_0072763 | |||
| 1795 | Ga0466962_0008940 | |||
| 1796 | 2511375170 | |||
| 1797 | 2519461377 | |||
| 1798 | 2555245637 | |||
| 1799 | 2585290843 | |||
| 1800 | 2599734638 | |||
| 1801 | 2599745541 | |||
| 1802 | 2599974342 | |||
| 1803 | 2600207448 | |||
| 1804 | 2601671882 | |||
| 1805 | 2643797745 | |||
| 1806 | 2644062997 | |||
| 1807 | 2644074302 | |||
| 1808 | 2644470473 | |||
| 1809 | 2676741264 | |||
| 1810 | 2738829335 | |||
| 1811 | 2739153131 | |||
| 1812 | 2739195051 | |||
| 1813 | 2739246582 | |||
| 1814 | 2739285929 | |||
| 1815 | 2739291242 | |||
| 1816 | 2739321527 | |||
| 1817 | 2739339917 | |||
| 1818 | 2739613104 | |||
| 1819 | 2765585995 | |||
| 1820 | 2807410309 | |||
| 1821 | 2807458657 | |||
| 1822 | 2808969327 | |||
| 1823 | 2809004158 | |||
| 1824 | 2816476113 | |||
| 1825 | 2817258282 | |||
| 1826 | 2817281304 | |||
| 1827 | 2817452008 | |||
| 1828 | 2819634437 | |||
| 1829 | 2821131484 | |||
| 1830 | 2834034306 | |||
| 1831 | 2842714162 | |||
| 1832 | 2842736145 | |||
| 1833 | 2857552244 | |||
| 1834 | 2857554372 | |||
| 1835 | 2857559975 | |||
| 1836 | 2857564857 | |||
| 1837 | 2863426751 | |||
| 1838 | 2870075226 | |||
| 1839 | 2885086522 | |||
| 1840 | 2887376014 | |||
| 1841 | 2904426140 | |||
| 1842 | 2904570651 | |||
| 1843 | 2904577828 | |||
| 1844 | 2912964445 | |||
| 1845 | 2919156505 | |||
| 1846 | 2919478521 | |||
| 1847 | 2928159003 | |||
| 1848 | 2928167826 | |||
| 1849 | 2928178098 | |||
| 1850 | 2928537983 | |||
| 1851 | 2929203765 | |||
| 1852 | 2932415072 | |||
| 1853 | 2932421280 | |||
| 1854 | 2939651953 | |||
| 1855 | 2981992380 | |||
| 1856 | 3007807128 | |||
| 1857 | 642419967 | |||
| 1858 | 8018846602 | |||
| 1859 | 8020810333 | |||
| 1860 | 8020941768 | |||
| 1861 | 8020945666 | |||
| 1862 | 8020958757 | |||
| 1863 | 8021121668 | |||
| 1864 | 8039103854 | |||
| 1865 | 8040167376 | |||
| 1866 | 8040175387 | |||
| 1867 | 8047679050 | |||
| 1868 | 8052495435 | |||
| 1869 | 8054932792 | |||
| 1870 | 8055823199 | |||
| 1871 | 8055882037 | |||
| 1872 | 8055915937 | |||
| 1873 | 8056116982 | |||
| 1874 | 8056121454 | |||
| 1875 | 8056136612 | |||
| 1876 | 8056142302 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9454 | 3 | 89 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9436 | 3 | 89 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9368 | 3 | 87 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9306 | 3 | 90 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9256 | 3 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0C6_1_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9813 | 3 | 83 | 1.10.10.10 |
| af_Q2G1Q6_4_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.972 | 3 | 87 | 1.10.10.10 |
| af_P0ACQ7_8_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9713 | 4 | 87 | 1.10.10.10 |
| af_Q57748_4_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9672 | 4 | 87 | 1.10.10.10 |
| af_P05827_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9648 | 3 | 84 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379ZR92-F1-model_v4 | CysJI operon transcriptional activator | 0.9335 | 89 | 292 |
GO:0005829
GO:0006355 |
| AF-A0A379ZR92-F1-model_v4 | CysJI operon transcriptional activator | 0.8997 | 89 | 292 |
GO:0005829
GO:0006355 |
| AF-A0A529FJL8-F1-model_v4 | LysR family transcriptional regulator | 0.8908 | 164 | 267 |
GO:0005829
GO:0006355 |
| AF-A0A6L4A263-F1-model_v4 | LysR family transcriptional regulator | 0.8781 | 166 | 262 |
GO:0000976
GO:0006355 |
| AF-A0A1N6KIL4-F1-model_v4 | deleted | 0.8724 | 169 | 262 |
|