F486262

General Info

Members Datasets Scaffolds Average Seq Length
938 315 1876 205

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0193567|Ga0495657_0193567_65_751
Length 228
Sequence MQTEATLAQSDVSELDLVKRCQAGDTEAFDELVTRYRTRVFGMIYNMVHSEQDAWDLAQDSFLKAWKSIGRFRGQSSFYTWIYRIVMNVTIDWLRKKKIKGGDAEFDDAIQLREIDPASKTVPKTEALPHQAMERDEIRARIEKAISQLSPEHRAVILMKEIDDMQYHEIAEALECSIGTVMSRLFYARKKLQSLLRDVYENVRGKMDGVAGRPAWRARVIGIRSGAA

Samples

Sample ID Description Type Environment
1 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
241 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
242 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 6.18
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 26.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495657_0193567 3300046675 Bacteria 1242
2 CNXas_1000206 3300000545 Bacteria 8432
3 JGI24032J14994_101162 3300001430 Unclassified 1185
4 JGI24737J22298_10012645 3300001990 Bacteria 2751
5 JGI24744J21845_10012038 3300002077 Unclassified 1760
6 JGI24035J26624_1000141 3300002126 Bacteria 6413
7 JGI24035J26624_1007613 3300002126 Bacteria 1054
8 JGI24035J26624_1011137 3300002126 Bacteria 898
9 JGI25406J46586_10000087 3300003203 Bacteria 42198
10 JGI25406J46586_10095645 3300003203 Unclassified 891
11 JGI25404J52841_10004829 3300003659 Unclassified 2760
12 JGI25405J52794_10000412 3300003911 Bacteria 6018
13 JGI25405J52794_10002813 3300003911 Bacteria 3019
14 Ga0065714_10094929 3300005288 Bacteria 1801
15 Ga0065704_10004850 3300005289 Bacteria 3990
16 Ga0065704_10009573 3300005289 Bacteria 3061
17 Ga0065704_10022829 3300005289 Unclassified 1004
18 Ga0065704_10073950 3300005289 Bacteria 6644
19 Ga0065704_10091739 3300005289 Bacteria 2696
20 Ga0065712_10001692 3300005290 Bacteria 6372
21 Ga0065712_10004664 3300005290 Bacteria 5980
22 Ga0065712_10006386 3300005290 Bacteria 4869
23 Ga0065712_10016478 3300005290 Unclassified 1439
24 Ga0065712_10026337 3300005290 Unclassified 1166
25 Ga0065712_10116148 3300005290 Bacteria 1740
26 Ga0065712_10137998 3300005290 Unclassified 1478
27 Ga0065712_10205871 3300005290 Unclassified 1091
28 Ga0065712_10227849 3300005290 Bacteria 1020
29 Ga0065712_10266013 3300005290 Unclassified 923
30 Ga0065715_10000709 3300005293 Bacteria 10157
31 Ga0065715_10001727 3300005293 Bacteria 5692
32 Ga0065715_10089933 3300005293 Bacteria 8092
33 Ga0065715_10119901 3300005293 Unclassified 2274
34 Ga0065715_10167516 3300005293 Bacteria 1574
35 Ga0065715_10174334 3300005293 Unclassified 1523
36 Ga0065715_10255269 3300005293 Bacteria 1154
37 Ga0065715_10298847 3300005293 Unclassified 1017
38 Ga0065715_10327626 3300005293 Unclassified 976
39 Ga0065715_10368088 3300005293 Bacteria 913
40 Ga0065715_10369071 3300005293 Unclassified 924
41 Ga0065715_10426084 3300005293 Bacteria 852
42 Ga0065707_10003005 3300005295 Bacteria 4384
43 Ga0065707_10005953 3300005295 Unclassified 2700
44 Ga0065707_10013106 3300005295 Unclassified 2268
45 Ga0070658_10005882 3300005327 Bacteria 9948
46 Ga0070658_10136660 3300005327 Bacteria 2046
47 Ga0070658_10314682 3300005327 Unclassified 1336
48 Ga0070658_10598176 3300005327 Bacteria 956
49 Ga0070676_10007273 3300005328 Bacteria 5939
50 Ga0070676_10013117 3300005328 Bacteria 4539
51 Ga0070676_10025549 3300005328 Bacteria 3339
52 Ga0070676_10171591 3300005328 Bacteria 1403
53 Ga0070676_10392529 3300005328 Bacteria 964
54 Ga0070676_10875274 3300005328 Unclassified 668
55 Ga0070683_100006008 3300005329 Bacteria 10172
56 Ga0070683_100010449 3300005329 Bacteria 7982
57 Ga0070683_100114079 3300005329 Bacteria 2550
58 Ga0070683_100359518 3300005329 Unclassified 1387
59 Ga0070690_100027697 3300005330 Bacteria 3504
60 Ga0070690_100236802 3300005330 Bacteria 1286
61 Ga0070690_100582137 3300005330 Bacteria 847
62 Ga0070690_100637363 3300005330 Bacteria 812
63 Ga0070670_100014931 3300005331 Bacteria 6665
64 Ga0070670_100023992 3300005331 Bacteria 5247
65 Ga0070670_100052927 3300005331 Unclassified 3487
66 Ga0070670_100122580 3300005331 Bacteria 2242
67 Ga0070670_100547513 3300005331 Bacteria 1032
68 Ga0070677_10003178 3300005333 Bacteria 5284
69 Ga0070677_10118311 3300005333 Bacteria 1193
70 Ga0068869_100061991 3300005334 Bacteria 2744
71 Ga0070666_10009111 3300005335 Bacteria 6188
72 Ga0070666_10014419 3300005335 Bacteria 5032
73 Ga0070666_10063078 3300005335 Bacteria 2511
74 Ga0070666_10115524 3300005335 Bacteria 1858
75 Ga0070666_10156365 3300005335 Unclassified 1592
76 Ga0070680_100026698 3300005336 Bacteria 4619
77 Ga0070680_100558357 3300005336 Unclassified 981
78 Ga0070682_100075346 3300005337 Bacteria 2170
79 Ga0068868_100099890 3300005338 Bacteria 2348
80 Ga0068868_100109169 3300005338 Bacteria 2247
81 Ga0068868_100144993 3300005338 Bacteria 1952
82 Ga0070660_100083058 3300005339 Bacteria 2516
83 Ga0070660_100123059 3300005339 Bacteria 2071
84 Ga0070660_100138468 3300005339 Bacteria 1951
85 Ga0070660_100306739 3300005339 Unclassified 1302
86 Ga0070660_100436038 3300005339 Bacteria 1086
87 Ga0070689_100000978 3300005340 Bacteria 17870
88 Ga0070689_100075259 3300005340 Bacteria 2643
89 Ga0070689_100085949 3300005340 Bacteria 2473
90 Ga0070689_100128485 3300005340 Bacteria 2031
91 Ga0070691_10242126 3300005341 Bacteria 964
92 Ga0070687_100013691 3300005343 Bacteria 3622
93 Ga0070687_100027127 3300005343 Bacteria 2763
94 Ga0070661_100087820 3300005344 Bacteria 2301
95 Ga0070661_100211272 3300005344 Bacteria 1486
96 Ga0070661_100343187 3300005344 Unclassified 1170
97 Ga0070668_100007657 3300005347 Bacteria 8015
98 Ga0070668_100023570 3300005347 Bacteria 4656
99 Ga0070668_100051505 3300005347 Bacteria 3172
100 Ga0070668_100165243 3300005347 Bacteria 1798
101 Ga0070669_100002655 3300005353 Bacteria 12882
102 Ga0070669_100002855 3300005353 Bacteria 12482
103 Ga0070669_100078802 3300005353 Bacteria 2449
104 Ga0070669_100149960 3300005353 Bacteria 1804
105 Ga0070675_100003712 3300005354 Bacteria 11603
106 Ga0070675_100009595 3300005354 Bacteria 7533
107 Ga0070675_100012255 3300005354 Bacteria 6720
108 Ga0070675_100051731 3300005354 Bacteria 3376
109 Ga0070675_100063293 3300005354 Bacteria 3058
110 Ga0070675_100071895 3300005354 Bacteria 2871
111 Ga0070675_100092059 3300005354 Bacteria 2541
112 Ga0070675_100333325 3300005354 Bacteria 1342
113 Ga0070675_100380263 3300005354 Unclassified 1257
114 Ga0070675_100527999 3300005354 Bacteria 1065
115 Ga0070671_100022030 3300005355 Bacteria 5205
116 Ga0070671_100027480 3300005355 Bacteria 4683
117 Ga0070671_100095441 3300005355 Bacteria 2493
118 Ga0070671_100119176 3300005355 Bacteria 2220
119 Ga0070671_100159825 3300005355 Bacteria 1905
120 Ga0070671_100214880 3300005355 Bacteria 1631
121 Ga0070671_100416101 3300005355 Bacteria 1151
122 Ga0070671_100813306 3300005355 Bacteria 814
123 Ga0070674_100027776 3300005356 Bacteria 3711
124 Ga0070674_100033088 3300005356 Bacteria 3439
125 Ga0070674_100184196 3300005356 Unclassified 1602
126 Ga0070674_100935327 3300005356 Unclassified 757
127 Ga0070674_101058546 3300005356 Unclassified 714
128 Ga0070673_100000434 3300005364 Bacteria 22067
129 Ga0070673_100016374 3300005364 Bacteria 5240
130 Ga0070673_100022537 3300005364 Bacteria 4586
131 Ga0070673_100186455 3300005364 Unclassified 1779
132 Ga0070673_100294201 3300005364 Unclassified 1428
133 Ga0070688_100007537 3300005365 Bacteria 5872
134 Ga0070688_100021992 3300005365 Bacteria 3731
135 Ga0070688_100030150 3300005365 Bacteria 3253
136 Ga0070688_100076237 3300005365 Bacteria 2157
137 Ga0070688_100118777 3300005365 Bacteria 1768
138 Ga0070688_100184754 3300005365 Bacteria 1448
139 Ga0070688_100206680 3300005365 Bacteria 1376
140 Ga0070688_100249770 3300005365 Unclassified 1263
141 Ga0070688_100376408 3300005365 Bacteria 1045
142 Ga0070659_100000971 3300005366 Bacteria 21095
143 Ga0070659_100052792 3300005366 Bacteria 3198
144 Ga0070667_100006762 3300005367 Bacteria 9523
145 Ga0070667_100055129 3300005367 Bacteria 3357
146 Ga0070667_100108365 3300005367 Bacteria 2406
147 Ga0070667_100137433 3300005367 Bacteria 2137
148 Ga0070667_100247302 3300005367 Unclassified 1594
149 Ga0070667_100272922 3300005367 Unclassified 1517
150 Ga0070667_100664626 3300005367 Bacteria 962
151 Ga0070709_10217629 3300005434 Bacteria 1360
152 Ga0070709_10349913 3300005434 Bacteria 1091
153 Ga0070709_10410699 3300005434 Bacteria 1013
154 Ga0070714_100022318 3300005435 Bacteria 5190
155 Ga0070714_100050890 3300005435 Bacteria 3531
156 Ga0070714_100112238 3300005435 Bacteria 2415
157 Ga0070714_100561150 3300005435 Bacteria 1094
158 Ga0070714_100834323 3300005435 Unclassified 893
159 Ga0070713_100037190 3300005436 Bacteria 3935
160 Ga0070713_100115542 3300005436 Unclassified 2346
161 Ga0070713_100226852 3300005436 Bacteria 1696
162 Ga0070713_100258111 3300005436 Unclassified 1592
163 Ga0070713_100293681 3300005436 Bacteria 1494
164 Ga0070713_100560086 3300005436 Bacteria 1083
165 Ga0070710_10075475 3300005437 Bacteria 1954
166 Ga0070710_10082369 3300005437 Bacteria 1881
167 Ga0070710_10148035 3300005437 Unclassified 1446
168 Ga0070710_10234718 3300005437 Bacteria 1172
169 Ga0070710_10315938 3300005437 Unclassified 1024
170 Ga0070701_10153599 3300005438 Bacteria 1327
171 Ga0070711_100012799 3300005439 Bacteria 5254
172 Ga0070711_100020670 3300005439 Unclassified 4247
173 Ga0070711_100201434 3300005439 Unclassified 1536
174 Ga0070705_100128756 3300005440 Bacteria 1648
175 Ga0070705_100146728 3300005440 Bacteria 1560
176 Ga0070705_100196055 3300005440 Bacteria 1381
177 Ga0070705_100276395 3300005440 Unclassified 1192
178 Ga0070700_100039609 3300005441 Bacteria 2880
179 Ga0070694_100024137 3300005444 Bacteria 3922
180 Ga0070708_100012016 3300005445 Bacteria 7057
181 Ga0070708_100047427 3300005445 Bacteria 3795
182 Ga0070708_100072775 3300005445 Bacteria 3097
183 Ga0070708_100085529 3300005445 Bacteria 2862
184 Ga0070708_100090982 3300005445 Unclassified 2778
185 Ga0070708_100220325 3300005445 Unclassified 1779
186 Ga0070708_100242041 3300005445 Bacteria 1694
187 Ga0070708_100291344 3300005445 Bacteria 1537
188 Ga0070708_100966426 3300005445 Unclassified 799
189 Ga0070663_100007018 3300005455 Bacteria 6824
190 Ga0070663_100147391 3300005455 Bacteria 1802
191 Ga0070663_100502859 3300005455 Unclassified 1007
192 Ga0070678_100014316 3300005456 Bacteria 4999
193 Ga0070678_100096894 3300005456 Bacteria 2277
194 Ga0070678_100588886 3300005456 Unclassified 992
195 Ga0070662_100003832 3300005457 Bacteria 9417
196 Ga0070662_100043784 3300005457 Bacteria 3204
197 Ga0070662_100131592 3300005457 Bacteria 1930
198 Ga0070662_100146136 3300005457 Bacteria 1837
199 Ga0070662_100375863 3300005457 Unclassified 1169
200 Ga0070662_101040614 3300005457 Bacteria 701
201 Ga0068867_100032843 3300005459 Bacteria 3755
202 Ga0068867_100086414 3300005459 Bacteria 2373
203 Ga0068867_100109459 3300005459 Unclassified 2121
204 Ga0068867_100860567 3300005459 Bacteria 813
205 Ga0070685_10067747 3300005466 Unclassified 2106
206 Ga0070706_100000311 3300005467 Bacteria 59149
207 Ga0070706_100001900 3300005467 Bacteria 21581
208 Ga0070706_100004096 3300005467 Bacteria 14178
209 Ga0070706_100013504 3300005467 Bacteria 7554
210 Ga0070706_100014263 3300005467 Bacteria 7344
211 Ga0070706_100042062 3300005467 Bacteria 4220
212 Ga0070706_100083975 3300005467 Bacteria 2951
213 Ga0070706_100117340 3300005467 Bacteria 2479
214 Ga0070706_100132337 3300005467 Bacteria 2328
215 Ga0070706_100300489 3300005467 Unclassified 1498
216 Ga0070706_100513346 3300005467 Unclassified 1115
217 Ga0070706_100590980 3300005467 Unclassified 1032
218 Ga0070706_101010697 3300005467 Bacteria 767
219 Ga0070707_100022786 3300005468 Bacteria 5922
220 Ga0070707_100052961 3300005468 Bacteria 3891
221 Ga0070707_100062513 3300005468 Bacteria 3572
222 Ga0070707_100082066 3300005468 Unclassified 3113
223 Ga0070707_100126280 3300005468 Bacteria 2486
224 Ga0070707_100284961 3300005468 Unclassified 1605
225 Ga0070707_100329039 3300005468 Unclassified 1485
226 Ga0070707_100511374 3300005468 Bacteria 1163
227 Ga0070707_100597627 3300005468 Unclassified 1066
228 Ga0070698_100003506 3300005471 Bacteria 17260
229 Ga0070698_100025039 3300005471 Bacteria 6220
230 Ga0070698_100077092 3300005471 Unclassified 3334
231 Ga0070698_100083823 3300005471 Bacteria 3177
232 Ga0070698_100258988 3300005471 Unclassified 1672
233 Ga0070698_100263776 3300005471 Bacteria 1655
234 Ga0070699_100010688 3300005518 Bacteria 7945
235 Ga0070699_100036437 3300005518 Unclassified 4255
236 Ga0070699_100077573 3300005518 Bacteria 2892
237 Ga0070699_100135107 3300005518 Bacteria 2176
238 Ga0070679_100701639 3300005530 Bacteria 955
239 Ga0070684_100006663 3300005535 Bacteria 8952
240 Ga0070684_100041434 3300005535 Bacteria 3970
241 Ga0070684_100099186 3300005535 Unclassified 2599
242 Ga0070684_100268320 3300005535 Unclassified 1562
243 Ga0070684_100597902 3300005535 Bacteria 1025
244 Ga0070697_100002917 3300005536 Bacteria 13156
245 Ga0070697_100003353 3300005536 Bacteria 12307
246 Ga0070697_100012443 3300005536 Bacteria 6668
247 Ga0070697_100071365 3300005536 Bacteria 2848
248 Ga0070697_100074750 3300005536 Bacteria 2784
249 Ga0070697_100098708 3300005536 Bacteria 2423
250 Ga0070697_100126546 3300005536 Bacteria 2140
251 Ga0070697_100152290 3300005536 Bacteria 1949
252 Ga0070697_100242102 3300005536 Unclassified 1541
253 Ga0070697_100409997 3300005536 Bacteria 1177
254 Ga0070697_100642290 3300005536 Bacteria 934
255 Ga0068853_100000002 3300005539 Bacteria 485323
256 Ga0068853_100371264 3300005539 Unclassified 1334
257 Ga0070672_100006356 3300005543 Bacteria 7934
258 Ga0070672_100021583 3300005543 Bacteria 4715
259 Ga0070672_100189510 3300005543 Bacteria 1716
260 Ga0070672_100270691 3300005543 Unclassified 1434
261 Ga0070672_100544384 3300005543 Bacteria 1007
262 Ga0070696_100070536 3300005546 Bacteria 2458
263 Ga0070665_100033364 3300005548 Bacteria 5180
264 Ga0070665_100048215 3300005548 Bacteria 4277
265 Ga0070665_100094465 3300005548 Bacteria 2995
266 Ga0070665_100126059 3300005548 Bacteria 2563
267 Ga0070665_100539402 3300005548 Bacteria 1178
268 Ga0070704_100002924 3300005549 Bacteria 9704
269 Ga0070704_100074513 3300005549 Bacteria 2476
270 Ga0070704_100576357 3300005549 Bacteria 986
271 Ga0068855_100013156 3300005563 Bacteria 9980
272 Ga0068855_100281988 3300005563 Bacteria 1845
273 Ga0068854_100266766 3300005578 Bacteria 1373
274 Ga0068854_100541044 3300005578 Bacteria 986
275 Ga0068856_100096159 3300005614 Bacteria 2950
276 Ga0068856_100246292 3300005614 Bacteria 1802
277 Ga0068856_101426804 3300005614 Unclassified 707
278 Ga0068856_101546904 3300005614 Unclassified 677
279 Ga0070702_100086753 3300005615 Bacteria 1888
280 Ga0068859_100990974 3300005617 Bacteria 923
281 Ga0068859_101132319 3300005617 Unclassified 861
282 Ga0068864_100274762 3300005618 Bacteria 1571
283 Ga0068864_101170157 3300005618 Unclassified 767
284 Ga0068866_10112301 3300005718 Unclassified 1523
285 Ga0068863_100003600 3300005841 Bacteria 15293
286 Ga0068863_100180547 3300005841 Unclassified 2026
287 Ga0068863_100240893 3300005841 Bacteria 1746
288 Ga0068863_100536375 3300005841 Bacteria 1154
289 Ga0068858_100010197 3300005842 Bacteria 8917
290 Ga0068858_100068419 3300005842 Bacteria 3291
291 Ga0068858_100320271 3300005842 Bacteria 1482
292 Ga0068860_100000576 3300005843 Bacteria 44149
293 Ga0068860_100037757 3300005843 Bacteria 4622
294 Ga0068860_100111877 3300005843 Bacteria 2611
295 Ga0068860_100350199 3300005843 Unclassified 1453
296 Ga0068860_100400993 3300005843 Bacteria 1357
297 Ga0068860_100889964 3300005843 Bacteria 906
298 Ga0068862_100267237 3300005844 Bacteria 1563
299 Ga0081455_10001872 3300005937 Bacteria 25307
300 Ga0081455_10016935 3300005937 Bacteria 7007
301 Ga0081455_10044602 3300005937 Bacteria 3866
302 Ga0081455_10049102 3300005937 Unclassified 3640
303 Ga0081540_1000036 3300005983 Bacteria 140805
304 Ga0081540_1020870 3300005983 Bacteria 3923
305 Ga0081540_1034481 3300005983 Bacteria 2728
306 Ga0081539_10000671 3300005985 Bacteria 68678
307 Ga0081539_10001132 3300005985 Bacteria 48398
308 Ga0081539_10040243 3300005985 Bacteria 2746
309 Ga0081539_10175139 3300005985 Unclassified 1011
310 Ga0070717_10091589 3300006028 Bacteria 2567
311 Ga0070717_10093046 3300006028 Unclassified 2547
312 Ga0070717_10119455 3300006028 Bacteria 2256
313 Ga0070717_10143413 3300006028 Bacteria 2061
314 Ga0070717_10171272 3300006028 Bacteria 1888
315 Ga0070717_10183786 3300006028 Bacteria 1823
316 Ga0070717_10216627 3300006028 Unclassified 1682
317 Ga0075363_100028247 3300006048 Bacteria 2883
318 Ga0070715_10047133 3300006163 Bacteria 1835
319 Ga0070715_10052209 3300006163 Bacteria 1762
320 Ga0070716_100016121 3300006173 Unclassified 3852
321 Ga0070716_100071096 3300006173 Bacteria 2045
322 Ga0070716_100187760 3300006173 Bacteria 1363
323 Ga0070716_100326689 3300006173 Bacteria 1077
324 Ga0070716_100356862 3300006173 Unclassified 1037
325 Ga0070716_100496278 3300006173 Unclassified 899
326 Ga0070712_100103548 3300006175 Bacteria 2110
327 Ga0070712_100103973 3300006175 Unclassified 2106
328 Ga0070712_100122575 3300006175 Bacteria 1958
329 Ga0070712_100217983 3300006175 Bacteria 1509
330 Ga0070712_100302264 3300006175 Bacteria 1295
331 Ga0070712_100350858 3300006175 Unclassified 1207
332 Ga0070712_100382815 3300006175 Unclassified 1158
333 Ga0070712_100432168 3300006175 Bacteria 1093
334 Ga0070712_100537545 3300006175 Bacteria 984
335 Ga0070712_101037270 3300006175 Bacteria 710
336 Ga0075362_10000662 3300006177 Bacteria 10150
337 Ga0075362_10018163 3300006177 Unclassified 2906
338 Ga0075369_10062924 3300006186 Bacteria 1622
339 Ga0097621_100014680 3300006237 Bacteria 5869
340 Ga0097621_100035139 3300006237 Bacteria 4003
341 Ga0097621_100097958 3300006237 Bacteria 2463
342 Ga0097621_100257754 3300006237 Bacteria 1529
343 Ga0097621_100713517 3300006237 Unclassified 924
344 Ga0075370_10004090 3300006353 Bacteria 7022
345 Ga0068871_100012306 3300006358 Bacteria 6304
346 Ga0068871_100035252 3300006358 Bacteria 3974
347 Ga0068871_100097947 3300006358 Unclassified 2453
348 Ga0075428_100210081 3300006844 Unclassified 2103
349 Ga0075433_10296210 3300006852 Bacteria 1432
350 Ga0075433_10390907 3300006852 Unclassified 1227
351 Ga0075434_100698607 3300006871 Unclassified 1032
352 Ga0075434_100839157 3300006871 Bacteria 935
353 Ga0075434_100933005 3300006871 Unclassified 883
354 Ga0068865_100020657 3300006881 Bacteria 4273
355 Ga0068865_100063909 3300006881 Unclassified 2589
356 Ga0075436_100115767 3300006914 Unclassified 1873
357 Ga0075436_100464806 3300006914 Unclassified 922
358 Ga0097620_100990952 3300006931 Bacteria 923
359 Ga0097620_101132438 3300006931 Unclassified 861
360 Ga0075435_100261554 3300007076 Bacteria 1474
361 Ga0075435_100334131 3300007076 Unclassified 1298
362 Ga0099794_10060393 3300007265 Bacteria 1841
363 Ga0099795_10003178 3300007788 Bacteria 4031
364 Ga0099795_10041176 3300007788 Bacteria 1644
365 Ga0099795_10075838 3300007788 Bacteria 1277
366 Ga0099795_10199188 3300007788 Unclassified 844
367 Ga0105240_10000412 3300009093 Bacteria 79783
368 Ga0105240_10401552 3300009093 Unclassified 1543
369 Ga0111539_10172555 3300009094 Bacteria 2526
370 Ga0111539_10249144 3300009094 Bacteria 2068
371 Ga0111539_10796145 3300009094 Unclassified 1100
372 Ga0105245_10026583 3300009098 Bacteria 5096
373 Ga0105245_10283623 3300009098 Unclassified 1620
374 Ga0105245_10568739 3300009098 Unclassified 1157
375 Ga0105247_10191930 3300009101 Unclassified 1368
376 Ga0114129_10007418 3300009147 Bacteria 15610
377 Ga0114129_10162066 3300009147 Bacteria 3054
378 Ga0114129_10244078 3300009147 Bacteria 2413
379 Ga0114129_10598948 3300009147 Unclassified 1428
380 Ga0105243_10047154 3300009148 Bacteria 3391
381 Ga0105241_10118065 3300009174 Bacteria 2132
382 Ga0105241_10341507 3300009174 Unclassified 1297
383 Ga0105241_10688375 3300009174 Unclassified 932
384 Ga0105242_10086583 3300009176 Bacteria 2629
385 Ga0105242_11341877 3300009176 Bacteria 740
386 Ga0105237_10006408 3300009545 Bacteria 13060
387 Ga0105237_10215473 3300009545 Bacteria 1920
388 Ga0105237_10387062 3300009545 Bacteria 1403
389 Ga0105237_10580387 3300009545 Bacteria 1128
390 Ga0105249_10074161 3300009553 Bacteria 3149
391 Ga0099796_10029945 3300010159 Bacteria 1761
392 Ga0099796_10239664 3300010159 Bacteria 749
393 Ga0105239_10086420 3300010375 Bacteria 3457
394 Ga0105239_10134580 3300010375 Bacteria 2751
395 Ga0105239_10135294 3300010375 Bacteria 2743
396 Ga0105239_10155992 3300010375 Bacteria 2549
397 Ga0105239_10217548 3300010375 Bacteria 2142
398 Ga0105239_11156063 3300010375 Bacteria 891
399 Ga0157371_10227161 3300013102 Bacteria 1341
400 Ga0157370_10516754 3300013104 Bacteria 1096
401 Ga0157369_10441889 3300013105 Bacteria 1347
402 Ga0157369_10644028 3300013105 Bacteria 1093
403 Ga0157374_10000160 3300013296 Bacteria 62026
404 Ga0157374_10016198 3300013296 Bacteria 6549
405 Ga0157374_10033371 3300013296 Bacteria 4696
406 Ga0157374_10083550 3300013296 Unclassified 3034
407 Ga0157374_10111000 3300013296 Bacteria 2637
408 Ga0157374_10230839 3300013296 Bacteria 1818
409 Ga0157374_10267638 3300013296 Bacteria 1685
410 Ga0157374_10600091 3300013296 Unclassified 1111
411 Ga0157374_11118901 3300013296 Bacteria 808
412 Ga0157374_11437729 3300013296 Unclassified 712
413 Ga0157378_10006750 3300013297 Bacteria 10028
414 Ga0157378_10023174 3300013297 Bacteria 5464
415 Ga0157378_10033296 3300013297 Unclassified 4555
416 Ga0157378_10077204 3300013297 Bacteria 3002
417 Ga0157378_10097175 3300013297 Bacteria 2684
418 Ga0157378_10108165 3300013297 Unclassified 2545
419 Ga0157378_10202123 3300013297 Bacteria 1880
420 Ga0157378_10231751 3300013297 Unclassified 1760
421 Ga0157378_10231898 3300013297 Bacteria 1760
422 Ga0157378_10567103 3300013297 Unclassified 1143
423 Ga0157378_10616943 3300013297 Bacteria 1097
424 Ga0157378_10689553 3300013297 Unclassified 1040
425 Ga0157378_10991161 3300013297 Bacteria 874
426 Ga0163162_10008629 3300013306 Bacteria 9930
427 Ga0163162_10013145 3300013306 Bacteria 8083
428 Ga0163162_10021558 3300013306 Bacteria 6346
429 Ga0163162_10021637 3300013306 Bacteria 6334
430 Ga0163162_10043308 3300013306 Bacteria 4507
431 Ga0163162_10057606 3300013306 Bacteria 3914
432 Ga0163162_10074321 3300013306 Bacteria 3457
433 Ga0163162_10224840 3300013306 Bacteria 2006
434 Ga0163162_10351894 3300013306 Unclassified 1606
435 Ga0157372_10414364 3300013307 Bacteria 1570
436 Ga0157372_10429439 3300013307 Bacteria 1540
437 Ga0157372_11358471 3300013307 Bacteria 819
438 Ga0157375_10002485 3300013308 Bacteria 15970
439 Ga0157375_10011674 3300013308 Bacteria 7761
440 Ga0157375_10052405 3300013308 Bacteria 4011
441 Ga0157375_10063296 3300013308 Bacteria 3679
442 Ga0157375_10115628 3300013308 Bacteria 2786
443 Ga0157375_11130186 3300013308 Bacteria 918
444 Ga0157375_11380639 3300013308 Bacteria 830
445 Ga0157375_11598394 3300013308 Unclassified 771
446 Ga0163163_10119296 3300014325 Unclassified 2671
447 Ga0163163_10141245 3300014325 Bacteria 2450
448 Ga0163163_10269781 3300014325 Bacteria 1753
449 Ga0163163_10273312 3300014325 Bacteria 1741
450 Ga0157377_10048614 3300014745 Bacteria 2381
451 Ga0157379_10343869 3300014968 Bacteria 1365
452 Ga0157376_10018271 3300014969 Bacteria 5370
453 Ga0157376_10081124 3300014969 Unclassified 2784
454 Ga0157376_10091651 3300014969 Bacteria 2633
455 Ga0157376_10135143 3300014969 Bacteria 2206
456 Ga0157376_10508681 3300014969 Bacteria 1185
457 Ga0157376_10584334 3300014969 Unclassified 1110
458 Ga0163161_10005833 3300017792 Bacteria 8533
459 Ga0163161_10119730 3300017792 Unclassified 1977
460 Ga0163161_10203079 3300017792 Unclassified 1528
461 Ga0163161_10529095 3300017792 Bacteria 964
462 Ga0206350_11555172 3300020080 Unclassified 929
463 Ga0213873_10081446 3300021358 Unclassified 907
464 Ga0213872_10002738 3300021361 Bacteria 10119
465 Ga0213872_10016657 3300021361 Bacteria 3409
466 Ga0213872_10095450 3300021361 Bacteria 1328
467 Ga0213876_10000779 3300021384 Bacteria 21764
468 Ga0213876_10044348 3300021384 Bacteria 2350
469 Ga0213876_10055287 3300021384 Unclassified 2096
470 Ga0213871_10055446 3300021441 Unclassified 1095
471 Ga0207666_1001627 3300025271 Unclassified 2662
472 Ga0207666_1003597 3300025271 Bacteria 1909
473 Ga0207666_1005596 3300025271 Bacteria 1609
474 Ga0207673_1004302 3300025290 Bacteria 1697
475 Ga0209050_1006977 3300025298 Bacteria 6505
476 Ga0207697_10000116 3300025315 Bacteria 37551
477 Ga0207697_10000348 3300025315 Bacteria 25805
478 Ga0207697_10001294 3300025315 Bacteria 13739
479 Ga0207697_10001541 3300025315 Bacteria 12483
480 Ga0207697_10002095 3300025315 Bacteria 10492
481 Ga0207697_10012438 3300025315 Bacteria 3567
482 Ga0207697_10025316 3300025315 Unclassified 2426
483 Ga0207653_10026242 3300025885 Bacteria 1867
484 Ga0207682_10044496 3300025893 Bacteria 1820
485 Ga0207692_10035612 3300025898 Bacteria 2419
486 Ga0207692_10118584 3300025898 Bacteria 1478
487 Ga0207692_10165832 3300025898 Unclassified 1276
488 Ga0207692_10374500 3300025898 Unclassified 882
489 Ga0207642_10296466 3300025899 Unclassified 936
490 Ga0207688_10006712 3300025901 Bacteria 6262
491 Ga0207688_10016999 3300025901 Bacteria 3952
492 Ga0207688_10028348 3300025901 Bacteria 3080
493 Ga0207688_10091145 3300025901 Bacteria 1751
494 Ga0207680_10006888 3300025903 Bacteria 5512
495 Ga0207680_10070344 3300025903 Unclassified 2165
496 Ga0207680_10640881 3300025903 Unclassified 760
497 Ga0207647_10004861 3300025904 Bacteria 9931
498 Ga0207685_10022911 3300025905 Bacteria 2118
499 Ga0207699_10023294 3300025906 Bacteria 3368
500 Ga0207645_10001573 3300025907 Bacteria 18629
501 Ga0207645_10004457 3300025907 Bacteria 10365
502 Ga0207645_10006861 3300025907 Bacteria 8125
503 Ga0207645_10036418 3300025907 Bacteria 3159
504 Ga0207645_10175933 3300025907 Bacteria 1403
505 Ga0207645_10178030 3300025907 Bacteria 1395
506 Ga0207643_10194845 3300025908 Unclassified 1231
507 Ga0207643_10476174 3300025908 Bacteria 796
508 Ga0207705_10075617 3300025909 Bacteria 2446
509 Ga0207684_10000337 3300025910 Bacteria 65590
510 Ga0207684_10004700 3300025910 Bacteria 12810
511 Ga0207684_10011043 3300025910 Bacteria 7911
512 Ga0207684_10024895 3300025910 Bacteria 5100
513 Ga0207684_10075011 3300025910 Unclassified 2874
514 Ga0207684_10102137 3300025910 Unclassified 2451
515 Ga0207684_10104691 3300025910 Unclassified 2420
516 Ga0207684_10107589 3300025910 Bacteria 2386
517 Ga0207684_10111774 3300025910 Bacteria 2338
518 Ga0207684_10149719 3300025910 Bacteria 2008
519 Ga0207684_10194513 3300025910 Bacteria 1749
520 Ga0207684_10440190 3300025910 Unclassified 1119
521 Ga0207684_10509917 3300025910 Unclassified 1031
522 Ga0207684_10755332 3300025910 Unclassified 824
523 Ga0207654_10196502 3300025911 Bacteria 1325
524 Ga0207707_10066916 3300025912 Bacteria 3129
525 Ga0207695_10000783 3300025913 Bacteria 60141
526 Ga0207671_10020513 3300025914 Bacteria 5029
527 Ga0207671_10669159 3300025914 Bacteria 826
528 Ga0207693_10008693 3300025915 Bacteria 8305
529 Ga0207693_10015810 3300025915 Bacteria 6046
530 Ga0207693_10035674 3300025915 Bacteria 3921
531 Ga0207693_10038294 3300025915 Bacteria 3777
532 Ga0207693_10063349 3300025915 Bacteria 2896
533 Ga0207693_10084225 3300025915 Unclassified 2491
534 Ga0207693_10094418 3300025915 Bacteria 2344
535 Ga0207693_10213180 3300025915 Bacteria 1518
536 Ga0207693_10241245 3300025915 Bacteria 1419
537 Ga0207693_10382709 3300025915 Bacteria 1100
538 Ga0207693_10659598 3300025915 Bacteria 812
539 Ga0207663_10029098 3300025916 Bacteria 3240
540 Ga0207663_10031762 3300025916 Bacteria 3128
541 Ga0207663_10055206 3300025916 Bacteria 2491
542 Ga0207663_10177341 3300025916 Bacteria 1519
543 Ga0207663_10375080 3300025916 Unclassified 1082
544 Ga0207663_10743878 3300025916 Bacteria 778
545 Ga0207660_10022146 3300025917 Bacteria 4280
546 Ga0207660_10211559 3300025917 Bacteria 1519
547 Ga0207662_10042413 3300025918 Bacteria 2682
548 Ga0207662_10047832 3300025918 Bacteria 2533
549 Ga0207662_10298144 3300025918 Bacteria 1071
550 Ga0207657_10100597 3300025919 Bacteria 2400
551 Ga0207657_10204362 3300025919 Unclassified 1588
552 Ga0207657_10308443 3300025919 Bacteria 1253
553 Ga0207657_10417350 3300025919 Unclassified 1055
554 Ga0207649_10042935 3300025920 Bacteria 2761
555 Ga0207649_10249863 3300025920 Unclassified 1277
556 Ga0207652_10068891 3300025921 Unclassified 3071
557 Ga0207646_10004682 3300025922 Bacteria 14739
558 Ga0207646_10008619 3300025922 Bacteria 10191
559 Ga0207646_10053741 3300025922 Bacteria 3603
560 Ga0207646_10060600 3300025922 Bacteria 3379
561 Ga0207646_10066819 3300025922 Bacteria 3210
562 Ga0207646_10074837 3300025922 Unclassified 3025
563 Ga0207646_10113228 3300025922 Bacteria 2435
564 Ga0207646_10183571 3300025922 Unclassified 1889
565 Ga0207646_10191083 3300025922 Bacteria 1849
566 Ga0207646_10208566 3300025922 Bacteria 1764
567 Ga0207646_10258704 3300025922 Unclassified 1573
568 Ga0207646_10334473 3300025922 Bacteria 1368
569 Ga0207681_10008466 3300025923 Bacteria 6286
570 Ga0207681_10027254 3300025923 Bacteria 3693
571 Ga0207681_10038451 3300025923 Bacteria 3170
572 Ga0207681_10048813 3300025923 Bacteria 2858
573 Ga0207681_10057878 3300025923 Bacteria 2651
574 Ga0207681_10466460 3300025923 Unclassified 1029
575 Ga0207650_10045346 3300025925 Bacteria 3234
576 Ga0207650_10073429 3300025925 Bacteria 2576
577 Ga0207650_10154225 3300025925 Bacteria 1815
578 Ga0207650_10469961 3300025925 Bacteria 1048
579 Ga0207650_10576425 3300025925 Bacteria 945
580 Ga0207659_10003753 3300025926 Bacteria 9156
581 Ga0207659_10011396 3300025926 Bacteria 5615
582 Ga0207659_10028169 3300025926 Bacteria 3815
583 Ga0207659_10166408 3300025926 Unclassified 1736
584 Ga0207659_10224742 3300025926 Bacteria 1511
585 Ga0207659_10372495 3300025926 Bacteria 1189
586 Ga0207659_11132218 3300025926 Unclassified 673
587 Ga0207687_10242269 3300025927 Bacteria 1430
588 Ga0207687_10483870 3300025927 Unclassified 1031
589 Ga0207687_10756201 3300025927 Bacteria 827
590 Ga0207700_10039447 3300025928 Unclassified 3438
591 Ga0207700_10546316 3300025928 Bacteria 1028
592 Ga0207700_11091293 3300025928 Unclassified 714
593 Ga0207664_10085388 3300025929 Bacteria 2576
594 Ga0207664_10121339 3300025929 Bacteria 2187
595 Ga0207644_10009749 3300025931 Bacteria 6314
596 Ga0207644_10039292 3300025931 Bacteria 3340
597 Ga0207644_10159115 3300025931 Bacteria 1754
598 Ga0207644_10463191 3300025931 Unclassified 1042
599 Ga0207644_10504218 3300025931 Unclassified 998
600 Ga0207690_10001481 3300025932 Bacteria 14676
601 Ga0207690_10025115 3300025932 Bacteria 3737
602 Ga0207706_10008614 3300025933 Bacteria 9399
603 Ga0207706_10049321 3300025933 Bacteria 3721
604 Ga0207706_10091217 3300025933 Bacteria 2679
605 Ga0207686_10144712 3300025934 Bacteria 1647
606 Ga0207670_10003100 3300025936 Bacteria 8793
607 Ga0207670_10047628 3300025936 Bacteria 2857
608 Ga0207670_10097423 3300025936 Bacteria 2094
609 Ga0207670_10128534 3300025936 Bacteria 1852
610 Ga0207670_10150698 3300025936 Bacteria 1725
611 Ga0207669_10003408 3300025937 Bacteria 6875
612 Ga0207669_10010427 3300025937 Bacteria 4473
613 Ga0207669_10102661 3300025937 Unclassified 1895
614 Ga0207669_10151515 3300025937 Unclassified 1625
615 Ga0207669_10281672 3300025937 Bacteria 1254
616 Ga0207669_10334333 3300025937 Unclassified 1164
617 Ga0207704_10022744 3300025938 Unclassified 3365
618 Ga0207704_10118581 3300025938 Bacteria 1805
619 Ga0207704_10211105 3300025938 Unclassified 1429
620 Ga0207665_10011275 3300025939 Bacteria 5866
621 Ga0207665_10026896 3300025939 Unclassified 3800
622 Ga0207665_10035745 3300025939 Bacteria 3300
623 Ga0207665_10050971 3300025939 Bacteria 2785
624 Ga0207665_10064244 3300025939 Bacteria 2494
625 Ga0207665_10079786 3300025939 Bacteria 2250
626 Ga0207665_10117148 3300025939 Bacteria 1878
627 Ga0207691_10000945 3300025940 Bacteria 28782
628 Ga0207691_10001082 3300025940 Bacteria 27131
629 Ga0207691_10032280 3300025940 Bacteria 4883
630 Ga0207691_10227062 3300025940 Bacteria 1617
631 Ga0207711_10418830 3300025941 Bacteria 1246
632 Ga0207689_10064409 3300025942 Bacteria 3016
633 Ga0207689_10284739 3300025942 Bacteria 1369
634 Ga0207661_10007132 3300025944 Bacteria 7940
635 Ga0207661_10026830 3300025944 Unclassified 4394
636 Ga0207661_10383409 3300025944 Bacteria 1272
637 Ga0207661_10394984 3300025944 Bacteria 1253
638 Ga0207679_10308419 3300025945 Bacteria 1367
639 Ga0207679_10612049 3300025945 Bacteria 982
640 Ga0207679_11140952 3300025945 Unclassified 715
641 Ga0207667_10024015 3300025949 Bacteria 6705
642 Ga0207667_10425115 3300025949 Bacteria 1351
643 Ga0207667_10535635 3300025949 Bacteria 1185
644 Ga0207651_10020043 3300025960 Bacteria 4025
645 Ga0207651_10028201 3300025960 Bacteria 3538
646 Ga0207651_10277099 3300025960 Unclassified 1384
647 Ga0207651_10389769 3300025960 Bacteria 1183
648 Ga0207651_10775826 3300025960 Bacteria 848
649 Ga0207712_10012291 3300025961 Bacteria 5471
650 Ga0207712_10040060 3300025961 Bacteria 3213
651 Ga0207668_10011932 3300025972 Bacteria 5301
652 Ga0207668_10056103 3300025972 Bacteria 2742
653 Ga0207668_10057537 3300025972 Unclassified 2713
654 Ga0207668_10133557 3300025972 Unclassified 1898
655 Ga0207668_10186846 3300025972 Bacteria 1639
656 Ga0207668_10321354 3300025972 Bacteria 1284
657 Ga0207668_10583611 3300025972 Bacteria 972
658 Ga0207668_10937950 3300025972 Bacteria 771
659 Ga0207658_10004701 3300025986 Bacteria 9459
660 Ga0207658_10022282 3300025986 Bacteria 4409
661 Ga0207658_10067376 3300025986 Bacteria 2696
662 Ga0207658_10108410 3300025986 Bacteria 2190
663 Ga0207658_10136796 3300025986 Bacteria 1977
664 Ga0207658_10208729 3300025986 Unclassified 1635
665 Ga0207658_10241487 3300025986 Unclassified 1530
666 Ga0207658_10412705 3300025986 Bacteria 1189
667 Ga0207677_10018031 3300026023 Bacteria 4228
668 Ga0207677_10133745 3300026023 Unclassified 1887
669 Ga0207677_10218686 3300026023 Bacteria 1526
670 Ga0207677_10445762 3300026023 Bacteria 1108
671 Ga0207677_10902842 3300026023 Unclassified 796
672 Ga0207703_10009368 3300026035 Bacteria 7696
673 Ga0207703_10015594 3300026035 Bacteria 5927
674 Ga0207703_10200678 3300026035 Bacteria 1772
675 Ga0207639_10000009 3300026041 Bacteria 432727
676 Ga0207678_10001585 3300026067 Bacteria 20917
677 Ga0207708_10038619 3300026075 Bacteria 3637
678 Ga0207702_10210848 3300026078 Bacteria 1806
679 Ga0207702_10777103 3300026078 Bacteria 946
680 Ga0207641_10012427 3300026088 Bacteria 6981
681 Ga0207641_10064327 3300026088 Bacteria 3135
682 Ga0207641_10084465 3300026088 Bacteria 2764
683 Ga0207641_11067914 3300026088 Unclassified 805
684 Ga0207648_10024504 3300026089 Bacteria 5385
685 Ga0207648_10094602 3300026089 Bacteria 2613
686 Ga0207648_10122198 3300026089 Bacteria 2290
687 Ga0207648_10131773 3300026089 Bacteria 2200
688 Ga0207648_10791194 3300026089 Unclassified 882
689 Ga0207676_10582979 3300026095 Bacteria 1072
690 Ga0207675_100154766 3300026118 Bacteria 2184
691 Ga0207683_10017209 3300026121 Bacteria 6157
692 Ga0207683_10032547 3300026121 Bacteria 4529
693 Ga0207683_10086586 3300026121 Bacteria 2785
694 Ga0207683_10206441 3300026121 Bacteria 1787
695 Ga0207683_10235777 3300026121 Bacteria 1669
696 Ga0207698_10719248 3300026142 Bacteria 995
697 Ga0209179_1021633 3300027512 Bacteria 1256
698 Ga0209971_1085204 3300027682 Unclassified 770
699 Ga0209998_10023187 3300027717 Unclassified 1341
700 Ga0209974_10009094 3300027876 Bacteria 3377
701 Ga0209974_10014068 3300027876 Unclassified 2666
702 Ga0209974_10036286 3300027876 Unclassified 1637
703 Ga0268266_10008218 3300028379 Bacteria 9302
704 Ga0268266_10012253 3300028379 Bacteria 7418
705 Ga0268266_10141314 3300028379 Bacteria 2161
706 Ga0268266_10188497 3300028379 Bacteria 1882
707 Ga0268266_10331437 3300028379 Bacteria 1426
708 Ga0268265_10303422 3300028380 Bacteria 1439
709 Ga0268265_10536243 3300028380 Bacteria 1109
710 Ga0268265_10654136 3300028380 Unclassified 1010
711 Ga0268264_10001424 3300028381 Bacteria 22372
712 Ga0268264_10016515 3300028381 Bacteria 6044
713 Ga0268264_10324411 3300028381 Unclassified 1457
714 Ga0307513_10052043 3300031456 Unclassified 4412
715 Ga0307414_10133466 3300032004 Bacteria 1931
716 Ga0373929_0024211 3300035085 Unclassified 1253
717 Ga0373923_0126460 3300035111 Unclassified 1146
718 Ga0373923_0266310 3300035111 Unclassified 805
719 Ga0373945_0020838 3300035116 Bacteria 2248
720 Ga0373953_0336164 3300035117 Unclassified 661
721 Ga0373954_0262604 3300035118 Bacteria 850
722 Ga0373956_0091350 3300035119 Bacteria 1405
723 Ga0373957_0230837 3300035120 Bacteria 776
724 Ga0373943_0033870 3300035170 Bacteria 2435
725 Ga0373943_0101304 3300035170 Bacteria 1507
726 Ga0373946_0040914 3300035171 Bacteria 1899
727 Ga0373946_0064944 3300035171 Bacteria 1562
728 Ga0373946_0254646 3300035171 Bacteria 857
729 Ga0373955_0055517 3300035172 Bacteria 2170
730 Ga0373942_0139937 3300035207 Unclassified 770
731 Ga0373962_0058122 3300035242 Unclassified 1130
732 Ga0373924_0084042 3300035410 Bacteria 1357
733 Ga0373924_0109499 3300035410 Unclassified 1193
734 Ga0373931_0015102 3300035691 Bacteria 3785
735 Ga0373931_0043088 3300035691 Unclassified 2375
736 Ga0373931_0130682 3300035691 Unclassified 1445
737 Ga0373931_0667840 3300035691 Bacteria 684
738 Ga0373935_0091805 3300035692 Bacteria 1989
739 Ga0373935_0173486 3300035692 Bacteria 1476
740 Ga0373935_0256526 3300035692 Bacteria 1225
741 Ga0373927_0076041 3300035695 Bacteria 2175
742 Ga0373927_0100471 3300035695 Bacteria 1881
743 Ga0373927_0117968 3300035695 Bacteria 1731
744 Ga0373927_0180641 3300035695 Unclassified 1384
745 Ga0373927_0246803 3300035695 Bacteria 1174
746 Ga0373933_0082536 3300035724 Unclassified 1973
747 Ga0373933_0124804 3300035724 Unclassified 1615
748 Ga0373947_0143887 3300035725 Unclassified 1531
749 Ga0373947_0169472 3300035725 Bacteria 1416
750 Ga0373937_0114240 3300036401 Bacteria 2513
751 Ga0373937_0423624 3300036401 Bacteria 1263
752 Ga0373937_0502707 3300036401 Unclassified 1152
753 Ga0373925_0010936 3300037068 Bacteria 6588
754 Ga0373925_0173166 3300037068 Bacteria 1705
755 Ga0395899_0202269 3300037312 Bacteria 1384
756 Ga0395899_0207320 3300037312 Unclassified 1364
757 Ga0395900_0090143 3300037418 Bacteria 3152
758 Ga0395900_0124762 3300037418 Bacteria 2641
759 Ga0395898_0032973 3300037466 Bacteria 5170
760 Ga0395898_0426733 3300037466 Unclassified 1263
761 Ga0436364_0573940 3300037853 Bacteria 1251
762 Ga0436364_1204737 3300037853 Unclassified 1153
763 Ga0436364_1459403 3300037853 Bacteria 1703
764 Ga0395901_0001548 3300038443 Bacteria 23830
765 Ga0395901_0003735 3300038443 Bacteria 15340
766 Ga0395901_0378666 3300038443 Bacteria 1457
767 Ga0395901_0501158 3300038443 Unclassified 1236
768 Ga0395901_0724371 3300038443 Bacteria 990
769 Ga0395901_1135387 3300038443 Bacteria 750
770 Ga0436365_0379833 3300039437 Bacteria 8140
771 Ga0436365_0530931 3300039437 Bacteria 35243
772 Ga0436365_0659259 3300039437 Unclassified 3531
773 Ga0436365_0960797 3300039437 Bacteria 5182
774 Ga0436365_1112867 3300039437 Bacteria 50005
775 Ga0436365_1117644 3300039437 Bacteria 5030
776 Ga0436360_0155647 3300039438 Bacteria 2151
777 Ga0436360_1341574 3300039438 Bacteria 2674
778 Ga0436361_0589004 3300039447 Bacteria 3064
779 Ga0436361_0591984 3300039447 Bacteria 1659
780 Ga0436361_0627296 3300039447 Unclassified 1186
781 Ga0436361_0756631 3300039447 Bacteria 4682
782 Ga0436361_0765849 3300039447 Bacteria 3663
783 Ga0436363_1091559 3300039450 Bacteria 2915
784 Ga0436362_0090010 3300039453 Unclassified 897
785 Ga0436362_1255536 3300039453 Unclassified 2543
786 Ga0451798_1030054 3300041458 Bacteria 853
787 Ga0451807_1769662 3300041486 Bacteria 873
788 Ga0451839_1404823 3300041496 Unclassified 1219
789 Ga0451853_0577735 3300041512 Bacteria 2215
790 Ga0451853_4098400 3300041512 Unclassified 900
791 Ga0439448_0018515 3300042005 Bacteria 2136
792 Ga0439450_075403 3300042008 Bacteria 833
793 Ga0439451_040672 3300042009 Bacteria 933
794 Ga0439455_0000520 3300042012 Bacteria 5374
795 Ga0439455_0015615 3300042012 Bacteria 1747
796 Ga0439458_0014766 3300042157 Unclassified 1765
797 Ga0439464_0017248 3300042439 Unclassified 1957
798 Ga0466959_0483443 3300045049 Unclassified 838
799 Ga0451576_0279364 3300045051 Unclassified 1746
800 Ga0466967_0563433 3300045976 Bacteria 1122
801 Ga0466967_0870977 3300045976 Unclassified 895
802 Ga0495592_0221815 3300046454 Bacteria 1263
803 Ga0495651_0014117 3300046462 Bacteria 6176
804 Ga0495580_0250338 3300046472 Bacteria 1213
805 Ga0495605_0090490 3300046474 Unclassified 1419
806 Ga0495662_0272770 3300046476 Bacteria 833
807 Ga0495584_0108807 3300046491 Bacteria 1402
808 Ga0495584_0161081 3300046491 Unclassified 1140
809 Ga0495584_0303464 3300046491 Unclassified 811
810 Ga0495584_0361714 3300046491 Unclassified 737
811 Ga0495585_0028725 3300046492 Bacteria 3170
812 Ga0495628_0123486 3300046516 Unclassified 1984
813 Ga0495630_0142315 3300046517 Bacteria 1824
814 Ga0495643_0000443 3300046522 Bacteria 53481
815 Ga0495663_0037248 3300046525 Bacteria 1467
816 Ga0495642_0077726 3300046528 Bacteria 1394
817 Ga0495652_0048747 3300046529 Bacteria 3628
818 Ga0495587_0147204 3300046536 Unclassified 1343
819 Ga0495598_0009934 3300046537 Bacteria 2265
820 Ga0495598_0012805 3300046537 Bacteria 2067
821 Ga0495598_0122913 3300046537 Unclassified 882
822 Ga0495645_0006709 3300046543 Bacteria 7998
823 Ga0495645_0094370 3300046543 Unclassified 2134
824 Ga0495667_0087550 3300046559 Unclassified 2020
825 Ga0495667_0214586 3300046559 Bacteria 1229
826 Ga0495634_0029418 3300046642 Bacteria 3803
827 Ga0495635_0357877 3300046663 Bacteria 973
828 Ga0495659_0022858 3300046664 Unclassified 2119
829 Ga0495659_0191686 3300046664 Unclassified 836
830 Ga0495661_0216664 3300046665 Unclassified 994
831 Ga0495588_0176558 3300046674 Bacteria 1129
832 Ga0495657_0354579 3300046675 Bacteria 868
833 Ga0495599_0002744 3300046678 Bacteria 10272
834 Ga0495623_0042456 3300046679 Bacteria 2896
835 Ga0495647_0099853 3300046681 Unclassified 1201
836 Ga0495658_0083075 3300046683 Bacteria 1883
837 Ga0495669_0017438 3300046684 Unclassified 3083
838 Ga0495669_0047039 3300046684 Unclassified 1926
839 Ga0495669_0074203 3300046684 Bacteria 1555
840 Ga0495669_0192932 3300046684 Unclassified 972
841 Ga0495613_0501925 3300046689 Bacteria 817
842 Ga0495624_0122878 3300046690 Bacteria 1594
843 Ga0495674_0231750 3300047319 Unclassified 1524
844 Ga0495674_0583287 3300047319 Bacteria 887
845 Ga0495680_0297735 3300047322 Bacteria 1133
846 Ga0495680_0393522 3300047322 Bacteria 958
847 Ga0495683_0153094 3300047323 Bacteria 1072
848 Ga0495675_0059492 3300047444 Bacteria 2422
849 Ga0495675_0154776 3300047444 Bacteria 1414
850 Ga0495681_0108882 3300047470 Unclassified 1202
851 Ga0495684_0010873 3300047471 Bacteria 7037
852 Ga0495684_0037920 3300047471 Bacteria 3697
853 Ga0495602_0107304 3300048088 Unclassified 2277
854 Ga0496100_0046887 3300048903 Bacteria 2782
855 Ga0496100_0063145 3300048903 Bacteria 2447
856 Ga0496100_0443269 3300048903 Bacteria 994
857 Ga0496101_0000422 3300048904 Bacteria 27267
858 Ga0496101_0124446 3300048904 Bacteria 1953
859 Ga0496102_0054945 3300048905 Bacteria 3631
860 Ga0496102_0097697 3300048905 Bacteria 2724
861 Ga0496102_0291428 3300048905 Unclassified 1538
862 Ga0496102_0389554 3300048905 Bacteria 1311
863 Ga0496103_0031615 3300048906 Bacteria 3226
864 Ga0496104_0054985 3300048907 Unclassified 3763
865 Ga0496104_0065707 3300048907 Bacteria 3443
866 Ga0496104_0166797 3300048907 Bacteria 2112
867 Ga0496104_0228305 3300048907 Bacteria 1774
868 Ga0496104_0265953 3300048907 Bacteria 1627
869 Ga0496105_0133891 3300048908 Bacteria 2042
870 Ga0496105_0142286 3300048908 Bacteria 1974
871 Ga0496105_0212441 3300048908 Bacteria 1577
872 Ga0496105_0420953 3300048908 Bacteria 1057
873 Ga0496106_0234696 3300048909 Bacteria 1465
874 Ga0496106_0298970 3300048909 Bacteria 1291
875 Ga0496106_0327013 3300048909 Bacteria 1231
876 Ga0496106_0421414 3300048909 Bacteria 1073
877 Ga0496107_0010651 3300048910 Bacteria 6393
878 Ga0496107_0187658 3300048910 Bacteria 1536
879 Ga0496107_0845781 3300048910 Bacteria 669
880 Ga0496108_0334790 3300048911 Unclassified 1320
881 Ga0496108_0521243 3300048911 Bacteria 1038
882 Ga0496108_0990047 3300048911 Bacteria 718
883 Ga0496109_0005026 3300048912 Bacteria 11049
884 Ga0496109_0246726 3300048912 Unclassified 1681
885 Ga0496109_0254926 3300048912 Unclassified 1652
886 Ga0496109_0352420 3300048912 Unclassified 1390
887 Ga0496109_0458599 3300048912 Unclassified 1204
888 Ga0496109_0533444 3300048912 Unclassified 1107
889 Ga0496109_0745718 3300048912 Bacteria 917
890 Ga0496110_0064443 3300048913 Bacteria 3239
891 Ga0496110_0076702 3300048913 Bacteria 2972
892 Ga0496110_0237909 3300048913 Bacteria 1657
893 Ga0496110_0586688 3300048913 Unclassified 1012
894 Ga0496111_0078935 3300048914 Bacteria 2401
895 Ga0496111_0216760 3300048914 Unclassified 1422
896 Ga0496112_0020455 3300048915 Bacteria 6274
897 Ga0496112_0034027 3300048915 Bacteria 4958
898 Ga0496112_0096332 3300048915 Unclassified 2929
899 Ga0496112_0205981 3300048915 Unclassified 1925
900 Ga0496112_0276295 3300048915 Bacteria 1627
901 Ga0496112_0298988 3300048915 Bacteria 1555
902 Ga0496112_0676835 3300048915 Unclassified 960
903 Ga0496113_0040430 3300048916 Bacteria 3437
904 Ga0496113_0152026 3300048916 Unclassified 1827
905 Ga0496115_0006139 3300048918 Bacteria 8784
906 Ga0496115_0059623 3300048918 Bacteria 3073
907 Ga0496115_0098738 3300048918 Unclassified 2392
908 Ga0496115_0208927 3300048918 Bacteria 1612
909 Ga0496115_0288015 3300048918 Unclassified 1348
910 Ga0501080_0109190 3300049742 Bacteria 2564
911 nmdc:mga00v17_478168_c1 3300050491 Bacteria 808
912 nmdc:mga0k408_137531_c1 3300050493 Unclassified 1452
913 nmdc:mga0k408_236189_c1 3300050493 Unclassified 1091
914 nmdc:mga0k408_351_c1 3300050493 Bacteria 25242
915 nmdc:mga0k408_437_c1 3300050493 Bacteria 22803
916 nmdc:mga0k408_600297_c1 3300050493 Unclassified 649
917 nmdc:mga07m45_16569_c1 3300050496 Bacteria 3945
918 nmdc:mga07m45_377399_c1 3300050496 Unclassified 823
919 nmdc:mga05p37_160571_c1 3300050507 Bacteria 2745
920 nmdc:mga05p37_4003_c1 3300050507 Bacteria 17226
921 nmdc:mga09592_503002_c1 3300050508 Bacteria 1043
922 nmdc:mga08y16_570412_c1 3300050511 Bacteria 1143
923 nmdc:mga0rr50_1021417_c1 3300050513 Bacteria 704
924 nmdc:mga0rr50_285548_c1 3300050513 Unclassified 1378
925 nmdc:mga0rr50_570701_c1 3300050513 Unclassified 964
926 nmdc:mga08x19_148929_c1 3300050514 Unclassified 1584
927 nmdc:mga08x19_215332_c1 3300050514 Unclassified 1319
928 nmdc:mga0a205_881180_c1 3300050515 Unclassified 742
929 nmdc:mga0a205_938600_c1 3300050515 Unclassified 712
930 nmdc:mga0sz30_59259_c1 3300050516 Bacteria 1282
931 Ga0495601_0003313 3300053077 Bacteria 9215
932 Ga0495601_0035889 3300053077 Bacteria 3096
933 Ga0500610_0164417 3300053079 Bacteria 1101
934 Ga0495595_0344038 3300053084 Bacteria 752
935 Ga0495619_0616924 3300053085 Bacteria 741
936 Ga0500556_0001824 3300053104 Bacteria 7800
937 Ga0500642_0002353 3300053130 Bacteria 5534
938 Ga0500616_0003203 3300053153 Bacteria 12709
939 Ga0495657_0193567
940 CNXas_1000206
941 JGI24032J14994_101162
942 JGI24737J22298_10012645
943 JGI24744J21845_10012038
944 JGI24035J26624_1000141
945 JGI24035J26624_1007613
946 JGI24035J26624_1011137
947 JGI25406J46586_10000087
948 JGI25406J46586_10095645
949 JGI25404J52841_10004829
950 JGI25405J52794_10000412
951 JGI25405J52794_10002813
952 Ga0065714_10094929
953 Ga0065704_10004850
954 Ga0065704_10009573
955 Ga0065704_10022829
956 Ga0065704_10073950
957 Ga0065704_10091739
958 Ga0065712_10001692
959 Ga0065712_10004664
960 Ga0065712_10006386
961 Ga0065712_10016478
962 Ga0065712_10026337
963 Ga0065712_10116148
964 Ga0065712_10137998
965 Ga0065712_10205871
966 Ga0065712_10227849
967 Ga0065712_10266013
968 Ga0065715_10000709
969 Ga0065715_10001727
970 Ga0065715_10089933
971 Ga0065715_10119901
972 Ga0065715_10167516
973 Ga0065715_10174334
974 Ga0065715_10255269
975 Ga0065715_10298847
976 Ga0065715_10327626
977 Ga0065715_10368088
978 Ga0065715_10369071
979 Ga0065715_10426084
980 Ga0065707_10003005
981 Ga0065707_10005953
982 Ga0065707_10013106
983 Ga0070658_10005882
984 Ga0070658_10136660
985 Ga0070658_10314682
986 Ga0070658_10598176
987 Ga0070676_10007273
988 Ga0070676_10013117
989 Ga0070676_10025549
990 Ga0070676_10171591
991 Ga0070676_10392529
992 Ga0070676_10875274
993 Ga0070683_100006008
994 Ga0070683_100010449
995 Ga0070683_100114079
996 Ga0070683_100359518
997 Ga0070690_100027697
998 Ga0070690_100236802
999 Ga0070690_100582137
1000 Ga0070690_100637363
1001 Ga0070670_100014931
1002 Ga0070670_100023992
1003 Ga0070670_100052927
1004 Ga0070670_100122580
1005 Ga0070670_100547513
1006 Ga0070677_10003178
1007 Ga0070677_10118311
1008 Ga0068869_100061991
1009 Ga0070666_10009111
1010 Ga0070666_10014419
1011 Ga0070666_10063078
1012 Ga0070666_10115524
1013 Ga0070666_10156365
1014 Ga0070680_100026698
1015 Ga0070680_100558357
1016 Ga0070682_100075346
1017 Ga0068868_100099890
1018 Ga0068868_100109169
1019 Ga0068868_100144993
1020 Ga0070660_100083058
1021 Ga0070660_100123059
1022 Ga0070660_100138468
1023 Ga0070660_100306739
1024 Ga0070660_100436038
1025 Ga0070689_100000978
1026 Ga0070689_100075259
1027 Ga0070689_100085949
1028 Ga0070689_100128485
1029 Ga0070691_10242126
1030 Ga0070687_100013691
1031 Ga0070687_100027127
1032 Ga0070661_100087820
1033 Ga0070661_100211272
1034 Ga0070661_100343187
1035 Ga0070668_100007657
1036 Ga0070668_100023570
1037 Ga0070668_100051505
1038 Ga0070668_100165243
1039 Ga0070669_100002655
1040 Ga0070669_100002855
1041 Ga0070669_100078802
1042 Ga0070669_100149960
1043 Ga0070675_100003712
1044 Ga0070675_100009595
1045 Ga0070675_100012255
1046 Ga0070675_100051731
1047 Ga0070675_100063293
1048 Ga0070675_100071895
1049 Ga0070675_100092059
1050 Ga0070675_100333325
1051 Ga0070675_100380263
1052 Ga0070675_100527999
1053 Ga0070671_100022030
1054 Ga0070671_100027480
1055 Ga0070671_100095441
1056 Ga0070671_100119176
1057 Ga0070671_100159825
1058 Ga0070671_100214880
1059 Ga0070671_100416101
1060 Ga0070671_100813306
1061 Ga0070674_100027776
1062 Ga0070674_100033088
1063 Ga0070674_100184196
1064 Ga0070674_100935327
1065 Ga0070674_101058546
1066 Ga0070673_100000434
1067 Ga0070673_100016374
1068 Ga0070673_100022537
1069 Ga0070673_100186455
1070 Ga0070673_100294201
1071 Ga0070688_100007537
1072 Ga0070688_100021992
1073 Ga0070688_100030150
1074 Ga0070688_100076237
1075 Ga0070688_100118777
1076 Ga0070688_100184754
1077 Ga0070688_100206680
1078 Ga0070688_100249770
1079 Ga0070688_100376408
1080 Ga0070659_100000971
1081 Ga0070659_100052792
1082 Ga0070667_100006762
1083 Ga0070667_100055129
1084 Ga0070667_100108365
1085 Ga0070667_100137433
1086 Ga0070667_100247302
1087 Ga0070667_100272922
1088 Ga0070667_100664626
1089 Ga0070709_10217629
1090 Ga0070709_10349913
1091 Ga0070709_10410699
1092 Ga0070714_100022318
1093 Ga0070714_100050890
1094 Ga0070714_100112238
1095 Ga0070714_100561150
1096 Ga0070714_100834323
1097 Ga0070713_100037190
1098 Ga0070713_100115542
1099 Ga0070713_100226852
1100 Ga0070713_100258111
1101 Ga0070713_100293681
1102 Ga0070713_100560086
1103 Ga0070710_10075475
1104 Ga0070710_10082369
1105 Ga0070710_10148035
1106 Ga0070710_10234718
1107 Ga0070710_10315938
1108 Ga0070701_10153599
1109 Ga0070711_100012799
1110 Ga0070711_100020670
1111 Ga0070711_100201434
1112 Ga0070705_100128756
1113 Ga0070705_100146728
1114 Ga0070705_100196055
1115 Ga0070705_100276395
1116 Ga0070700_100039609
1117 Ga0070694_100024137
1118 Ga0070708_100012016
1119 Ga0070708_100047427
1120 Ga0070708_100072775
1121 Ga0070708_100085529
1122 Ga0070708_100090982
1123 Ga0070708_100220325
1124 Ga0070708_100242041
1125 Ga0070708_100291344
1126 Ga0070708_100966426
1127 Ga0070663_100007018
1128 Ga0070663_100147391
1129 Ga0070663_100502859
1130 Ga0070678_100014316
1131 Ga0070678_100096894
1132 Ga0070678_100588886
1133 Ga0070662_100003832
1134 Ga0070662_100043784
1135 Ga0070662_100131592
1136 Ga0070662_100146136
1137 Ga0070662_100375863
1138 Ga0070662_101040614
1139 Ga0068867_100032843
1140 Ga0068867_100086414
1141 Ga0068867_100109459
1142 Ga0068867_100860567
1143 Ga0070685_10067747
1144 Ga0070706_100000311
1145 Ga0070706_100001900
1146 Ga0070706_100004096
1147 Ga0070706_100013504
1148 Ga0070706_100014263
1149 Ga0070706_100042062
1150 Ga0070706_100083975
1151 Ga0070706_100117340
1152 Ga0070706_100132337
1153 Ga0070706_100300489
1154 Ga0070706_100513346
1155 Ga0070706_100590980
1156 Ga0070706_101010697
1157 Ga0070707_100022786
1158 Ga0070707_100052961
1159 Ga0070707_100062513
1160 Ga0070707_100082066
1161 Ga0070707_100126280
1162 Ga0070707_100284961
1163 Ga0070707_100329039
1164 Ga0070707_100511374
1165 Ga0070707_100597627
1166 Ga0070698_100003506
1167 Ga0070698_100025039
1168 Ga0070698_100077092
1169 Ga0070698_100083823
1170 Ga0070698_100258988
1171 Ga0070698_100263776
1172 Ga0070699_100010688
1173 Ga0070699_100036437
1174 Ga0070699_100077573
1175 Ga0070699_100135107
1176 Ga0070679_100701639
1177 Ga0070684_100006663
1178 Ga0070684_100041434
1179 Ga0070684_100099186
1180 Ga0070684_100268320
1181 Ga0070684_100597902
1182 Ga0070697_100002917
1183 Ga0070697_100003353
1184 Ga0070697_100012443
1185 Ga0070697_100071365
1186 Ga0070697_100074750
1187 Ga0070697_100098708
1188 Ga0070697_100126546
1189 Ga0070697_100152290
1190 Ga0070697_100242102
1191 Ga0070697_100409997
1192 Ga0070697_100642290
1193 Ga0068853_100000002
1194 Ga0068853_100371264
1195 Ga0070672_100006356
1196 Ga0070672_100021583
1197 Ga0070672_100189510
1198 Ga0070672_100270691
1199 Ga0070672_100544384
1200 Ga0070696_100070536
1201 Ga0070665_100033364
1202 Ga0070665_100048215
1203 Ga0070665_100094465
1204 Ga0070665_100126059
1205 Ga0070665_100539402
1206 Ga0070704_100002924
1207 Ga0070704_100074513
1208 Ga0070704_100576357
1209 Ga0068855_100013156
1210 Ga0068855_100281988
1211 Ga0068854_100266766
1212 Ga0068854_100541044
1213 Ga0068856_100096159
1214 Ga0068856_100246292
1215 Ga0068856_101426804
1216 Ga0068856_101546904
1217 Ga0070702_100086753
1218 Ga0068859_100990974
1219 Ga0068859_101132319
1220 Ga0068864_100274762
1221 Ga0068864_101170157
1222 Ga0068866_10112301
1223 Ga0068863_100003600
1224 Ga0068863_100180547
1225 Ga0068863_100240893
1226 Ga0068863_100536375
1227 Ga0068858_100010197
1228 Ga0068858_100068419
1229 Ga0068858_100320271
1230 Ga0068860_100000576
1231 Ga0068860_100037757
1232 Ga0068860_100111877
1233 Ga0068860_100350199
1234 Ga0068860_100400993
1235 Ga0068860_100889964
1236 Ga0068862_100267237
1237 Ga0081455_10001872
1238 Ga0081455_10016935
1239 Ga0081455_10044602
1240 Ga0081455_10049102
1241 Ga0081540_1000036
1242 Ga0081540_1020870
1243 Ga0081540_1034481
1244 Ga0081539_10000671
1245 Ga0081539_10001132
1246 Ga0081539_10040243
1247 Ga0081539_10175139
1248 Ga0070717_10091589
1249 Ga0070717_10093046
1250 Ga0070717_10119455
1251 Ga0070717_10143413
1252 Ga0070717_10171272
1253 Ga0070717_10183786
1254 Ga0070717_10216627
1255 Ga0075363_100028247
1256 Ga0070715_10047133
1257 Ga0070715_10052209
1258 Ga0070716_100016121
1259 Ga0070716_100071096
1260 Ga0070716_100187760
1261 Ga0070716_100326689
1262 Ga0070716_100356862
1263 Ga0070716_100496278
1264 Ga0070712_100103548
1265 Ga0070712_100103973
1266 Ga0070712_100122575
1267 Ga0070712_100217983
1268 Ga0070712_100302264
1269 Ga0070712_100350858
1270 Ga0070712_100382815
1271 Ga0070712_100432168
1272 Ga0070712_100537545
1273 Ga0070712_101037270
1274 Ga0075362_10000662
1275 Ga0075362_10018163
1276 Ga0075369_10062924
1277 Ga0097621_100014680
1278 Ga0097621_100035139
1279 Ga0097621_100097958
1280 Ga0097621_100257754
1281 Ga0097621_100713517
1282 Ga0075370_10004090
1283 Ga0068871_100012306
1284 Ga0068871_100035252
1285 Ga0068871_100097947
1286 Ga0075428_100210081
1287 Ga0075433_10296210
1288 Ga0075433_10390907
1289 Ga0075434_100698607
1290 Ga0075434_100839157
1291 Ga0075434_100933005
1292 Ga0068865_100020657
1293 Ga0068865_100063909
1294 Ga0075436_100115767
1295 Ga0075436_100464806
1296 Ga0097620_100990952
1297 Ga0097620_101132438
1298 Ga0075435_100261554
1299 Ga0075435_100334131
1300 Ga0099794_10060393
1301 Ga0099795_10003178
1302 Ga0099795_10041176
1303 Ga0099795_10075838
1304 Ga0099795_10199188
1305 Ga0105240_10000412
1306 Ga0105240_10401552
1307 Ga0111539_10172555
1308 Ga0111539_10249144
1309 Ga0111539_10796145
1310 Ga0105245_10026583
1311 Ga0105245_10283623
1312 Ga0105245_10568739
1313 Ga0105247_10191930
1314 Ga0114129_10007418
1315 Ga0114129_10162066
1316 Ga0114129_10244078
1317 Ga0114129_10598948
1318 Ga0105243_10047154
1319 Ga0105241_10118065
1320 Ga0105241_10341507
1321 Ga0105241_10688375
1322 Ga0105242_10086583
1323 Ga0105242_11341877
1324 Ga0105237_10006408
1325 Ga0105237_10215473
1326 Ga0105237_10387062
1327 Ga0105237_10580387
1328 Ga0105249_10074161
1329 Ga0099796_10029945
1330 Ga0099796_10239664
1331 Ga0105239_10086420
1332 Ga0105239_10134580
1333 Ga0105239_10135294
1334 Ga0105239_10155992
1335 Ga0105239_10217548
1336 Ga0105239_11156063
1337 Ga0157371_10227161
1338 Ga0157370_10516754
1339 Ga0157369_10441889
1340 Ga0157369_10644028
1341 Ga0157374_10000160
1342 Ga0157374_10016198
1343 Ga0157374_10033371
1344 Ga0157374_10083550
1345 Ga0157374_10111000
1346 Ga0157374_10230839
1347 Ga0157374_10267638
1348 Ga0157374_10600091
1349 Ga0157374_11118901
1350 Ga0157374_11437729
1351 Ga0157378_10006750
1352 Ga0157378_10023174
1353 Ga0157378_10033296
1354 Ga0157378_10077204
1355 Ga0157378_10097175
1356 Ga0157378_10108165
1357 Ga0157378_10202123
1358 Ga0157378_10231751
1359 Ga0157378_10231898
1360 Ga0157378_10567103
1361 Ga0157378_10616943
1362 Ga0157378_10689553
1363 Ga0157378_10991161
1364 Ga0163162_10008629
1365 Ga0163162_10013145
1366 Ga0163162_10021558
1367 Ga0163162_10021637
1368 Ga0163162_10043308
1369 Ga0163162_10057606
1370 Ga0163162_10074321
1371 Ga0163162_10224840
1372 Ga0163162_10351894
1373 Ga0157372_10414364
1374 Ga0157372_10429439
1375 Ga0157372_11358471
1376 Ga0157375_10002485
1377 Ga0157375_10011674
1378 Ga0157375_10052405
1379 Ga0157375_10063296
1380 Ga0157375_10115628
1381 Ga0157375_11130186
1382 Ga0157375_11380639
1383 Ga0157375_11598394
1384 Ga0163163_10119296
1385 Ga0163163_10141245
1386 Ga0163163_10269781
1387 Ga0163163_10273312
1388 Ga0157377_10048614
1389 Ga0157379_10343869
1390 Ga0157376_10018271
1391 Ga0157376_10081124
1392 Ga0157376_10091651
1393 Ga0157376_10135143
1394 Ga0157376_10508681
1395 Ga0157376_10584334
1396 Ga0163161_10005833
1397 Ga0163161_10119730
1398 Ga0163161_10203079
1399 Ga0163161_10529095
1400 Ga0206350_11555172
1401 Ga0213873_10081446
1402 Ga0213872_10002738
1403 Ga0213872_10016657
1404 Ga0213872_10095450
1405 Ga0213876_10000779
1406 Ga0213876_10044348
1407 Ga0213876_10055287
1408 Ga0213871_10055446
1409 Ga0207666_1001627
1410 Ga0207666_1003597
1411 Ga0207666_1005596
1412 Ga0207673_1004302
1413 Ga0209050_1006977
1414 Ga0207697_10000116
1415 Ga0207697_10000348
1416 Ga0207697_10001294
1417 Ga0207697_10001541
1418 Ga0207697_10002095
1419 Ga0207697_10012438
1420 Ga0207697_10025316
1421 Ga0207653_10026242
1422 Ga0207682_10044496
1423 Ga0207692_10035612
1424 Ga0207692_10118584
1425 Ga0207692_10165832
1426 Ga0207692_10374500
1427 Ga0207642_10296466
1428 Ga0207688_10006712
1429 Ga0207688_10016999
1430 Ga0207688_10028348
1431 Ga0207688_10091145
1432 Ga0207680_10006888
1433 Ga0207680_10070344
1434 Ga0207680_10640881
1435 Ga0207647_10004861
1436 Ga0207685_10022911
1437 Ga0207699_10023294
1438 Ga0207645_10001573
1439 Ga0207645_10004457
1440 Ga0207645_10006861
1441 Ga0207645_10036418
1442 Ga0207645_10175933
1443 Ga0207645_10178030
1444 Ga0207643_10194845
1445 Ga0207643_10476174
1446 Ga0207705_10075617
1447 Ga0207684_10000337
1448 Ga0207684_10004700
1449 Ga0207684_10011043
1450 Ga0207684_10024895
1451 Ga0207684_10075011
1452 Ga0207684_10102137
1453 Ga0207684_10104691
1454 Ga0207684_10107589
1455 Ga0207684_10111774
1456 Ga0207684_10149719
1457 Ga0207684_10194513
1458 Ga0207684_10440190
1459 Ga0207684_10509917
1460 Ga0207684_10755332
1461 Ga0207654_10196502
1462 Ga0207707_10066916
1463 Ga0207695_10000783
1464 Ga0207671_10020513
1465 Ga0207671_10669159
1466 Ga0207693_10008693
1467 Ga0207693_10015810
1468 Ga0207693_10035674
1469 Ga0207693_10038294
1470 Ga0207693_10063349
1471 Ga0207693_10084225
1472 Ga0207693_10094418
1473 Ga0207693_10213180
1474 Ga0207693_10241245
1475 Ga0207693_10382709
1476 Ga0207693_10659598
1477 Ga0207663_10029098
1478 Ga0207663_10031762
1479 Ga0207663_10055206
1480 Ga0207663_10177341
1481 Ga0207663_10375080
1482 Ga0207663_10743878
1483 Ga0207660_10022146
1484 Ga0207660_10211559
1485 Ga0207662_10042413
1486 Ga0207662_10047832
1487 Ga0207662_10298144
1488 Ga0207657_10100597
1489 Ga0207657_10204362
1490 Ga0207657_10308443
1491 Ga0207657_10417350
1492 Ga0207649_10042935
1493 Ga0207649_10249863
1494 Ga0207652_10068891
1495 Ga0207646_10004682
1496 Ga0207646_10008619
1497 Ga0207646_10053741
1498 Ga0207646_10060600
1499 Ga0207646_10066819
1500 Ga0207646_10074837
1501 Ga0207646_10113228
1502 Ga0207646_10183571
1503 Ga0207646_10191083
1504 Ga0207646_10208566
1505 Ga0207646_10258704
1506 Ga0207646_10334473
1507 Ga0207681_10008466
1508 Ga0207681_10027254
1509 Ga0207681_10038451
1510 Ga0207681_10048813
1511 Ga0207681_10057878
1512 Ga0207681_10466460
1513 Ga0207650_10045346
1514 Ga0207650_10073429
1515 Ga0207650_10154225
1516 Ga0207650_10469961
1517 Ga0207650_10576425
1518 Ga0207659_10003753
1519 Ga0207659_10011396
1520 Ga0207659_10028169
1521 Ga0207659_10166408
1522 Ga0207659_10224742
1523 Ga0207659_10372495
1524 Ga0207659_11132218
1525 Ga0207687_10242269
1526 Ga0207687_10483870
1527 Ga0207687_10756201
1528 Ga0207700_10039447
1529 Ga0207700_10546316
1530 Ga0207700_11091293
1531 Ga0207664_10085388
1532 Ga0207664_10121339
1533 Ga0207644_10009749
1534 Ga0207644_10039292
1535 Ga0207644_10159115
1536 Ga0207644_10463191
1537 Ga0207644_10504218
1538 Ga0207690_10001481
1539 Ga0207690_10025115
1540 Ga0207706_10008614
1541 Ga0207706_10049321
1542 Ga0207706_10091217
1543 Ga0207686_10144712
1544 Ga0207670_10003100
1545 Ga0207670_10047628
1546 Ga0207670_10097423
1547 Ga0207670_10128534
1548 Ga0207670_10150698
1549 Ga0207669_10003408
1550 Ga0207669_10010427
1551 Ga0207669_10102661
1552 Ga0207669_10151515
1553 Ga0207669_10281672
1554 Ga0207669_10334333
1555 Ga0207704_10022744
1556 Ga0207704_10118581
1557 Ga0207704_10211105
1558 Ga0207665_10011275
1559 Ga0207665_10026896
1560 Ga0207665_10035745
1561 Ga0207665_10050971
1562 Ga0207665_10064244
1563 Ga0207665_10079786
1564 Ga0207665_10117148
1565 Ga0207691_10000945
1566 Ga0207691_10001082
1567 Ga0207691_10032280
1568 Ga0207691_10227062
1569 Ga0207711_10418830
1570 Ga0207689_10064409
1571 Ga0207689_10284739
1572 Ga0207661_10007132
1573 Ga0207661_10026830
1574 Ga0207661_10383409
1575 Ga0207661_10394984
1576 Ga0207679_10308419
1577 Ga0207679_10612049
1578 Ga0207679_11140952
1579 Ga0207667_10024015
1580 Ga0207667_10425115
1581 Ga0207667_10535635
1582 Ga0207651_10020043
1583 Ga0207651_10028201
1584 Ga0207651_10277099
1585 Ga0207651_10389769
1586 Ga0207651_10775826
1587 Ga0207712_10012291
1588 Ga0207712_10040060
1589 Ga0207668_10011932
1590 Ga0207668_10056103
1591 Ga0207668_10057537
1592 Ga0207668_10133557
1593 Ga0207668_10186846
1594 Ga0207668_10321354
1595 Ga0207668_10583611
1596 Ga0207668_10937950
1597 Ga0207658_10004701
1598 Ga0207658_10022282
1599 Ga0207658_10067376
1600 Ga0207658_10108410
1601 Ga0207658_10136796
1602 Ga0207658_10208729
1603 Ga0207658_10241487
1604 Ga0207658_10412705
1605 Ga0207677_10018031
1606 Ga0207677_10133745
1607 Ga0207677_10218686
1608 Ga0207677_10445762
1609 Ga0207677_10902842
1610 Ga0207703_10009368
1611 Ga0207703_10015594
1612 Ga0207703_10200678
1613 Ga0207639_10000009
1614 Ga0207678_10001585
1615 Ga0207708_10038619
1616 Ga0207702_10210848
1617 Ga0207702_10777103
1618 Ga0207641_10012427
1619 Ga0207641_10064327
1620 Ga0207641_10084465
1621 Ga0207641_11067914
1622 Ga0207648_10024504
1623 Ga0207648_10094602
1624 Ga0207648_10122198
1625 Ga0207648_10131773
1626 Ga0207648_10791194
1627 Ga0207676_10582979
1628 Ga0207675_100154766
1629 Ga0207683_10017209
1630 Ga0207683_10032547
1631 Ga0207683_10086586
1632 Ga0207683_10206441
1633 Ga0207683_10235777
1634 Ga0207698_10719248
1635 Ga0209179_1021633
1636 Ga0209971_1085204
1637 Ga0209998_10023187
1638 Ga0209974_10009094
1639 Ga0209974_10014068
1640 Ga0209974_10036286
1641 Ga0268266_10008218
1642 Ga0268266_10012253
1643 Ga0268266_10141314
1644 Ga0268266_10188497
1645 Ga0268266_10331437
1646 Ga0268265_10303422
1647 Ga0268265_10536243
1648 Ga0268265_10654136
1649 Ga0268264_10001424
1650 Ga0268264_10016515
1651 Ga0268264_10324411
1652 Ga0307513_10052043
1653 Ga0307414_10133466
1654 Ga0373929_0024211
1655 Ga0373923_0126460
1656 Ga0373923_0266310
1657 Ga0373945_0020838
1658 Ga0373953_0336164
1659 Ga0373954_0262604
1660 Ga0373956_0091350
1661 Ga0373957_0230837
1662 Ga0373943_0033870
1663 Ga0373943_0101304
1664 Ga0373946_0040914
1665 Ga0373946_0064944
1666 Ga0373946_0254646
1667 Ga0373955_0055517
1668 Ga0373942_0139937
1669 Ga0373962_0058122
1670 Ga0373924_0084042
1671 Ga0373924_0109499
1672 Ga0373931_0015102
1673 Ga0373931_0043088
1674 Ga0373931_0130682
1675 Ga0373931_0667840
1676 Ga0373935_0091805
1677 Ga0373935_0173486
1678 Ga0373935_0256526
1679 Ga0373927_0076041
1680 Ga0373927_0100471
1681 Ga0373927_0117968
1682 Ga0373927_0180641
1683 Ga0373927_0246803
1684 Ga0373933_0082536
1685 Ga0373933_0124804
1686 Ga0373947_0143887
1687 Ga0373947_0169472
1688 Ga0373937_0114240
1689 Ga0373937_0423624
1690 Ga0373937_0502707
1691 Ga0373925_0010936
1692 Ga0373925_0173166
1693 Ga0395899_0202269
1694 Ga0395899_0207320
1695 Ga0395900_0090143
1696 Ga0395900_0124762
1697 Ga0395898_0032973
1698 Ga0395898_0426733
1699 Ga0436364_0573940
1700 Ga0436364_1204737
1701 Ga0436364_1459403
1702 Ga0395901_0001548
1703 Ga0395901_0003735
1704 Ga0395901_0378666
1705 Ga0395901_0501158
1706 Ga0395901_0724371
1707 Ga0395901_1135387
1708 Ga0436365_0379833
1709 Ga0436365_0530931
1710 Ga0436365_0659259
1711 Ga0436365_0960797
1712 Ga0436365_1112867
1713 Ga0436365_1117644
1714 Ga0436360_0155647
1715 Ga0436360_1341574
1716 Ga0436361_0589004
1717 Ga0436361_0591984
1718 Ga0436361_0627296
1719 Ga0436361_0756631
1720 Ga0436361_0765849
1721 Ga0436363_1091559
1722 Ga0436362_0090010
1723 Ga0436362_1255536
1724 Ga0451798_1030054
1725 Ga0451807_1769662
1726 Ga0451839_1404823
1727 Ga0451853_0577735
1728 Ga0451853_4098400
1729 Ga0439448_0018515
1730 Ga0439450_075403
1731 Ga0439451_040672
1732 Ga0439455_0000520
1733 Ga0439455_0015615
1734 Ga0439458_0014766
1735 Ga0439464_0017248
1736 Ga0466959_0483443
1737 Ga0451576_0279364
1738 Ga0466967_0563433
1739 Ga0466967_0870977
1740 Ga0495592_0221815
1741 Ga0495651_0014117
1742 Ga0495580_0250338
1743 Ga0495605_0090490
1744 Ga0495662_0272770
1745 Ga0495584_0108807
1746 Ga0495584_0161081
1747 Ga0495584_0303464
1748 Ga0495584_0361714
1749 Ga0495585_0028725
1750 Ga0495628_0123486
1751 Ga0495630_0142315
1752 Ga0495643_0000443
1753 Ga0495663_0037248
1754 Ga0495642_0077726
1755 Ga0495652_0048747
1756 Ga0495587_0147204
1757 Ga0495598_0009934
1758 Ga0495598_0012805
1759 Ga0495598_0122913
1760 Ga0495645_0006709
1761 Ga0495645_0094370
1762 Ga0495667_0087550
1763 Ga0495667_0214586
1764 Ga0495634_0029418
1765 Ga0495635_0357877
1766 Ga0495659_0022858
1767 Ga0495659_0191686
1768 Ga0495661_0216664
1769 Ga0495588_0176558
1770 Ga0495657_0354579
1771 Ga0495599_0002744
1772 Ga0495623_0042456
1773 Ga0495647_0099853
1774 Ga0495658_0083075
1775 Ga0495669_0017438
1776 Ga0495669_0047039
1777 Ga0495669_0074203
1778 Ga0495669_0192932
1779 Ga0495613_0501925
1780 Ga0495624_0122878
1781 Ga0495674_0231750
1782 Ga0495674_0583287
1783 Ga0495680_0297735
1784 Ga0495680_0393522
1785 Ga0495683_0153094
1786 Ga0495675_0059492
1787 Ga0495675_0154776
1788 Ga0495681_0108882
1789 Ga0495684_0010873
1790 Ga0495684_0037920
1791 Ga0495602_0107304
1792 Ga0496100_0046887
1793 Ga0496100_0063145
1794 Ga0496100_0443269
1795 Ga0496101_0000422
1796 Ga0496101_0124446
1797 Ga0496102_0054945
1798 Ga0496102_0097697
1799 Ga0496102_0291428
1800 Ga0496102_0389554
1801 Ga0496103_0031615
1802 Ga0496104_0054985
1803 Ga0496104_0065707
1804 Ga0496104_0166797
1805 Ga0496104_0228305
1806 Ga0496104_0265953
1807 Ga0496105_0133891
1808 Ga0496105_0142286
1809 Ga0496105_0212441
1810 Ga0496105_0420953
1811 Ga0496106_0234696
1812 Ga0496106_0298970
1813 Ga0496106_0327013
1814 Ga0496106_0421414
1815 Ga0496107_0010651
1816 Ga0496107_0187658
1817 Ga0496107_0845781
1818 Ga0496108_0334790
1819 Ga0496108_0521243
1820 Ga0496108_0990047
1821 Ga0496109_0005026
1822 Ga0496109_0246726
1823 Ga0496109_0254926
1824 Ga0496109_0352420
1825 Ga0496109_0458599
1826 Ga0496109_0533444
1827 Ga0496109_0745718
1828 Ga0496110_0064443
1829 Ga0496110_0076702
1830 Ga0496110_0237909
1831 Ga0496110_0586688
1832 Ga0496111_0078935
1833 Ga0496111_0216760
1834 Ga0496112_0020455
1835 Ga0496112_0034027
1836 Ga0496112_0096332
1837 Ga0496112_0205981
1838 Ga0496112_0276295
1839 Ga0496112_0298988
1840 Ga0496112_0676835
1841 Ga0496113_0040430
1842 Ga0496113_0152026
1843 Ga0496115_0006139
1844 Ga0496115_0059623
1845 Ga0496115_0098738
1846 Ga0496115_0208927
1847 Ga0496115_0288015
1848 Ga0501080_0109190
1849 nmdc:mga00v17_478168_c1
1850 nmdc:mga0k408_137531_c1
1851 nmdc:mga0k408_236189_c1
1852 nmdc:mga0k408_351_c1
1853 nmdc:mga0k408_437_c1
1854 nmdc:mga0k408_600297_c1
1855 nmdc:mga07m45_16569_c1
1856 nmdc:mga07m45_377399_c1
1857 nmdc:mga05p37_160571_c1
1858 nmdc:mga05p37_4003_c1
1859 nmdc:mga09592_503002_c1
1860 nmdc:mga08y16_570412_c1
1861 nmdc:mga0rr50_1021417_c1
1862 nmdc:mga0rr50_285548_c1
1863 nmdc:mga0rr50_570701_c1
1864 nmdc:mga08x19_148929_c1
1865 nmdc:mga08x19_215332_c1
1866 nmdc:mga0a205_881180_c1
1867 nmdc:mga0a205_938600_c1
1868 nmdc:mga0sz30_59259_c1
1869 Ga0495601_0003313
1870 Ga0495601_0035889
1871 Ga0500610_0164417
1872 Ga0495595_0344038
1873 Ga0495619_0616924
1874 Ga0500556_0001824
1875 Ga0500642_0002353
1876 Ga0500616_0003203

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

32

100

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

145

194

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

139

192

0.97

PF07638

Sigma70_ECF

ECF sigma factor

9

198

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.974 156 191
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9619 140 194
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9609 10 102
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9586 137 192
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9556 137 192
ID Description Score Start End Superfamily
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9806 15 96 1.10.1740.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9682 143 194 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 140 192 1.10.10.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9672 12 102 1.10.1740.10
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9634 143 196 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V6H3B2-F1-model_v4 RNA polymerase subunit sigma 0.9331 1 97 GO:0006352
GO:0016987
AF-A0A2V6H3B2-F1-model_v4 RNA polymerase subunit sigma 0.9143 1 97 GO:0006352
GO:0016987
AF-A0A2V5L354-F1-model_v4 RNA polymerase subunit sigma 0.8487 1 112 GO:0006352
GO:0016987
AF-A0A2V5L354-F1-model_v4 RNA polymerase subunit sigma 0.8414 1 112 GO:0006352
GO:0016987
AF-A0A534N7F4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.761 7 126 GO:0006352
GO:0016987

Map