F486262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 315 | 1876 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300046675|Ga0495657_0193567|Ga0495657_0193567_65_751 |
| Length | 228 |
| Sequence | MQTEATLAQSDVSELDLVKRCQAGDTEAFDELVTRYRTRVFGMIYNMVHSEQDAWDLAQDSFLKAWKSIGRFRGQSSFYTWIYRIVMNVTIDWLRKKKIKGGDAEFDDAIQLREIDPASKTVPKTEALPHQAMERDEIRARIEKAISQLSPEHRAVILMKEIDDMQYHEIAEALECSIGTVMSRLFYARKKLQSLLRDVYENVRGKMDGVAGRPAWRARVIGIRSGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 241 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 242 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0 |
| Rhizoplane | 6.18 |
| Rhizosphere | 89.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495657_0193567 | 3300046675 | Bacteria | 1242 |
| 2 | CNXas_1000206 | 3300000545 | Bacteria | 8432 |
| 3 | JGI24032J14994_101162 | 3300001430 | Unclassified | 1185 |
| 4 | JGI24737J22298_10012645 | 3300001990 | Bacteria | 2751 |
| 5 | JGI24744J21845_10012038 | 3300002077 | Unclassified | 1760 |
| 6 | JGI24035J26624_1000141 | 3300002126 | Bacteria | 6413 |
| 7 | JGI24035J26624_1007613 | 3300002126 | Bacteria | 1054 |
| 8 | JGI24035J26624_1011137 | 3300002126 | Bacteria | 898 |
| 9 | JGI25406J46586_10000087 | 3300003203 | Bacteria | 42198 |
| 10 | JGI25406J46586_10095645 | 3300003203 | Unclassified | 891 |
| 11 | JGI25404J52841_10004829 | 3300003659 | Unclassified | 2760 |
| 12 | JGI25405J52794_10000412 | 3300003911 | Bacteria | 6018 |
| 13 | JGI25405J52794_10002813 | 3300003911 | Bacteria | 3019 |
| 14 | Ga0065714_10094929 | 3300005288 | Bacteria | 1801 |
| 15 | Ga0065704_10004850 | 3300005289 | Bacteria | 3990 |
| 16 | Ga0065704_10009573 | 3300005289 | Bacteria | 3061 |
| 17 | Ga0065704_10022829 | 3300005289 | Unclassified | 1004 |
| 18 | Ga0065704_10073950 | 3300005289 | Bacteria | 6644 |
| 19 | Ga0065704_10091739 | 3300005289 | Bacteria | 2696 |
| 20 | Ga0065712_10001692 | 3300005290 | Bacteria | 6372 |
| 21 | Ga0065712_10004664 | 3300005290 | Bacteria | 5980 |
| 22 | Ga0065712_10006386 | 3300005290 | Bacteria | 4869 |
| 23 | Ga0065712_10016478 | 3300005290 | Unclassified | 1439 |
| 24 | Ga0065712_10026337 | 3300005290 | Unclassified | 1166 |
| 25 | Ga0065712_10116148 | 3300005290 | Bacteria | 1740 |
| 26 | Ga0065712_10137998 | 3300005290 | Unclassified | 1478 |
| 27 | Ga0065712_10205871 | 3300005290 | Unclassified | 1091 |
| 28 | Ga0065712_10227849 | 3300005290 | Bacteria | 1020 |
| 29 | Ga0065712_10266013 | 3300005290 | Unclassified | 923 |
| 30 | Ga0065715_10000709 | 3300005293 | Bacteria | 10157 |
| 31 | Ga0065715_10001727 | 3300005293 | Bacteria | 5692 |
| 32 | Ga0065715_10089933 | 3300005293 | Bacteria | 8092 |
| 33 | Ga0065715_10119901 | 3300005293 | Unclassified | 2274 |
| 34 | Ga0065715_10167516 | 3300005293 | Bacteria | 1574 |
| 35 | Ga0065715_10174334 | 3300005293 | Unclassified | 1523 |
| 36 | Ga0065715_10255269 | 3300005293 | Bacteria | 1154 |
| 37 | Ga0065715_10298847 | 3300005293 | Unclassified | 1017 |
| 38 | Ga0065715_10327626 | 3300005293 | Unclassified | 976 |
| 39 | Ga0065715_10368088 | 3300005293 | Bacteria | 913 |
| 40 | Ga0065715_10369071 | 3300005293 | Unclassified | 924 |
| 41 | Ga0065715_10426084 | 3300005293 | Bacteria | 852 |
| 42 | Ga0065707_10003005 | 3300005295 | Bacteria | 4384 |
| 43 | Ga0065707_10005953 | 3300005295 | Unclassified | 2700 |
| 44 | Ga0065707_10013106 | 3300005295 | Unclassified | 2268 |
| 45 | Ga0070658_10005882 | 3300005327 | Bacteria | 9948 |
| 46 | Ga0070658_10136660 | 3300005327 | Bacteria | 2046 |
| 47 | Ga0070658_10314682 | 3300005327 | Unclassified | 1336 |
| 48 | Ga0070658_10598176 | 3300005327 | Bacteria | 956 |
| 49 | Ga0070676_10007273 | 3300005328 | Bacteria | 5939 |
| 50 | Ga0070676_10013117 | 3300005328 | Bacteria | 4539 |
| 51 | Ga0070676_10025549 | 3300005328 | Bacteria | 3339 |
| 52 | Ga0070676_10171591 | 3300005328 | Bacteria | 1403 |
| 53 | Ga0070676_10392529 | 3300005328 | Bacteria | 964 |
| 54 | Ga0070676_10875274 | 3300005328 | Unclassified | 668 |
| 55 | Ga0070683_100006008 | 3300005329 | Bacteria | 10172 |
| 56 | Ga0070683_100010449 | 3300005329 | Bacteria | 7982 |
| 57 | Ga0070683_100114079 | 3300005329 | Bacteria | 2550 |
| 58 | Ga0070683_100359518 | 3300005329 | Unclassified | 1387 |
| 59 | Ga0070690_100027697 | 3300005330 | Bacteria | 3504 |
| 60 | Ga0070690_100236802 | 3300005330 | Bacteria | 1286 |
| 61 | Ga0070690_100582137 | 3300005330 | Bacteria | 847 |
| 62 | Ga0070690_100637363 | 3300005330 | Bacteria | 812 |
| 63 | Ga0070670_100014931 | 3300005331 | Bacteria | 6665 |
| 64 | Ga0070670_100023992 | 3300005331 | Bacteria | 5247 |
| 65 | Ga0070670_100052927 | 3300005331 | Unclassified | 3487 |
| 66 | Ga0070670_100122580 | 3300005331 | Bacteria | 2242 |
| 67 | Ga0070670_100547513 | 3300005331 | Bacteria | 1032 |
| 68 | Ga0070677_10003178 | 3300005333 | Bacteria | 5284 |
| 69 | Ga0070677_10118311 | 3300005333 | Bacteria | 1193 |
| 70 | Ga0068869_100061991 | 3300005334 | Bacteria | 2744 |
| 71 | Ga0070666_10009111 | 3300005335 | Bacteria | 6188 |
| 72 | Ga0070666_10014419 | 3300005335 | Bacteria | 5032 |
| 73 | Ga0070666_10063078 | 3300005335 | Bacteria | 2511 |
| 74 | Ga0070666_10115524 | 3300005335 | Bacteria | 1858 |
| 75 | Ga0070666_10156365 | 3300005335 | Unclassified | 1592 |
| 76 | Ga0070680_100026698 | 3300005336 | Bacteria | 4619 |
| 77 | Ga0070680_100558357 | 3300005336 | Unclassified | 981 |
| 78 | Ga0070682_100075346 | 3300005337 | Bacteria | 2170 |
| 79 | Ga0068868_100099890 | 3300005338 | Bacteria | 2348 |
| 80 | Ga0068868_100109169 | 3300005338 | Bacteria | 2247 |
| 81 | Ga0068868_100144993 | 3300005338 | Bacteria | 1952 |
| 82 | Ga0070660_100083058 | 3300005339 | Bacteria | 2516 |
| 83 | Ga0070660_100123059 | 3300005339 | Bacteria | 2071 |
| 84 | Ga0070660_100138468 | 3300005339 | Bacteria | 1951 |
| 85 | Ga0070660_100306739 | 3300005339 | Unclassified | 1302 |
| 86 | Ga0070660_100436038 | 3300005339 | Bacteria | 1086 |
| 87 | Ga0070689_100000978 | 3300005340 | Bacteria | 17870 |
| 88 | Ga0070689_100075259 | 3300005340 | Bacteria | 2643 |
| 89 | Ga0070689_100085949 | 3300005340 | Bacteria | 2473 |
| 90 | Ga0070689_100128485 | 3300005340 | Bacteria | 2031 |
| 91 | Ga0070691_10242126 | 3300005341 | Bacteria | 964 |
| 92 | Ga0070687_100013691 | 3300005343 | Bacteria | 3622 |
| 93 | Ga0070687_100027127 | 3300005343 | Bacteria | 2763 |
| 94 | Ga0070661_100087820 | 3300005344 | Bacteria | 2301 |
| 95 | Ga0070661_100211272 | 3300005344 | Bacteria | 1486 |
| 96 | Ga0070661_100343187 | 3300005344 | Unclassified | 1170 |
| 97 | Ga0070668_100007657 | 3300005347 | Bacteria | 8015 |
| 98 | Ga0070668_100023570 | 3300005347 | Bacteria | 4656 |
| 99 | Ga0070668_100051505 | 3300005347 | Bacteria | 3172 |
| 100 | Ga0070668_100165243 | 3300005347 | Bacteria | 1798 |
| 101 | Ga0070669_100002655 | 3300005353 | Bacteria | 12882 |
| 102 | Ga0070669_100002855 | 3300005353 | Bacteria | 12482 |
| 103 | Ga0070669_100078802 | 3300005353 | Bacteria | 2449 |
| 104 | Ga0070669_100149960 | 3300005353 | Bacteria | 1804 |
| 105 | Ga0070675_100003712 | 3300005354 | Bacteria | 11603 |
| 106 | Ga0070675_100009595 | 3300005354 | Bacteria | 7533 |
| 107 | Ga0070675_100012255 | 3300005354 | Bacteria | 6720 |
| 108 | Ga0070675_100051731 | 3300005354 | Bacteria | 3376 |
| 109 | Ga0070675_100063293 | 3300005354 | Bacteria | 3058 |
| 110 | Ga0070675_100071895 | 3300005354 | Bacteria | 2871 |
| 111 | Ga0070675_100092059 | 3300005354 | Bacteria | 2541 |
| 112 | Ga0070675_100333325 | 3300005354 | Bacteria | 1342 |
| 113 | Ga0070675_100380263 | 3300005354 | Unclassified | 1257 |
| 114 | Ga0070675_100527999 | 3300005354 | Bacteria | 1065 |
| 115 | Ga0070671_100022030 | 3300005355 | Bacteria | 5205 |
| 116 | Ga0070671_100027480 | 3300005355 | Bacteria | 4683 |
| 117 | Ga0070671_100095441 | 3300005355 | Bacteria | 2493 |
| 118 | Ga0070671_100119176 | 3300005355 | Bacteria | 2220 |
| 119 | Ga0070671_100159825 | 3300005355 | Bacteria | 1905 |
| 120 | Ga0070671_100214880 | 3300005355 | Bacteria | 1631 |
| 121 | Ga0070671_100416101 | 3300005355 | Bacteria | 1151 |
| 122 | Ga0070671_100813306 | 3300005355 | Bacteria | 814 |
| 123 | Ga0070674_100027776 | 3300005356 | Bacteria | 3711 |
| 124 | Ga0070674_100033088 | 3300005356 | Bacteria | 3439 |
| 125 | Ga0070674_100184196 | 3300005356 | Unclassified | 1602 |
| 126 | Ga0070674_100935327 | 3300005356 | Unclassified | 757 |
| 127 | Ga0070674_101058546 | 3300005356 | Unclassified | 714 |
| 128 | Ga0070673_100000434 | 3300005364 | Bacteria | 22067 |
| 129 | Ga0070673_100016374 | 3300005364 | Bacteria | 5240 |
| 130 | Ga0070673_100022537 | 3300005364 | Bacteria | 4586 |
| 131 | Ga0070673_100186455 | 3300005364 | Unclassified | 1779 |
| 132 | Ga0070673_100294201 | 3300005364 | Unclassified | 1428 |
| 133 | Ga0070688_100007537 | 3300005365 | Bacteria | 5872 |
| 134 | Ga0070688_100021992 | 3300005365 | Bacteria | 3731 |
| 135 | Ga0070688_100030150 | 3300005365 | Bacteria | 3253 |
| 136 | Ga0070688_100076237 | 3300005365 | Bacteria | 2157 |
| 137 | Ga0070688_100118777 | 3300005365 | Bacteria | 1768 |
| 138 | Ga0070688_100184754 | 3300005365 | Bacteria | 1448 |
| 139 | Ga0070688_100206680 | 3300005365 | Bacteria | 1376 |
| 140 | Ga0070688_100249770 | 3300005365 | Unclassified | 1263 |
| 141 | Ga0070688_100376408 | 3300005365 | Bacteria | 1045 |
| 142 | Ga0070659_100000971 | 3300005366 | Bacteria | 21095 |
| 143 | Ga0070659_100052792 | 3300005366 | Bacteria | 3198 |
| 144 | Ga0070667_100006762 | 3300005367 | Bacteria | 9523 |
| 145 | Ga0070667_100055129 | 3300005367 | Bacteria | 3357 |
| 146 | Ga0070667_100108365 | 3300005367 | Bacteria | 2406 |
| 147 | Ga0070667_100137433 | 3300005367 | Bacteria | 2137 |
| 148 | Ga0070667_100247302 | 3300005367 | Unclassified | 1594 |
| 149 | Ga0070667_100272922 | 3300005367 | Unclassified | 1517 |
| 150 | Ga0070667_100664626 | 3300005367 | Bacteria | 962 |
| 151 | Ga0070709_10217629 | 3300005434 | Bacteria | 1360 |
| 152 | Ga0070709_10349913 | 3300005434 | Bacteria | 1091 |
| 153 | Ga0070709_10410699 | 3300005434 | Bacteria | 1013 |
| 154 | Ga0070714_100022318 | 3300005435 | Bacteria | 5190 |
| 155 | Ga0070714_100050890 | 3300005435 | Bacteria | 3531 |
| 156 | Ga0070714_100112238 | 3300005435 | Bacteria | 2415 |
| 157 | Ga0070714_100561150 | 3300005435 | Bacteria | 1094 |
| 158 | Ga0070714_100834323 | 3300005435 | Unclassified | 893 |
| 159 | Ga0070713_100037190 | 3300005436 | Bacteria | 3935 |
| 160 | Ga0070713_100115542 | 3300005436 | Unclassified | 2346 |
| 161 | Ga0070713_100226852 | 3300005436 | Bacteria | 1696 |
| 162 | Ga0070713_100258111 | 3300005436 | Unclassified | 1592 |
| 163 | Ga0070713_100293681 | 3300005436 | Bacteria | 1494 |
| 164 | Ga0070713_100560086 | 3300005436 | Bacteria | 1083 |
| 165 | Ga0070710_10075475 | 3300005437 | Bacteria | 1954 |
| 166 | Ga0070710_10082369 | 3300005437 | Bacteria | 1881 |
| 167 | Ga0070710_10148035 | 3300005437 | Unclassified | 1446 |
| 168 | Ga0070710_10234718 | 3300005437 | Bacteria | 1172 |
| 169 | Ga0070710_10315938 | 3300005437 | Unclassified | 1024 |
| 170 | Ga0070701_10153599 | 3300005438 | Bacteria | 1327 |
| 171 | Ga0070711_100012799 | 3300005439 | Bacteria | 5254 |
| 172 | Ga0070711_100020670 | 3300005439 | Unclassified | 4247 |
| 173 | Ga0070711_100201434 | 3300005439 | Unclassified | 1536 |
| 174 | Ga0070705_100128756 | 3300005440 | Bacteria | 1648 |
| 175 | Ga0070705_100146728 | 3300005440 | Bacteria | 1560 |
| 176 | Ga0070705_100196055 | 3300005440 | Bacteria | 1381 |
| 177 | Ga0070705_100276395 | 3300005440 | Unclassified | 1192 |
| 178 | Ga0070700_100039609 | 3300005441 | Bacteria | 2880 |
| 179 | Ga0070694_100024137 | 3300005444 | Bacteria | 3922 |
| 180 | Ga0070708_100012016 | 3300005445 | Bacteria | 7057 |
| 181 | Ga0070708_100047427 | 3300005445 | Bacteria | 3795 |
| 182 | Ga0070708_100072775 | 3300005445 | Bacteria | 3097 |
| 183 | Ga0070708_100085529 | 3300005445 | Bacteria | 2862 |
| 184 | Ga0070708_100090982 | 3300005445 | Unclassified | 2778 |
| 185 | Ga0070708_100220325 | 3300005445 | Unclassified | 1779 |
| 186 | Ga0070708_100242041 | 3300005445 | Bacteria | 1694 |
| 187 | Ga0070708_100291344 | 3300005445 | Bacteria | 1537 |
| 188 | Ga0070708_100966426 | 3300005445 | Unclassified | 799 |
| 189 | Ga0070663_100007018 | 3300005455 | Bacteria | 6824 |
| 190 | Ga0070663_100147391 | 3300005455 | Bacteria | 1802 |
| 191 | Ga0070663_100502859 | 3300005455 | Unclassified | 1007 |
| 192 | Ga0070678_100014316 | 3300005456 | Bacteria | 4999 |
| 193 | Ga0070678_100096894 | 3300005456 | Bacteria | 2277 |
| 194 | Ga0070678_100588886 | 3300005456 | Unclassified | 992 |
| 195 | Ga0070662_100003832 | 3300005457 | Bacteria | 9417 |
| 196 | Ga0070662_100043784 | 3300005457 | Bacteria | 3204 |
| 197 | Ga0070662_100131592 | 3300005457 | Bacteria | 1930 |
| 198 | Ga0070662_100146136 | 3300005457 | Bacteria | 1837 |
| 199 | Ga0070662_100375863 | 3300005457 | Unclassified | 1169 |
| 200 | Ga0070662_101040614 | 3300005457 | Bacteria | 701 |
| 201 | Ga0068867_100032843 | 3300005459 | Bacteria | 3755 |
| 202 | Ga0068867_100086414 | 3300005459 | Bacteria | 2373 |
| 203 | Ga0068867_100109459 | 3300005459 | Unclassified | 2121 |
| 204 | Ga0068867_100860567 | 3300005459 | Bacteria | 813 |
| 205 | Ga0070685_10067747 | 3300005466 | Unclassified | 2106 |
| 206 | Ga0070706_100000311 | 3300005467 | Bacteria | 59149 |
| 207 | Ga0070706_100001900 | 3300005467 | Bacteria | 21581 |
| 208 | Ga0070706_100004096 | 3300005467 | Bacteria | 14178 |
| 209 | Ga0070706_100013504 | 3300005467 | Bacteria | 7554 |
| 210 | Ga0070706_100014263 | 3300005467 | Bacteria | 7344 |
| 211 | Ga0070706_100042062 | 3300005467 | Bacteria | 4220 |
| 212 | Ga0070706_100083975 | 3300005467 | Bacteria | 2951 |
| 213 | Ga0070706_100117340 | 3300005467 | Bacteria | 2479 |
| 214 | Ga0070706_100132337 | 3300005467 | Bacteria | 2328 |
| 215 | Ga0070706_100300489 | 3300005467 | Unclassified | 1498 |
| 216 | Ga0070706_100513346 | 3300005467 | Unclassified | 1115 |
| 217 | Ga0070706_100590980 | 3300005467 | Unclassified | 1032 |
| 218 | Ga0070706_101010697 | 3300005467 | Bacteria | 767 |
| 219 | Ga0070707_100022786 | 3300005468 | Bacteria | 5922 |
| 220 | Ga0070707_100052961 | 3300005468 | Bacteria | 3891 |
| 221 | Ga0070707_100062513 | 3300005468 | Bacteria | 3572 |
| 222 | Ga0070707_100082066 | 3300005468 | Unclassified | 3113 |
| 223 | Ga0070707_100126280 | 3300005468 | Bacteria | 2486 |
| 224 | Ga0070707_100284961 | 3300005468 | Unclassified | 1605 |
| 225 | Ga0070707_100329039 | 3300005468 | Unclassified | 1485 |
| 226 | Ga0070707_100511374 | 3300005468 | Bacteria | 1163 |
| 227 | Ga0070707_100597627 | 3300005468 | Unclassified | 1066 |
| 228 | Ga0070698_100003506 | 3300005471 | Bacteria | 17260 |
| 229 | Ga0070698_100025039 | 3300005471 | Bacteria | 6220 |
| 230 | Ga0070698_100077092 | 3300005471 | Unclassified | 3334 |
| 231 | Ga0070698_100083823 | 3300005471 | Bacteria | 3177 |
| 232 | Ga0070698_100258988 | 3300005471 | Unclassified | 1672 |
| 233 | Ga0070698_100263776 | 3300005471 | Bacteria | 1655 |
| 234 | Ga0070699_100010688 | 3300005518 | Bacteria | 7945 |
| 235 | Ga0070699_100036437 | 3300005518 | Unclassified | 4255 |
| 236 | Ga0070699_100077573 | 3300005518 | Bacteria | 2892 |
| 237 | Ga0070699_100135107 | 3300005518 | Bacteria | 2176 |
| 238 | Ga0070679_100701639 | 3300005530 | Bacteria | 955 |
| 239 | Ga0070684_100006663 | 3300005535 | Bacteria | 8952 |
| 240 | Ga0070684_100041434 | 3300005535 | Bacteria | 3970 |
| 241 | Ga0070684_100099186 | 3300005535 | Unclassified | 2599 |
| 242 | Ga0070684_100268320 | 3300005535 | Unclassified | 1562 |
| 243 | Ga0070684_100597902 | 3300005535 | Bacteria | 1025 |
| 244 | Ga0070697_100002917 | 3300005536 | Bacteria | 13156 |
| 245 | Ga0070697_100003353 | 3300005536 | Bacteria | 12307 |
| 246 | Ga0070697_100012443 | 3300005536 | Bacteria | 6668 |
| 247 | Ga0070697_100071365 | 3300005536 | Bacteria | 2848 |
| 248 | Ga0070697_100074750 | 3300005536 | Bacteria | 2784 |
| 249 | Ga0070697_100098708 | 3300005536 | Bacteria | 2423 |
| 250 | Ga0070697_100126546 | 3300005536 | Bacteria | 2140 |
| 251 | Ga0070697_100152290 | 3300005536 | Bacteria | 1949 |
| 252 | Ga0070697_100242102 | 3300005536 | Unclassified | 1541 |
| 253 | Ga0070697_100409997 | 3300005536 | Bacteria | 1177 |
| 254 | Ga0070697_100642290 | 3300005536 | Bacteria | 934 |
| 255 | Ga0068853_100000002 | 3300005539 | Bacteria | 485323 |
| 256 | Ga0068853_100371264 | 3300005539 | Unclassified | 1334 |
| 257 | Ga0070672_100006356 | 3300005543 | Bacteria | 7934 |
| 258 | Ga0070672_100021583 | 3300005543 | Bacteria | 4715 |
| 259 | Ga0070672_100189510 | 3300005543 | Bacteria | 1716 |
| 260 | Ga0070672_100270691 | 3300005543 | Unclassified | 1434 |
| 261 | Ga0070672_100544384 | 3300005543 | Bacteria | 1007 |
| 262 | Ga0070696_100070536 | 3300005546 | Bacteria | 2458 |
| 263 | Ga0070665_100033364 | 3300005548 | Bacteria | 5180 |
| 264 | Ga0070665_100048215 | 3300005548 | Bacteria | 4277 |
| 265 | Ga0070665_100094465 | 3300005548 | Bacteria | 2995 |
| 266 | Ga0070665_100126059 | 3300005548 | Bacteria | 2563 |
| 267 | Ga0070665_100539402 | 3300005548 | Bacteria | 1178 |
| 268 | Ga0070704_100002924 | 3300005549 | Bacteria | 9704 |
| 269 | Ga0070704_100074513 | 3300005549 | Bacteria | 2476 |
| 270 | Ga0070704_100576357 | 3300005549 | Bacteria | 986 |
| 271 | Ga0068855_100013156 | 3300005563 | Bacteria | 9980 |
| 272 | Ga0068855_100281988 | 3300005563 | Bacteria | 1845 |
| 273 | Ga0068854_100266766 | 3300005578 | Bacteria | 1373 |
| 274 | Ga0068854_100541044 | 3300005578 | Bacteria | 986 |
| 275 | Ga0068856_100096159 | 3300005614 | Bacteria | 2950 |
| 276 | Ga0068856_100246292 | 3300005614 | Bacteria | 1802 |
| 277 | Ga0068856_101426804 | 3300005614 | Unclassified | 707 |
| 278 | Ga0068856_101546904 | 3300005614 | Unclassified | 677 |
| 279 | Ga0070702_100086753 | 3300005615 | Bacteria | 1888 |
| 280 | Ga0068859_100990974 | 3300005617 | Bacteria | 923 |
| 281 | Ga0068859_101132319 | 3300005617 | Unclassified | 861 |
| 282 | Ga0068864_100274762 | 3300005618 | Bacteria | 1571 |
| 283 | Ga0068864_101170157 | 3300005618 | Unclassified | 767 |
| 284 | Ga0068866_10112301 | 3300005718 | Unclassified | 1523 |
| 285 | Ga0068863_100003600 | 3300005841 | Bacteria | 15293 |
| 286 | Ga0068863_100180547 | 3300005841 | Unclassified | 2026 |
| 287 | Ga0068863_100240893 | 3300005841 | Bacteria | 1746 |
| 288 | Ga0068863_100536375 | 3300005841 | Bacteria | 1154 |
| 289 | Ga0068858_100010197 | 3300005842 | Bacteria | 8917 |
| 290 | Ga0068858_100068419 | 3300005842 | Bacteria | 3291 |
| 291 | Ga0068858_100320271 | 3300005842 | Bacteria | 1482 |
| 292 | Ga0068860_100000576 | 3300005843 | Bacteria | 44149 |
| 293 | Ga0068860_100037757 | 3300005843 | Bacteria | 4622 |
| 294 | Ga0068860_100111877 | 3300005843 | Bacteria | 2611 |
| 295 | Ga0068860_100350199 | 3300005843 | Unclassified | 1453 |
| 296 | Ga0068860_100400993 | 3300005843 | Bacteria | 1357 |
| 297 | Ga0068860_100889964 | 3300005843 | Bacteria | 906 |
| 298 | Ga0068862_100267237 | 3300005844 | Bacteria | 1563 |
| 299 | Ga0081455_10001872 | 3300005937 | Bacteria | 25307 |
| 300 | Ga0081455_10016935 | 3300005937 | Bacteria | 7007 |
| 301 | Ga0081455_10044602 | 3300005937 | Bacteria | 3866 |
| 302 | Ga0081455_10049102 | 3300005937 | Unclassified | 3640 |
| 303 | Ga0081540_1000036 | 3300005983 | Bacteria | 140805 |
| 304 | Ga0081540_1020870 | 3300005983 | Bacteria | 3923 |
| 305 | Ga0081540_1034481 | 3300005983 | Bacteria | 2728 |
| 306 | Ga0081539_10000671 | 3300005985 | Bacteria | 68678 |
| 307 | Ga0081539_10001132 | 3300005985 | Bacteria | 48398 |
| 308 | Ga0081539_10040243 | 3300005985 | Bacteria | 2746 |
| 309 | Ga0081539_10175139 | 3300005985 | Unclassified | 1011 |
| 310 | Ga0070717_10091589 | 3300006028 | Bacteria | 2567 |
| 311 | Ga0070717_10093046 | 3300006028 | Unclassified | 2547 |
| 312 | Ga0070717_10119455 | 3300006028 | Bacteria | 2256 |
| 313 | Ga0070717_10143413 | 3300006028 | Bacteria | 2061 |
| 314 | Ga0070717_10171272 | 3300006028 | Bacteria | 1888 |
| 315 | Ga0070717_10183786 | 3300006028 | Bacteria | 1823 |
| 316 | Ga0070717_10216627 | 3300006028 | Unclassified | 1682 |
| 317 | Ga0075363_100028247 | 3300006048 | Bacteria | 2883 |
| 318 | Ga0070715_10047133 | 3300006163 | Bacteria | 1835 |
| 319 | Ga0070715_10052209 | 3300006163 | Bacteria | 1762 |
| 320 | Ga0070716_100016121 | 3300006173 | Unclassified | 3852 |
| 321 | Ga0070716_100071096 | 3300006173 | Bacteria | 2045 |
| 322 | Ga0070716_100187760 | 3300006173 | Bacteria | 1363 |
| 323 | Ga0070716_100326689 | 3300006173 | Bacteria | 1077 |
| 324 | Ga0070716_100356862 | 3300006173 | Unclassified | 1037 |
| 325 | Ga0070716_100496278 | 3300006173 | Unclassified | 899 |
| 326 | Ga0070712_100103548 | 3300006175 | Bacteria | 2110 |
| 327 | Ga0070712_100103973 | 3300006175 | Unclassified | 2106 |
| 328 | Ga0070712_100122575 | 3300006175 | Bacteria | 1958 |
| 329 | Ga0070712_100217983 | 3300006175 | Bacteria | 1509 |
| 330 | Ga0070712_100302264 | 3300006175 | Bacteria | 1295 |
| 331 | Ga0070712_100350858 | 3300006175 | Unclassified | 1207 |
| 332 | Ga0070712_100382815 | 3300006175 | Unclassified | 1158 |
| 333 | Ga0070712_100432168 | 3300006175 | Bacteria | 1093 |
| 334 | Ga0070712_100537545 | 3300006175 | Bacteria | 984 |
| 335 | Ga0070712_101037270 | 3300006175 | Bacteria | 710 |
| 336 | Ga0075362_10000662 | 3300006177 | Bacteria | 10150 |
| 337 | Ga0075362_10018163 | 3300006177 | Unclassified | 2906 |
| 338 | Ga0075369_10062924 | 3300006186 | Bacteria | 1622 |
| 339 | Ga0097621_100014680 | 3300006237 | Bacteria | 5869 |
| 340 | Ga0097621_100035139 | 3300006237 | Bacteria | 4003 |
| 341 | Ga0097621_100097958 | 3300006237 | Bacteria | 2463 |
| 342 | Ga0097621_100257754 | 3300006237 | Bacteria | 1529 |
| 343 | Ga0097621_100713517 | 3300006237 | Unclassified | 924 |
| 344 | Ga0075370_10004090 | 3300006353 | Bacteria | 7022 |
| 345 | Ga0068871_100012306 | 3300006358 | Bacteria | 6304 |
| 346 | Ga0068871_100035252 | 3300006358 | Bacteria | 3974 |
| 347 | Ga0068871_100097947 | 3300006358 | Unclassified | 2453 |
| 348 | Ga0075428_100210081 | 3300006844 | Unclassified | 2103 |
| 349 | Ga0075433_10296210 | 3300006852 | Bacteria | 1432 |
| 350 | Ga0075433_10390907 | 3300006852 | Unclassified | 1227 |
| 351 | Ga0075434_100698607 | 3300006871 | Unclassified | 1032 |
| 352 | Ga0075434_100839157 | 3300006871 | Bacteria | 935 |
| 353 | Ga0075434_100933005 | 3300006871 | Unclassified | 883 |
| 354 | Ga0068865_100020657 | 3300006881 | Bacteria | 4273 |
| 355 | Ga0068865_100063909 | 3300006881 | Unclassified | 2589 |
| 356 | Ga0075436_100115767 | 3300006914 | Unclassified | 1873 |
| 357 | Ga0075436_100464806 | 3300006914 | Unclassified | 922 |
| 358 | Ga0097620_100990952 | 3300006931 | Bacteria | 923 |
| 359 | Ga0097620_101132438 | 3300006931 | Unclassified | 861 |
| 360 | Ga0075435_100261554 | 3300007076 | Bacteria | 1474 |
| 361 | Ga0075435_100334131 | 3300007076 | Unclassified | 1298 |
| 362 | Ga0099794_10060393 | 3300007265 | Bacteria | 1841 |
| 363 | Ga0099795_10003178 | 3300007788 | Bacteria | 4031 |
| 364 | Ga0099795_10041176 | 3300007788 | Bacteria | 1644 |
| 365 | Ga0099795_10075838 | 3300007788 | Bacteria | 1277 |
| 366 | Ga0099795_10199188 | 3300007788 | Unclassified | 844 |
| 367 | Ga0105240_10000412 | 3300009093 | Bacteria | 79783 |
| 368 | Ga0105240_10401552 | 3300009093 | Unclassified | 1543 |
| 369 | Ga0111539_10172555 | 3300009094 | Bacteria | 2526 |
| 370 | Ga0111539_10249144 | 3300009094 | Bacteria | 2068 |
| 371 | Ga0111539_10796145 | 3300009094 | Unclassified | 1100 |
| 372 | Ga0105245_10026583 | 3300009098 | Bacteria | 5096 |
| 373 | Ga0105245_10283623 | 3300009098 | Unclassified | 1620 |
| 374 | Ga0105245_10568739 | 3300009098 | Unclassified | 1157 |
| 375 | Ga0105247_10191930 | 3300009101 | Unclassified | 1368 |
| 376 | Ga0114129_10007418 | 3300009147 | Bacteria | 15610 |
| 377 | Ga0114129_10162066 | 3300009147 | Bacteria | 3054 |
| 378 | Ga0114129_10244078 | 3300009147 | Bacteria | 2413 |
| 379 | Ga0114129_10598948 | 3300009147 | Unclassified | 1428 |
| 380 | Ga0105243_10047154 | 3300009148 | Bacteria | 3391 |
| 381 | Ga0105241_10118065 | 3300009174 | Bacteria | 2132 |
| 382 | Ga0105241_10341507 | 3300009174 | Unclassified | 1297 |
| 383 | Ga0105241_10688375 | 3300009174 | Unclassified | 932 |
| 384 | Ga0105242_10086583 | 3300009176 | Bacteria | 2629 |
| 385 | Ga0105242_11341877 | 3300009176 | Bacteria | 740 |
| 386 | Ga0105237_10006408 | 3300009545 | Bacteria | 13060 |
| 387 | Ga0105237_10215473 | 3300009545 | Bacteria | 1920 |
| 388 | Ga0105237_10387062 | 3300009545 | Bacteria | 1403 |
| 389 | Ga0105237_10580387 | 3300009545 | Bacteria | 1128 |
| 390 | Ga0105249_10074161 | 3300009553 | Bacteria | 3149 |
| 391 | Ga0099796_10029945 | 3300010159 | Bacteria | 1761 |
| 392 | Ga0099796_10239664 | 3300010159 | Bacteria | 749 |
| 393 | Ga0105239_10086420 | 3300010375 | Bacteria | 3457 |
| 394 | Ga0105239_10134580 | 3300010375 | Bacteria | 2751 |
| 395 | Ga0105239_10135294 | 3300010375 | Bacteria | 2743 |
| 396 | Ga0105239_10155992 | 3300010375 | Bacteria | 2549 |
| 397 | Ga0105239_10217548 | 3300010375 | Bacteria | 2142 |
| 398 | Ga0105239_11156063 | 3300010375 | Bacteria | 891 |
| 399 | Ga0157371_10227161 | 3300013102 | Bacteria | 1341 |
| 400 | Ga0157370_10516754 | 3300013104 | Bacteria | 1096 |
| 401 | Ga0157369_10441889 | 3300013105 | Bacteria | 1347 |
| 402 | Ga0157369_10644028 | 3300013105 | Bacteria | 1093 |
| 403 | Ga0157374_10000160 | 3300013296 | Bacteria | 62026 |
| 404 | Ga0157374_10016198 | 3300013296 | Bacteria | 6549 |
| 405 | Ga0157374_10033371 | 3300013296 | Bacteria | 4696 |
| 406 | Ga0157374_10083550 | 3300013296 | Unclassified | 3034 |
| 407 | Ga0157374_10111000 | 3300013296 | Bacteria | 2637 |
| 408 | Ga0157374_10230839 | 3300013296 | Bacteria | 1818 |
| 409 | Ga0157374_10267638 | 3300013296 | Bacteria | 1685 |
| 410 | Ga0157374_10600091 | 3300013296 | Unclassified | 1111 |
| 411 | Ga0157374_11118901 | 3300013296 | Bacteria | 808 |
| 412 | Ga0157374_11437729 | 3300013296 | Unclassified | 712 |
| 413 | Ga0157378_10006750 | 3300013297 | Bacteria | 10028 |
| 414 | Ga0157378_10023174 | 3300013297 | Bacteria | 5464 |
| 415 | Ga0157378_10033296 | 3300013297 | Unclassified | 4555 |
| 416 | Ga0157378_10077204 | 3300013297 | Bacteria | 3002 |
| 417 | Ga0157378_10097175 | 3300013297 | Bacteria | 2684 |
| 418 | Ga0157378_10108165 | 3300013297 | Unclassified | 2545 |
| 419 | Ga0157378_10202123 | 3300013297 | Bacteria | 1880 |
| 420 | Ga0157378_10231751 | 3300013297 | Unclassified | 1760 |
| 421 | Ga0157378_10231898 | 3300013297 | Bacteria | 1760 |
| 422 | Ga0157378_10567103 | 3300013297 | Unclassified | 1143 |
| 423 | Ga0157378_10616943 | 3300013297 | Bacteria | 1097 |
| 424 | Ga0157378_10689553 | 3300013297 | Unclassified | 1040 |
| 425 | Ga0157378_10991161 | 3300013297 | Bacteria | 874 |
| 426 | Ga0163162_10008629 | 3300013306 | Bacteria | 9930 |
| 427 | Ga0163162_10013145 | 3300013306 | Bacteria | 8083 |
| 428 | Ga0163162_10021558 | 3300013306 | Bacteria | 6346 |
| 429 | Ga0163162_10021637 | 3300013306 | Bacteria | 6334 |
| 430 | Ga0163162_10043308 | 3300013306 | Bacteria | 4507 |
| 431 | Ga0163162_10057606 | 3300013306 | Bacteria | 3914 |
| 432 | Ga0163162_10074321 | 3300013306 | Bacteria | 3457 |
| 433 | Ga0163162_10224840 | 3300013306 | Bacteria | 2006 |
| 434 | Ga0163162_10351894 | 3300013306 | Unclassified | 1606 |
| 435 | Ga0157372_10414364 | 3300013307 | Bacteria | 1570 |
| 436 | Ga0157372_10429439 | 3300013307 | Bacteria | 1540 |
| 437 | Ga0157372_11358471 | 3300013307 | Bacteria | 819 |
| 438 | Ga0157375_10002485 | 3300013308 | Bacteria | 15970 |
| 439 | Ga0157375_10011674 | 3300013308 | Bacteria | 7761 |
| 440 | Ga0157375_10052405 | 3300013308 | Bacteria | 4011 |
| 441 | Ga0157375_10063296 | 3300013308 | Bacteria | 3679 |
| 442 | Ga0157375_10115628 | 3300013308 | Bacteria | 2786 |
| 443 | Ga0157375_11130186 | 3300013308 | Bacteria | 918 |
| 444 | Ga0157375_11380639 | 3300013308 | Bacteria | 830 |
| 445 | Ga0157375_11598394 | 3300013308 | Unclassified | 771 |
| 446 | Ga0163163_10119296 | 3300014325 | Unclassified | 2671 |
| 447 | Ga0163163_10141245 | 3300014325 | Bacteria | 2450 |
| 448 | Ga0163163_10269781 | 3300014325 | Bacteria | 1753 |
| 449 | Ga0163163_10273312 | 3300014325 | Bacteria | 1741 |
| 450 | Ga0157377_10048614 | 3300014745 | Bacteria | 2381 |
| 451 | Ga0157379_10343869 | 3300014968 | Bacteria | 1365 |
| 452 | Ga0157376_10018271 | 3300014969 | Bacteria | 5370 |
| 453 | Ga0157376_10081124 | 3300014969 | Unclassified | 2784 |
| 454 | Ga0157376_10091651 | 3300014969 | Bacteria | 2633 |
| 455 | Ga0157376_10135143 | 3300014969 | Bacteria | 2206 |
| 456 | Ga0157376_10508681 | 3300014969 | Bacteria | 1185 |
| 457 | Ga0157376_10584334 | 3300014969 | Unclassified | 1110 |
| 458 | Ga0163161_10005833 | 3300017792 | Bacteria | 8533 |
| 459 | Ga0163161_10119730 | 3300017792 | Unclassified | 1977 |
| 460 | Ga0163161_10203079 | 3300017792 | Unclassified | 1528 |
| 461 | Ga0163161_10529095 | 3300017792 | Bacteria | 964 |
| 462 | Ga0206350_11555172 | 3300020080 | Unclassified | 929 |
| 463 | Ga0213873_10081446 | 3300021358 | Unclassified | 907 |
| 464 | Ga0213872_10002738 | 3300021361 | Bacteria | 10119 |
| 465 | Ga0213872_10016657 | 3300021361 | Bacteria | 3409 |
| 466 | Ga0213872_10095450 | 3300021361 | Bacteria | 1328 |
| 467 | Ga0213876_10000779 | 3300021384 | Bacteria | 21764 |
| 468 | Ga0213876_10044348 | 3300021384 | Bacteria | 2350 |
| 469 | Ga0213876_10055287 | 3300021384 | Unclassified | 2096 |
| 470 | Ga0213871_10055446 | 3300021441 | Unclassified | 1095 |
| 471 | Ga0207666_1001627 | 3300025271 | Unclassified | 2662 |
| 472 | Ga0207666_1003597 | 3300025271 | Bacteria | 1909 |
| 473 | Ga0207666_1005596 | 3300025271 | Bacteria | 1609 |
| 474 | Ga0207673_1004302 | 3300025290 | Bacteria | 1697 |
| 475 | Ga0209050_1006977 | 3300025298 | Bacteria | 6505 |
| 476 | Ga0207697_10000116 | 3300025315 | Bacteria | 37551 |
| 477 | Ga0207697_10000348 | 3300025315 | Bacteria | 25805 |
| 478 | Ga0207697_10001294 | 3300025315 | Bacteria | 13739 |
| 479 | Ga0207697_10001541 | 3300025315 | Bacteria | 12483 |
| 480 | Ga0207697_10002095 | 3300025315 | Bacteria | 10492 |
| 481 | Ga0207697_10012438 | 3300025315 | Bacteria | 3567 |
| 482 | Ga0207697_10025316 | 3300025315 | Unclassified | 2426 |
| 483 | Ga0207653_10026242 | 3300025885 | Bacteria | 1867 |
| 484 | Ga0207682_10044496 | 3300025893 | Bacteria | 1820 |
| 485 | Ga0207692_10035612 | 3300025898 | Bacteria | 2419 |
| 486 | Ga0207692_10118584 | 3300025898 | Bacteria | 1478 |
| 487 | Ga0207692_10165832 | 3300025898 | Unclassified | 1276 |
| 488 | Ga0207692_10374500 | 3300025898 | Unclassified | 882 |
| 489 | Ga0207642_10296466 | 3300025899 | Unclassified | 936 |
| 490 | Ga0207688_10006712 | 3300025901 | Bacteria | 6262 |
| 491 | Ga0207688_10016999 | 3300025901 | Bacteria | 3952 |
| 492 | Ga0207688_10028348 | 3300025901 | Bacteria | 3080 |
| 493 | Ga0207688_10091145 | 3300025901 | Bacteria | 1751 |
| 494 | Ga0207680_10006888 | 3300025903 | Bacteria | 5512 |
| 495 | Ga0207680_10070344 | 3300025903 | Unclassified | 2165 |
| 496 | Ga0207680_10640881 | 3300025903 | Unclassified | 760 |
| 497 | Ga0207647_10004861 | 3300025904 | Bacteria | 9931 |
| 498 | Ga0207685_10022911 | 3300025905 | Bacteria | 2118 |
| 499 | Ga0207699_10023294 | 3300025906 | Bacteria | 3368 |
| 500 | Ga0207645_10001573 | 3300025907 | Bacteria | 18629 |
| 501 | Ga0207645_10004457 | 3300025907 | Bacteria | 10365 |
| 502 | Ga0207645_10006861 | 3300025907 | Bacteria | 8125 |
| 503 | Ga0207645_10036418 | 3300025907 | Bacteria | 3159 |
| 504 | Ga0207645_10175933 | 3300025907 | Bacteria | 1403 |
| 505 | Ga0207645_10178030 | 3300025907 | Bacteria | 1395 |
| 506 | Ga0207643_10194845 | 3300025908 | Unclassified | 1231 |
| 507 | Ga0207643_10476174 | 3300025908 | Bacteria | 796 |
| 508 | Ga0207705_10075617 | 3300025909 | Bacteria | 2446 |
| 509 | Ga0207684_10000337 | 3300025910 | Bacteria | 65590 |
| 510 | Ga0207684_10004700 | 3300025910 | Bacteria | 12810 |
| 511 | Ga0207684_10011043 | 3300025910 | Bacteria | 7911 |
| 512 | Ga0207684_10024895 | 3300025910 | Bacteria | 5100 |
| 513 | Ga0207684_10075011 | 3300025910 | Unclassified | 2874 |
| 514 | Ga0207684_10102137 | 3300025910 | Unclassified | 2451 |
| 515 | Ga0207684_10104691 | 3300025910 | Unclassified | 2420 |
| 516 | Ga0207684_10107589 | 3300025910 | Bacteria | 2386 |
| 517 | Ga0207684_10111774 | 3300025910 | Bacteria | 2338 |
| 518 | Ga0207684_10149719 | 3300025910 | Bacteria | 2008 |
| 519 | Ga0207684_10194513 | 3300025910 | Bacteria | 1749 |
| 520 | Ga0207684_10440190 | 3300025910 | Unclassified | 1119 |
| 521 | Ga0207684_10509917 | 3300025910 | Unclassified | 1031 |
| 522 | Ga0207684_10755332 | 3300025910 | Unclassified | 824 |
| 523 | Ga0207654_10196502 | 3300025911 | Bacteria | 1325 |
| 524 | Ga0207707_10066916 | 3300025912 | Bacteria | 3129 |
| 525 | Ga0207695_10000783 | 3300025913 | Bacteria | 60141 |
| 526 | Ga0207671_10020513 | 3300025914 | Bacteria | 5029 |
| 527 | Ga0207671_10669159 | 3300025914 | Bacteria | 826 |
| 528 | Ga0207693_10008693 | 3300025915 | Bacteria | 8305 |
| 529 | Ga0207693_10015810 | 3300025915 | Bacteria | 6046 |
| 530 | Ga0207693_10035674 | 3300025915 | Bacteria | 3921 |
| 531 | Ga0207693_10038294 | 3300025915 | Bacteria | 3777 |
| 532 | Ga0207693_10063349 | 3300025915 | Bacteria | 2896 |
| 533 | Ga0207693_10084225 | 3300025915 | Unclassified | 2491 |
| 534 | Ga0207693_10094418 | 3300025915 | Bacteria | 2344 |
| 535 | Ga0207693_10213180 | 3300025915 | Bacteria | 1518 |
| 536 | Ga0207693_10241245 | 3300025915 | Bacteria | 1419 |
| 537 | Ga0207693_10382709 | 3300025915 | Bacteria | 1100 |
| 538 | Ga0207693_10659598 | 3300025915 | Bacteria | 812 |
| 539 | Ga0207663_10029098 | 3300025916 | Bacteria | 3240 |
| 540 | Ga0207663_10031762 | 3300025916 | Bacteria | 3128 |
| 541 | Ga0207663_10055206 | 3300025916 | Bacteria | 2491 |
| 542 | Ga0207663_10177341 | 3300025916 | Bacteria | 1519 |
| 543 | Ga0207663_10375080 | 3300025916 | Unclassified | 1082 |
| 544 | Ga0207663_10743878 | 3300025916 | Bacteria | 778 |
| 545 | Ga0207660_10022146 | 3300025917 | Bacteria | 4280 |
| 546 | Ga0207660_10211559 | 3300025917 | Bacteria | 1519 |
| 547 | Ga0207662_10042413 | 3300025918 | Bacteria | 2682 |
| 548 | Ga0207662_10047832 | 3300025918 | Bacteria | 2533 |
| 549 | Ga0207662_10298144 | 3300025918 | Bacteria | 1071 |
| 550 | Ga0207657_10100597 | 3300025919 | Bacteria | 2400 |
| 551 | Ga0207657_10204362 | 3300025919 | Unclassified | 1588 |
| 552 | Ga0207657_10308443 | 3300025919 | Bacteria | 1253 |
| 553 | Ga0207657_10417350 | 3300025919 | Unclassified | 1055 |
| 554 | Ga0207649_10042935 | 3300025920 | Bacteria | 2761 |
| 555 | Ga0207649_10249863 | 3300025920 | Unclassified | 1277 |
| 556 | Ga0207652_10068891 | 3300025921 | Unclassified | 3071 |
| 557 | Ga0207646_10004682 | 3300025922 | Bacteria | 14739 |
| 558 | Ga0207646_10008619 | 3300025922 | Bacteria | 10191 |
| 559 | Ga0207646_10053741 | 3300025922 | Bacteria | 3603 |
| 560 | Ga0207646_10060600 | 3300025922 | Bacteria | 3379 |
| 561 | Ga0207646_10066819 | 3300025922 | Bacteria | 3210 |
| 562 | Ga0207646_10074837 | 3300025922 | Unclassified | 3025 |
| 563 | Ga0207646_10113228 | 3300025922 | Bacteria | 2435 |
| 564 | Ga0207646_10183571 | 3300025922 | Unclassified | 1889 |
| 565 | Ga0207646_10191083 | 3300025922 | Bacteria | 1849 |
| 566 | Ga0207646_10208566 | 3300025922 | Bacteria | 1764 |
| 567 | Ga0207646_10258704 | 3300025922 | Unclassified | 1573 |
| 568 | Ga0207646_10334473 | 3300025922 | Bacteria | 1368 |
| 569 | Ga0207681_10008466 | 3300025923 | Bacteria | 6286 |
| 570 | Ga0207681_10027254 | 3300025923 | Bacteria | 3693 |
| 571 | Ga0207681_10038451 | 3300025923 | Bacteria | 3170 |
| 572 | Ga0207681_10048813 | 3300025923 | Bacteria | 2858 |
| 573 | Ga0207681_10057878 | 3300025923 | Bacteria | 2651 |
| 574 | Ga0207681_10466460 | 3300025923 | Unclassified | 1029 |
| 575 | Ga0207650_10045346 | 3300025925 | Bacteria | 3234 |
| 576 | Ga0207650_10073429 | 3300025925 | Bacteria | 2576 |
| 577 | Ga0207650_10154225 | 3300025925 | Bacteria | 1815 |
| 578 | Ga0207650_10469961 | 3300025925 | Bacteria | 1048 |
| 579 | Ga0207650_10576425 | 3300025925 | Bacteria | 945 |
| 580 | Ga0207659_10003753 | 3300025926 | Bacteria | 9156 |
| 581 | Ga0207659_10011396 | 3300025926 | Bacteria | 5615 |
| 582 | Ga0207659_10028169 | 3300025926 | Bacteria | 3815 |
| 583 | Ga0207659_10166408 | 3300025926 | Unclassified | 1736 |
| 584 | Ga0207659_10224742 | 3300025926 | Bacteria | 1511 |
| 585 | Ga0207659_10372495 | 3300025926 | Bacteria | 1189 |
| 586 | Ga0207659_11132218 | 3300025926 | Unclassified | 673 |
| 587 | Ga0207687_10242269 | 3300025927 | Bacteria | 1430 |
| 588 | Ga0207687_10483870 | 3300025927 | Unclassified | 1031 |
| 589 | Ga0207687_10756201 | 3300025927 | Bacteria | 827 |
| 590 | Ga0207700_10039447 | 3300025928 | Unclassified | 3438 |
| 591 | Ga0207700_10546316 | 3300025928 | Bacteria | 1028 |
| 592 | Ga0207700_11091293 | 3300025928 | Unclassified | 714 |
| 593 | Ga0207664_10085388 | 3300025929 | Bacteria | 2576 |
| 594 | Ga0207664_10121339 | 3300025929 | Bacteria | 2187 |
| 595 | Ga0207644_10009749 | 3300025931 | Bacteria | 6314 |
| 596 | Ga0207644_10039292 | 3300025931 | Bacteria | 3340 |
| 597 | Ga0207644_10159115 | 3300025931 | Bacteria | 1754 |
| 598 | Ga0207644_10463191 | 3300025931 | Unclassified | 1042 |
| 599 | Ga0207644_10504218 | 3300025931 | Unclassified | 998 |
| 600 | Ga0207690_10001481 | 3300025932 | Bacteria | 14676 |
| 601 | Ga0207690_10025115 | 3300025932 | Bacteria | 3737 |
| 602 | Ga0207706_10008614 | 3300025933 | Bacteria | 9399 |
| 603 | Ga0207706_10049321 | 3300025933 | Bacteria | 3721 |
| 604 | Ga0207706_10091217 | 3300025933 | Bacteria | 2679 |
| 605 | Ga0207686_10144712 | 3300025934 | Bacteria | 1647 |
| 606 | Ga0207670_10003100 | 3300025936 | Bacteria | 8793 |
| 607 | Ga0207670_10047628 | 3300025936 | Bacteria | 2857 |
| 608 | Ga0207670_10097423 | 3300025936 | Bacteria | 2094 |
| 609 | Ga0207670_10128534 | 3300025936 | Bacteria | 1852 |
| 610 | Ga0207670_10150698 | 3300025936 | Bacteria | 1725 |
| 611 | Ga0207669_10003408 | 3300025937 | Bacteria | 6875 |
| 612 | Ga0207669_10010427 | 3300025937 | Bacteria | 4473 |
| 613 | Ga0207669_10102661 | 3300025937 | Unclassified | 1895 |
| 614 | Ga0207669_10151515 | 3300025937 | Unclassified | 1625 |
| 615 | Ga0207669_10281672 | 3300025937 | Bacteria | 1254 |
| 616 | Ga0207669_10334333 | 3300025937 | Unclassified | 1164 |
| 617 | Ga0207704_10022744 | 3300025938 | Unclassified | 3365 |
| 618 | Ga0207704_10118581 | 3300025938 | Bacteria | 1805 |
| 619 | Ga0207704_10211105 | 3300025938 | Unclassified | 1429 |
| 620 | Ga0207665_10011275 | 3300025939 | Bacteria | 5866 |
| 621 | Ga0207665_10026896 | 3300025939 | Unclassified | 3800 |
| 622 | Ga0207665_10035745 | 3300025939 | Bacteria | 3300 |
| 623 | Ga0207665_10050971 | 3300025939 | Bacteria | 2785 |
| 624 | Ga0207665_10064244 | 3300025939 | Bacteria | 2494 |
| 625 | Ga0207665_10079786 | 3300025939 | Bacteria | 2250 |
| 626 | Ga0207665_10117148 | 3300025939 | Bacteria | 1878 |
| 627 | Ga0207691_10000945 | 3300025940 | Bacteria | 28782 |
| 628 | Ga0207691_10001082 | 3300025940 | Bacteria | 27131 |
| 629 | Ga0207691_10032280 | 3300025940 | Bacteria | 4883 |
| 630 | Ga0207691_10227062 | 3300025940 | Bacteria | 1617 |
| 631 | Ga0207711_10418830 | 3300025941 | Bacteria | 1246 |
| 632 | Ga0207689_10064409 | 3300025942 | Bacteria | 3016 |
| 633 | Ga0207689_10284739 | 3300025942 | Bacteria | 1369 |
| 634 | Ga0207661_10007132 | 3300025944 | Bacteria | 7940 |
| 635 | Ga0207661_10026830 | 3300025944 | Unclassified | 4394 |
| 636 | Ga0207661_10383409 | 3300025944 | Bacteria | 1272 |
| 637 | Ga0207661_10394984 | 3300025944 | Bacteria | 1253 |
| 638 | Ga0207679_10308419 | 3300025945 | Bacteria | 1367 |
| 639 | Ga0207679_10612049 | 3300025945 | Bacteria | 982 |
| 640 | Ga0207679_11140952 | 3300025945 | Unclassified | 715 |
| 641 | Ga0207667_10024015 | 3300025949 | Bacteria | 6705 |
| 642 | Ga0207667_10425115 | 3300025949 | Bacteria | 1351 |
| 643 | Ga0207667_10535635 | 3300025949 | Bacteria | 1185 |
| 644 | Ga0207651_10020043 | 3300025960 | Bacteria | 4025 |
| 645 | Ga0207651_10028201 | 3300025960 | Bacteria | 3538 |
| 646 | Ga0207651_10277099 | 3300025960 | Unclassified | 1384 |
| 647 | Ga0207651_10389769 | 3300025960 | Bacteria | 1183 |
| 648 | Ga0207651_10775826 | 3300025960 | Bacteria | 848 |
| 649 | Ga0207712_10012291 | 3300025961 | Bacteria | 5471 |
| 650 | Ga0207712_10040060 | 3300025961 | Bacteria | 3213 |
| 651 | Ga0207668_10011932 | 3300025972 | Bacteria | 5301 |
| 652 | Ga0207668_10056103 | 3300025972 | Bacteria | 2742 |
| 653 | Ga0207668_10057537 | 3300025972 | Unclassified | 2713 |
| 654 | Ga0207668_10133557 | 3300025972 | Unclassified | 1898 |
| 655 | Ga0207668_10186846 | 3300025972 | Bacteria | 1639 |
| 656 | Ga0207668_10321354 | 3300025972 | Bacteria | 1284 |
| 657 | Ga0207668_10583611 | 3300025972 | Bacteria | 972 |
| 658 | Ga0207668_10937950 | 3300025972 | Bacteria | 771 |
| 659 | Ga0207658_10004701 | 3300025986 | Bacteria | 9459 |
| 660 | Ga0207658_10022282 | 3300025986 | Bacteria | 4409 |
| 661 | Ga0207658_10067376 | 3300025986 | Bacteria | 2696 |
| 662 | Ga0207658_10108410 | 3300025986 | Bacteria | 2190 |
| 663 | Ga0207658_10136796 | 3300025986 | Bacteria | 1977 |
| 664 | Ga0207658_10208729 | 3300025986 | Unclassified | 1635 |
| 665 | Ga0207658_10241487 | 3300025986 | Unclassified | 1530 |
| 666 | Ga0207658_10412705 | 3300025986 | Bacteria | 1189 |
| 667 | Ga0207677_10018031 | 3300026023 | Bacteria | 4228 |
| 668 | Ga0207677_10133745 | 3300026023 | Unclassified | 1887 |
| 669 | Ga0207677_10218686 | 3300026023 | Bacteria | 1526 |
| 670 | Ga0207677_10445762 | 3300026023 | Bacteria | 1108 |
| 671 | Ga0207677_10902842 | 3300026023 | Unclassified | 796 |
| 672 | Ga0207703_10009368 | 3300026035 | Bacteria | 7696 |
| 673 | Ga0207703_10015594 | 3300026035 | Bacteria | 5927 |
| 674 | Ga0207703_10200678 | 3300026035 | Bacteria | 1772 |
| 675 | Ga0207639_10000009 | 3300026041 | Bacteria | 432727 |
| 676 | Ga0207678_10001585 | 3300026067 | Bacteria | 20917 |
| 677 | Ga0207708_10038619 | 3300026075 | Bacteria | 3637 |
| 678 | Ga0207702_10210848 | 3300026078 | Bacteria | 1806 |
| 679 | Ga0207702_10777103 | 3300026078 | Bacteria | 946 |
| 680 | Ga0207641_10012427 | 3300026088 | Bacteria | 6981 |
| 681 | Ga0207641_10064327 | 3300026088 | Bacteria | 3135 |
| 682 | Ga0207641_10084465 | 3300026088 | Bacteria | 2764 |
| 683 | Ga0207641_11067914 | 3300026088 | Unclassified | 805 |
| 684 | Ga0207648_10024504 | 3300026089 | Bacteria | 5385 |
| 685 | Ga0207648_10094602 | 3300026089 | Bacteria | 2613 |
| 686 | Ga0207648_10122198 | 3300026089 | Bacteria | 2290 |
| 687 | Ga0207648_10131773 | 3300026089 | Bacteria | 2200 |
| 688 | Ga0207648_10791194 | 3300026089 | Unclassified | 882 |
| 689 | Ga0207676_10582979 | 3300026095 | Bacteria | 1072 |
| 690 | Ga0207675_100154766 | 3300026118 | Bacteria | 2184 |
| 691 | Ga0207683_10017209 | 3300026121 | Bacteria | 6157 |
| 692 | Ga0207683_10032547 | 3300026121 | Bacteria | 4529 |
| 693 | Ga0207683_10086586 | 3300026121 | Bacteria | 2785 |
| 694 | Ga0207683_10206441 | 3300026121 | Bacteria | 1787 |
| 695 | Ga0207683_10235777 | 3300026121 | Bacteria | 1669 |
| 696 | Ga0207698_10719248 | 3300026142 | Bacteria | 995 |
| 697 | Ga0209179_1021633 | 3300027512 | Bacteria | 1256 |
| 698 | Ga0209971_1085204 | 3300027682 | Unclassified | 770 |
| 699 | Ga0209998_10023187 | 3300027717 | Unclassified | 1341 |
| 700 | Ga0209974_10009094 | 3300027876 | Bacteria | 3377 |
| 701 | Ga0209974_10014068 | 3300027876 | Unclassified | 2666 |
| 702 | Ga0209974_10036286 | 3300027876 | Unclassified | 1637 |
| 703 | Ga0268266_10008218 | 3300028379 | Bacteria | 9302 |
| 704 | Ga0268266_10012253 | 3300028379 | Bacteria | 7418 |
| 705 | Ga0268266_10141314 | 3300028379 | Bacteria | 2161 |
| 706 | Ga0268266_10188497 | 3300028379 | Bacteria | 1882 |
| 707 | Ga0268266_10331437 | 3300028379 | Bacteria | 1426 |
| 708 | Ga0268265_10303422 | 3300028380 | Bacteria | 1439 |
| 709 | Ga0268265_10536243 | 3300028380 | Bacteria | 1109 |
| 710 | Ga0268265_10654136 | 3300028380 | Unclassified | 1010 |
| 711 | Ga0268264_10001424 | 3300028381 | Bacteria | 22372 |
| 712 | Ga0268264_10016515 | 3300028381 | Bacteria | 6044 |
| 713 | Ga0268264_10324411 | 3300028381 | Unclassified | 1457 |
| 714 | Ga0307513_10052043 | 3300031456 | Unclassified | 4412 |
| 715 | Ga0307414_10133466 | 3300032004 | Bacteria | 1931 |
| 716 | Ga0373929_0024211 | 3300035085 | Unclassified | 1253 |
| 717 | Ga0373923_0126460 | 3300035111 | Unclassified | 1146 |
| 718 | Ga0373923_0266310 | 3300035111 | Unclassified | 805 |
| 719 | Ga0373945_0020838 | 3300035116 | Bacteria | 2248 |
| 720 | Ga0373953_0336164 | 3300035117 | Unclassified | 661 |
| 721 | Ga0373954_0262604 | 3300035118 | Bacteria | 850 |
| 722 | Ga0373956_0091350 | 3300035119 | Bacteria | 1405 |
| 723 | Ga0373957_0230837 | 3300035120 | Bacteria | 776 |
| 724 | Ga0373943_0033870 | 3300035170 | Bacteria | 2435 |
| 725 | Ga0373943_0101304 | 3300035170 | Bacteria | 1507 |
| 726 | Ga0373946_0040914 | 3300035171 | Bacteria | 1899 |
| 727 | Ga0373946_0064944 | 3300035171 | Bacteria | 1562 |
| 728 | Ga0373946_0254646 | 3300035171 | Bacteria | 857 |
| 729 | Ga0373955_0055517 | 3300035172 | Bacteria | 2170 |
| 730 | Ga0373942_0139937 | 3300035207 | Unclassified | 770 |
| 731 | Ga0373962_0058122 | 3300035242 | Unclassified | 1130 |
| 732 | Ga0373924_0084042 | 3300035410 | Bacteria | 1357 |
| 733 | Ga0373924_0109499 | 3300035410 | Unclassified | 1193 |
| 734 | Ga0373931_0015102 | 3300035691 | Bacteria | 3785 |
| 735 | Ga0373931_0043088 | 3300035691 | Unclassified | 2375 |
| 736 | Ga0373931_0130682 | 3300035691 | Unclassified | 1445 |
| 737 | Ga0373931_0667840 | 3300035691 | Bacteria | 684 |
| 738 | Ga0373935_0091805 | 3300035692 | Bacteria | 1989 |
| 739 | Ga0373935_0173486 | 3300035692 | Bacteria | 1476 |
| 740 | Ga0373935_0256526 | 3300035692 | Bacteria | 1225 |
| 741 | Ga0373927_0076041 | 3300035695 | Bacteria | 2175 |
| 742 | Ga0373927_0100471 | 3300035695 | Bacteria | 1881 |
| 743 | Ga0373927_0117968 | 3300035695 | Bacteria | 1731 |
| 744 | Ga0373927_0180641 | 3300035695 | Unclassified | 1384 |
| 745 | Ga0373927_0246803 | 3300035695 | Bacteria | 1174 |
| 746 | Ga0373933_0082536 | 3300035724 | Unclassified | 1973 |
| 747 | Ga0373933_0124804 | 3300035724 | Unclassified | 1615 |
| 748 | Ga0373947_0143887 | 3300035725 | Unclassified | 1531 |
| 749 | Ga0373947_0169472 | 3300035725 | Bacteria | 1416 |
| 750 | Ga0373937_0114240 | 3300036401 | Bacteria | 2513 |
| 751 | Ga0373937_0423624 | 3300036401 | Bacteria | 1263 |
| 752 | Ga0373937_0502707 | 3300036401 | Unclassified | 1152 |
| 753 | Ga0373925_0010936 | 3300037068 | Bacteria | 6588 |
| 754 | Ga0373925_0173166 | 3300037068 | Bacteria | 1705 |
| 755 | Ga0395899_0202269 | 3300037312 | Bacteria | 1384 |
| 756 | Ga0395899_0207320 | 3300037312 | Unclassified | 1364 |
| 757 | Ga0395900_0090143 | 3300037418 | Bacteria | 3152 |
| 758 | Ga0395900_0124762 | 3300037418 | Bacteria | 2641 |
| 759 | Ga0395898_0032973 | 3300037466 | Bacteria | 5170 |
| 760 | Ga0395898_0426733 | 3300037466 | Unclassified | 1263 |
| 761 | Ga0436364_0573940 | 3300037853 | Bacteria | 1251 |
| 762 | Ga0436364_1204737 | 3300037853 | Unclassified | 1153 |
| 763 | Ga0436364_1459403 | 3300037853 | Bacteria | 1703 |
| 764 | Ga0395901_0001548 | 3300038443 | Bacteria | 23830 |
| 765 | Ga0395901_0003735 | 3300038443 | Bacteria | 15340 |
| 766 | Ga0395901_0378666 | 3300038443 | Bacteria | 1457 |
| 767 | Ga0395901_0501158 | 3300038443 | Unclassified | 1236 |
| 768 | Ga0395901_0724371 | 3300038443 | Bacteria | 990 |
| 769 | Ga0395901_1135387 | 3300038443 | Bacteria | 750 |
| 770 | Ga0436365_0379833 | 3300039437 | Bacteria | 8140 |
| 771 | Ga0436365_0530931 | 3300039437 | Bacteria | 35243 |
| 772 | Ga0436365_0659259 | 3300039437 | Unclassified | 3531 |
| 773 | Ga0436365_0960797 | 3300039437 | Bacteria | 5182 |
| 774 | Ga0436365_1112867 | 3300039437 | Bacteria | 50005 |
| 775 | Ga0436365_1117644 | 3300039437 | Bacteria | 5030 |
| 776 | Ga0436360_0155647 | 3300039438 | Bacteria | 2151 |
| 777 | Ga0436360_1341574 | 3300039438 | Bacteria | 2674 |
| 778 | Ga0436361_0589004 | 3300039447 | Bacteria | 3064 |
| 779 | Ga0436361_0591984 | 3300039447 | Bacteria | 1659 |
| 780 | Ga0436361_0627296 | 3300039447 | Unclassified | 1186 |
| 781 | Ga0436361_0756631 | 3300039447 | Bacteria | 4682 |
| 782 | Ga0436361_0765849 | 3300039447 | Bacteria | 3663 |
| 783 | Ga0436363_1091559 | 3300039450 | Bacteria | 2915 |
| 784 | Ga0436362_0090010 | 3300039453 | Unclassified | 897 |
| 785 | Ga0436362_1255536 | 3300039453 | Unclassified | 2543 |
| 786 | Ga0451798_1030054 | 3300041458 | Bacteria | 853 |
| 787 | Ga0451807_1769662 | 3300041486 | Bacteria | 873 |
| 788 | Ga0451839_1404823 | 3300041496 | Unclassified | 1219 |
| 789 | Ga0451853_0577735 | 3300041512 | Bacteria | 2215 |
| 790 | Ga0451853_4098400 | 3300041512 | Unclassified | 900 |
| 791 | Ga0439448_0018515 | 3300042005 | Bacteria | 2136 |
| 792 | Ga0439450_075403 | 3300042008 | Bacteria | 833 |
| 793 | Ga0439451_040672 | 3300042009 | Bacteria | 933 |
| 794 | Ga0439455_0000520 | 3300042012 | Bacteria | 5374 |
| 795 | Ga0439455_0015615 | 3300042012 | Bacteria | 1747 |
| 796 | Ga0439458_0014766 | 3300042157 | Unclassified | 1765 |
| 797 | Ga0439464_0017248 | 3300042439 | Unclassified | 1957 |
| 798 | Ga0466959_0483443 | 3300045049 | Unclassified | 838 |
| 799 | Ga0451576_0279364 | 3300045051 | Unclassified | 1746 |
| 800 | Ga0466967_0563433 | 3300045976 | Bacteria | 1122 |
| 801 | Ga0466967_0870977 | 3300045976 | Unclassified | 895 |
| 802 | Ga0495592_0221815 | 3300046454 | Bacteria | 1263 |
| 803 | Ga0495651_0014117 | 3300046462 | Bacteria | 6176 |
| 804 | Ga0495580_0250338 | 3300046472 | Bacteria | 1213 |
| 805 | Ga0495605_0090490 | 3300046474 | Unclassified | 1419 |
| 806 | Ga0495662_0272770 | 3300046476 | Bacteria | 833 |
| 807 | Ga0495584_0108807 | 3300046491 | Bacteria | 1402 |
| 808 | Ga0495584_0161081 | 3300046491 | Unclassified | 1140 |
| 809 | Ga0495584_0303464 | 3300046491 | Unclassified | 811 |
| 810 | Ga0495584_0361714 | 3300046491 | Unclassified | 737 |
| 811 | Ga0495585_0028725 | 3300046492 | Bacteria | 3170 |
| 812 | Ga0495628_0123486 | 3300046516 | Unclassified | 1984 |
| 813 | Ga0495630_0142315 | 3300046517 | Bacteria | 1824 |
| 814 | Ga0495643_0000443 | 3300046522 | Bacteria | 53481 |
| 815 | Ga0495663_0037248 | 3300046525 | Bacteria | 1467 |
| 816 | Ga0495642_0077726 | 3300046528 | Bacteria | 1394 |
| 817 | Ga0495652_0048747 | 3300046529 | Bacteria | 3628 |
| 818 | Ga0495587_0147204 | 3300046536 | Unclassified | 1343 |
| 819 | Ga0495598_0009934 | 3300046537 | Bacteria | 2265 |
| 820 | Ga0495598_0012805 | 3300046537 | Bacteria | 2067 |
| 821 | Ga0495598_0122913 | 3300046537 | Unclassified | 882 |
| 822 | Ga0495645_0006709 | 3300046543 | Bacteria | 7998 |
| 823 | Ga0495645_0094370 | 3300046543 | Unclassified | 2134 |
| 824 | Ga0495667_0087550 | 3300046559 | Unclassified | 2020 |
| 825 | Ga0495667_0214586 | 3300046559 | Bacteria | 1229 |
| 826 | Ga0495634_0029418 | 3300046642 | Bacteria | 3803 |
| 827 | Ga0495635_0357877 | 3300046663 | Bacteria | 973 |
| 828 | Ga0495659_0022858 | 3300046664 | Unclassified | 2119 |
| 829 | Ga0495659_0191686 | 3300046664 | Unclassified | 836 |
| 830 | Ga0495661_0216664 | 3300046665 | Unclassified | 994 |
| 831 | Ga0495588_0176558 | 3300046674 | Bacteria | 1129 |
| 832 | Ga0495657_0354579 | 3300046675 | Bacteria | 868 |
| 833 | Ga0495599_0002744 | 3300046678 | Bacteria | 10272 |
| 834 | Ga0495623_0042456 | 3300046679 | Bacteria | 2896 |
| 835 | Ga0495647_0099853 | 3300046681 | Unclassified | 1201 |
| 836 | Ga0495658_0083075 | 3300046683 | Bacteria | 1883 |
| 837 | Ga0495669_0017438 | 3300046684 | Unclassified | 3083 |
| 838 | Ga0495669_0047039 | 3300046684 | Unclassified | 1926 |
| 839 | Ga0495669_0074203 | 3300046684 | Bacteria | 1555 |
| 840 | Ga0495669_0192932 | 3300046684 | Unclassified | 972 |
| 841 | Ga0495613_0501925 | 3300046689 | Bacteria | 817 |
| 842 | Ga0495624_0122878 | 3300046690 | Bacteria | 1594 |
| 843 | Ga0495674_0231750 | 3300047319 | Unclassified | 1524 |
| 844 | Ga0495674_0583287 | 3300047319 | Bacteria | 887 |
| 845 | Ga0495680_0297735 | 3300047322 | Bacteria | 1133 |
| 846 | Ga0495680_0393522 | 3300047322 | Bacteria | 958 |
| 847 | Ga0495683_0153094 | 3300047323 | Bacteria | 1072 |
| 848 | Ga0495675_0059492 | 3300047444 | Bacteria | 2422 |
| 849 | Ga0495675_0154776 | 3300047444 | Bacteria | 1414 |
| 850 | Ga0495681_0108882 | 3300047470 | Unclassified | 1202 |
| 851 | Ga0495684_0010873 | 3300047471 | Bacteria | 7037 |
| 852 | Ga0495684_0037920 | 3300047471 | Bacteria | 3697 |
| 853 | Ga0495602_0107304 | 3300048088 | Unclassified | 2277 |
| 854 | Ga0496100_0046887 | 3300048903 | Bacteria | 2782 |
| 855 | Ga0496100_0063145 | 3300048903 | Bacteria | 2447 |
| 856 | Ga0496100_0443269 | 3300048903 | Bacteria | 994 |
| 857 | Ga0496101_0000422 | 3300048904 | Bacteria | 27267 |
| 858 | Ga0496101_0124446 | 3300048904 | Bacteria | 1953 |
| 859 | Ga0496102_0054945 | 3300048905 | Bacteria | 3631 |
| 860 | Ga0496102_0097697 | 3300048905 | Bacteria | 2724 |
| 861 | Ga0496102_0291428 | 3300048905 | Unclassified | 1538 |
| 862 | Ga0496102_0389554 | 3300048905 | Bacteria | 1311 |
| 863 | Ga0496103_0031615 | 3300048906 | Bacteria | 3226 |
| 864 | Ga0496104_0054985 | 3300048907 | Unclassified | 3763 |
| 865 | Ga0496104_0065707 | 3300048907 | Bacteria | 3443 |
| 866 | Ga0496104_0166797 | 3300048907 | Bacteria | 2112 |
| 867 | Ga0496104_0228305 | 3300048907 | Bacteria | 1774 |
| 868 | Ga0496104_0265953 | 3300048907 | Bacteria | 1627 |
| 869 | Ga0496105_0133891 | 3300048908 | Bacteria | 2042 |
| 870 | Ga0496105_0142286 | 3300048908 | Bacteria | 1974 |
| 871 | Ga0496105_0212441 | 3300048908 | Bacteria | 1577 |
| 872 | Ga0496105_0420953 | 3300048908 | Bacteria | 1057 |
| 873 | Ga0496106_0234696 | 3300048909 | Bacteria | 1465 |
| 874 | Ga0496106_0298970 | 3300048909 | Bacteria | 1291 |
| 875 | Ga0496106_0327013 | 3300048909 | Bacteria | 1231 |
| 876 | Ga0496106_0421414 | 3300048909 | Bacteria | 1073 |
| 877 | Ga0496107_0010651 | 3300048910 | Bacteria | 6393 |
| 878 | Ga0496107_0187658 | 3300048910 | Bacteria | 1536 |
| 879 | Ga0496107_0845781 | 3300048910 | Bacteria | 669 |
| 880 | Ga0496108_0334790 | 3300048911 | Unclassified | 1320 |
| 881 | Ga0496108_0521243 | 3300048911 | Bacteria | 1038 |
| 882 | Ga0496108_0990047 | 3300048911 | Bacteria | 718 |
| 883 | Ga0496109_0005026 | 3300048912 | Bacteria | 11049 |
| 884 | Ga0496109_0246726 | 3300048912 | Unclassified | 1681 |
| 885 | Ga0496109_0254926 | 3300048912 | Unclassified | 1652 |
| 886 | Ga0496109_0352420 | 3300048912 | Unclassified | 1390 |
| 887 | Ga0496109_0458599 | 3300048912 | Unclassified | 1204 |
| 888 | Ga0496109_0533444 | 3300048912 | Unclassified | 1107 |
| 889 | Ga0496109_0745718 | 3300048912 | Bacteria | 917 |
| 890 | Ga0496110_0064443 | 3300048913 | Bacteria | 3239 |
| 891 | Ga0496110_0076702 | 3300048913 | Bacteria | 2972 |
| 892 | Ga0496110_0237909 | 3300048913 | Bacteria | 1657 |
| 893 | Ga0496110_0586688 | 3300048913 | Unclassified | 1012 |
| 894 | Ga0496111_0078935 | 3300048914 | Bacteria | 2401 |
| 895 | Ga0496111_0216760 | 3300048914 | Unclassified | 1422 |
| 896 | Ga0496112_0020455 | 3300048915 | Bacteria | 6274 |
| 897 | Ga0496112_0034027 | 3300048915 | Bacteria | 4958 |
| 898 | Ga0496112_0096332 | 3300048915 | Unclassified | 2929 |
| 899 | Ga0496112_0205981 | 3300048915 | Unclassified | 1925 |
| 900 | Ga0496112_0276295 | 3300048915 | Bacteria | 1627 |
| 901 | Ga0496112_0298988 | 3300048915 | Bacteria | 1555 |
| 902 | Ga0496112_0676835 | 3300048915 | Unclassified | 960 |
| 903 | Ga0496113_0040430 | 3300048916 | Bacteria | 3437 |
| 904 | Ga0496113_0152026 | 3300048916 | Unclassified | 1827 |
| 905 | Ga0496115_0006139 | 3300048918 | Bacteria | 8784 |
| 906 | Ga0496115_0059623 | 3300048918 | Bacteria | 3073 |
| 907 | Ga0496115_0098738 | 3300048918 | Unclassified | 2392 |
| 908 | Ga0496115_0208927 | 3300048918 | Bacteria | 1612 |
| 909 | Ga0496115_0288015 | 3300048918 | Unclassified | 1348 |
| 910 | Ga0501080_0109190 | 3300049742 | Bacteria | 2564 |
| 911 | nmdc:mga00v17_478168_c1 | 3300050491 | Bacteria | 808 |
| 912 | nmdc:mga0k408_137531_c1 | 3300050493 | Unclassified | 1452 |
| 913 | nmdc:mga0k408_236189_c1 | 3300050493 | Unclassified | 1091 |
| 914 | nmdc:mga0k408_351_c1 | 3300050493 | Bacteria | 25242 |
| 915 | nmdc:mga0k408_437_c1 | 3300050493 | Bacteria | 22803 |
| 916 | nmdc:mga0k408_600297_c1 | 3300050493 | Unclassified | 649 |
| 917 | nmdc:mga07m45_16569_c1 | 3300050496 | Bacteria | 3945 |
| 918 | nmdc:mga07m45_377399_c1 | 3300050496 | Unclassified | 823 |
| 919 | nmdc:mga05p37_160571_c1 | 3300050507 | Bacteria | 2745 |
| 920 | nmdc:mga05p37_4003_c1 | 3300050507 | Bacteria | 17226 |
| 921 | nmdc:mga09592_503002_c1 | 3300050508 | Bacteria | 1043 |
| 922 | nmdc:mga08y16_570412_c1 | 3300050511 | Bacteria | 1143 |
| 923 | nmdc:mga0rr50_1021417_c1 | 3300050513 | Bacteria | 704 |
| 924 | nmdc:mga0rr50_285548_c1 | 3300050513 | Unclassified | 1378 |
| 925 | nmdc:mga0rr50_570701_c1 | 3300050513 | Unclassified | 964 |
| 926 | nmdc:mga08x19_148929_c1 | 3300050514 | Unclassified | 1584 |
| 927 | nmdc:mga08x19_215332_c1 | 3300050514 | Unclassified | 1319 |
| 928 | nmdc:mga0a205_881180_c1 | 3300050515 | Unclassified | 742 |
| 929 | nmdc:mga0a205_938600_c1 | 3300050515 | Unclassified | 712 |
| 930 | nmdc:mga0sz30_59259_c1 | 3300050516 | Bacteria | 1282 |
| 931 | Ga0495601_0003313 | 3300053077 | Bacteria | 9215 |
| 932 | Ga0495601_0035889 | 3300053077 | Bacteria | 3096 |
| 933 | Ga0500610_0164417 | 3300053079 | Bacteria | 1101 |
| 934 | Ga0495595_0344038 | 3300053084 | Bacteria | 752 |
| 935 | Ga0495619_0616924 | 3300053085 | Bacteria | 741 |
| 936 | Ga0500556_0001824 | 3300053104 | Bacteria | 7800 |
| 937 | Ga0500642_0002353 | 3300053130 | Bacteria | 5534 |
| 938 | Ga0500616_0003203 | 3300053153 | Bacteria | 12709 |
| 939 | Ga0495657_0193567 | |||
| 940 | CNXas_1000206 | |||
| 941 | JGI24032J14994_101162 | |||
| 942 | JGI24737J22298_10012645 | |||
| 943 | JGI24744J21845_10012038 | |||
| 944 | JGI24035J26624_1000141 | |||
| 945 | JGI24035J26624_1007613 | |||
| 946 | JGI24035J26624_1011137 | |||
| 947 | JGI25406J46586_10000087 | |||
| 948 | JGI25406J46586_10095645 | |||
| 949 | JGI25404J52841_10004829 | |||
| 950 | JGI25405J52794_10000412 | |||
| 951 | JGI25405J52794_10002813 | |||
| 952 | Ga0065714_10094929 | |||
| 953 | Ga0065704_10004850 | |||
| 954 | Ga0065704_10009573 | |||
| 955 | Ga0065704_10022829 | |||
| 956 | Ga0065704_10073950 | |||
| 957 | Ga0065704_10091739 | |||
| 958 | Ga0065712_10001692 | |||
| 959 | Ga0065712_10004664 | |||
| 960 | Ga0065712_10006386 | |||
| 961 | Ga0065712_10016478 | |||
| 962 | Ga0065712_10026337 | |||
| 963 | Ga0065712_10116148 | |||
| 964 | Ga0065712_10137998 | |||
| 965 | Ga0065712_10205871 | |||
| 966 | Ga0065712_10227849 | |||
| 967 | Ga0065712_10266013 | |||
| 968 | Ga0065715_10000709 | |||
| 969 | Ga0065715_10001727 | |||
| 970 | Ga0065715_10089933 | |||
| 971 | Ga0065715_10119901 | |||
| 972 | Ga0065715_10167516 | |||
| 973 | Ga0065715_10174334 | |||
| 974 | Ga0065715_10255269 | |||
| 975 | Ga0065715_10298847 | |||
| 976 | Ga0065715_10327626 | |||
| 977 | Ga0065715_10368088 | |||
| 978 | Ga0065715_10369071 | |||
| 979 | Ga0065715_10426084 | |||
| 980 | Ga0065707_10003005 | |||
| 981 | Ga0065707_10005953 | |||
| 982 | Ga0065707_10013106 | |||
| 983 | Ga0070658_10005882 | |||
| 984 | Ga0070658_10136660 | |||
| 985 | Ga0070658_10314682 | |||
| 986 | Ga0070658_10598176 | |||
| 987 | Ga0070676_10007273 | |||
| 988 | Ga0070676_10013117 | |||
| 989 | Ga0070676_10025549 | |||
| 990 | Ga0070676_10171591 | |||
| 991 | Ga0070676_10392529 | |||
| 992 | Ga0070676_10875274 | |||
| 993 | Ga0070683_100006008 | |||
| 994 | Ga0070683_100010449 | |||
| 995 | Ga0070683_100114079 | |||
| 996 | Ga0070683_100359518 | |||
| 997 | Ga0070690_100027697 | |||
| 998 | Ga0070690_100236802 | |||
| 999 | Ga0070690_100582137 | |||
| 1000 | Ga0070690_100637363 | |||
| 1001 | Ga0070670_100014931 | |||
| 1002 | Ga0070670_100023992 | |||
| 1003 | Ga0070670_100052927 | |||
| 1004 | Ga0070670_100122580 | |||
| 1005 | Ga0070670_100547513 | |||
| 1006 | Ga0070677_10003178 | |||
| 1007 | Ga0070677_10118311 | |||
| 1008 | Ga0068869_100061991 | |||
| 1009 | Ga0070666_10009111 | |||
| 1010 | Ga0070666_10014419 | |||
| 1011 | Ga0070666_10063078 | |||
| 1012 | Ga0070666_10115524 | |||
| 1013 | Ga0070666_10156365 | |||
| 1014 | Ga0070680_100026698 | |||
| 1015 | Ga0070680_100558357 | |||
| 1016 | Ga0070682_100075346 | |||
| 1017 | Ga0068868_100099890 | |||
| 1018 | Ga0068868_100109169 | |||
| 1019 | Ga0068868_100144993 | |||
| 1020 | Ga0070660_100083058 | |||
| 1021 | Ga0070660_100123059 | |||
| 1022 | Ga0070660_100138468 | |||
| 1023 | Ga0070660_100306739 | |||
| 1024 | Ga0070660_100436038 | |||
| 1025 | Ga0070689_100000978 | |||
| 1026 | Ga0070689_100075259 | |||
| 1027 | Ga0070689_100085949 | |||
| 1028 | Ga0070689_100128485 | |||
| 1029 | Ga0070691_10242126 | |||
| 1030 | Ga0070687_100013691 | |||
| 1031 | Ga0070687_100027127 | |||
| 1032 | Ga0070661_100087820 | |||
| 1033 | Ga0070661_100211272 | |||
| 1034 | Ga0070661_100343187 | |||
| 1035 | Ga0070668_100007657 | |||
| 1036 | Ga0070668_100023570 | |||
| 1037 | Ga0070668_100051505 | |||
| 1038 | Ga0070668_100165243 | |||
| 1039 | Ga0070669_100002655 | |||
| 1040 | Ga0070669_100002855 | |||
| 1041 | Ga0070669_100078802 | |||
| 1042 | Ga0070669_100149960 | |||
| 1043 | Ga0070675_100003712 | |||
| 1044 | Ga0070675_100009595 | |||
| 1045 | Ga0070675_100012255 | |||
| 1046 | Ga0070675_100051731 | |||
| 1047 | Ga0070675_100063293 | |||
| 1048 | Ga0070675_100071895 | |||
| 1049 | Ga0070675_100092059 | |||
| 1050 | Ga0070675_100333325 | |||
| 1051 | Ga0070675_100380263 | |||
| 1052 | Ga0070675_100527999 | |||
| 1053 | Ga0070671_100022030 | |||
| 1054 | Ga0070671_100027480 | |||
| 1055 | Ga0070671_100095441 | |||
| 1056 | Ga0070671_100119176 | |||
| 1057 | Ga0070671_100159825 | |||
| 1058 | Ga0070671_100214880 | |||
| 1059 | Ga0070671_100416101 | |||
| 1060 | Ga0070671_100813306 | |||
| 1061 | Ga0070674_100027776 | |||
| 1062 | Ga0070674_100033088 | |||
| 1063 | Ga0070674_100184196 | |||
| 1064 | Ga0070674_100935327 | |||
| 1065 | Ga0070674_101058546 | |||
| 1066 | Ga0070673_100000434 | |||
| 1067 | Ga0070673_100016374 | |||
| 1068 | Ga0070673_100022537 | |||
| 1069 | Ga0070673_100186455 | |||
| 1070 | Ga0070673_100294201 | |||
| 1071 | Ga0070688_100007537 | |||
| 1072 | Ga0070688_100021992 | |||
| 1073 | Ga0070688_100030150 | |||
| 1074 | Ga0070688_100076237 | |||
| 1075 | Ga0070688_100118777 | |||
| 1076 | Ga0070688_100184754 | |||
| 1077 | Ga0070688_100206680 | |||
| 1078 | Ga0070688_100249770 | |||
| 1079 | Ga0070688_100376408 | |||
| 1080 | Ga0070659_100000971 | |||
| 1081 | Ga0070659_100052792 | |||
| 1082 | Ga0070667_100006762 | |||
| 1083 | Ga0070667_100055129 | |||
| 1084 | Ga0070667_100108365 | |||
| 1085 | Ga0070667_100137433 | |||
| 1086 | Ga0070667_100247302 | |||
| 1087 | Ga0070667_100272922 | |||
| 1088 | Ga0070667_100664626 | |||
| 1089 | Ga0070709_10217629 | |||
| 1090 | Ga0070709_10349913 | |||
| 1091 | Ga0070709_10410699 | |||
| 1092 | Ga0070714_100022318 | |||
| 1093 | Ga0070714_100050890 | |||
| 1094 | Ga0070714_100112238 | |||
| 1095 | Ga0070714_100561150 | |||
| 1096 | Ga0070714_100834323 | |||
| 1097 | Ga0070713_100037190 | |||
| 1098 | Ga0070713_100115542 | |||
| 1099 | Ga0070713_100226852 | |||
| 1100 | Ga0070713_100258111 | |||
| 1101 | Ga0070713_100293681 | |||
| 1102 | Ga0070713_100560086 | |||
| 1103 | Ga0070710_10075475 | |||
| 1104 | Ga0070710_10082369 | |||
| 1105 | Ga0070710_10148035 | |||
| 1106 | Ga0070710_10234718 | |||
| 1107 | Ga0070710_10315938 | |||
| 1108 | Ga0070701_10153599 | |||
| 1109 | Ga0070711_100012799 | |||
| 1110 | Ga0070711_100020670 | |||
| 1111 | Ga0070711_100201434 | |||
| 1112 | Ga0070705_100128756 | |||
| 1113 | Ga0070705_100146728 | |||
| 1114 | Ga0070705_100196055 | |||
| 1115 | Ga0070705_100276395 | |||
| 1116 | Ga0070700_100039609 | |||
| 1117 | Ga0070694_100024137 | |||
| 1118 | Ga0070708_100012016 | |||
| 1119 | Ga0070708_100047427 | |||
| 1120 | Ga0070708_100072775 | |||
| 1121 | Ga0070708_100085529 | |||
| 1122 | Ga0070708_100090982 | |||
| 1123 | Ga0070708_100220325 | |||
| 1124 | Ga0070708_100242041 | |||
| 1125 | Ga0070708_100291344 | |||
| 1126 | Ga0070708_100966426 | |||
| 1127 | Ga0070663_100007018 | |||
| 1128 | Ga0070663_100147391 | |||
| 1129 | Ga0070663_100502859 | |||
| 1130 | Ga0070678_100014316 | |||
| 1131 | Ga0070678_100096894 | |||
| 1132 | Ga0070678_100588886 | |||
| 1133 | Ga0070662_100003832 | |||
| 1134 | Ga0070662_100043784 | |||
| 1135 | Ga0070662_100131592 | |||
| 1136 | Ga0070662_100146136 | |||
| 1137 | Ga0070662_100375863 | |||
| 1138 | Ga0070662_101040614 | |||
| 1139 | Ga0068867_100032843 | |||
| 1140 | Ga0068867_100086414 | |||
| 1141 | Ga0068867_100109459 | |||
| 1142 | Ga0068867_100860567 | |||
| 1143 | Ga0070685_10067747 | |||
| 1144 | Ga0070706_100000311 | |||
| 1145 | Ga0070706_100001900 | |||
| 1146 | Ga0070706_100004096 | |||
| 1147 | Ga0070706_100013504 | |||
| 1148 | Ga0070706_100014263 | |||
| 1149 | Ga0070706_100042062 | |||
| 1150 | Ga0070706_100083975 | |||
| 1151 | Ga0070706_100117340 | |||
| 1152 | Ga0070706_100132337 | |||
| 1153 | Ga0070706_100300489 | |||
| 1154 | Ga0070706_100513346 | |||
| 1155 | Ga0070706_100590980 | |||
| 1156 | Ga0070706_101010697 | |||
| 1157 | Ga0070707_100022786 | |||
| 1158 | Ga0070707_100052961 | |||
| 1159 | Ga0070707_100062513 | |||
| 1160 | Ga0070707_100082066 | |||
| 1161 | Ga0070707_100126280 | |||
| 1162 | Ga0070707_100284961 | |||
| 1163 | Ga0070707_100329039 | |||
| 1164 | Ga0070707_100511374 | |||
| 1165 | Ga0070707_100597627 | |||
| 1166 | Ga0070698_100003506 | |||
| 1167 | Ga0070698_100025039 | |||
| 1168 | Ga0070698_100077092 | |||
| 1169 | Ga0070698_100083823 | |||
| 1170 | Ga0070698_100258988 | |||
| 1171 | Ga0070698_100263776 | |||
| 1172 | Ga0070699_100010688 | |||
| 1173 | Ga0070699_100036437 | |||
| 1174 | Ga0070699_100077573 | |||
| 1175 | Ga0070699_100135107 | |||
| 1176 | Ga0070679_100701639 | |||
| 1177 | Ga0070684_100006663 | |||
| 1178 | Ga0070684_100041434 | |||
| 1179 | Ga0070684_100099186 | |||
| 1180 | Ga0070684_100268320 | |||
| 1181 | Ga0070684_100597902 | |||
| 1182 | Ga0070697_100002917 | |||
| 1183 | Ga0070697_100003353 | |||
| 1184 | Ga0070697_100012443 | |||
| 1185 | Ga0070697_100071365 | |||
| 1186 | Ga0070697_100074750 | |||
| 1187 | Ga0070697_100098708 | |||
| 1188 | Ga0070697_100126546 | |||
| 1189 | Ga0070697_100152290 | |||
| 1190 | Ga0070697_100242102 | |||
| 1191 | Ga0070697_100409997 | |||
| 1192 | Ga0070697_100642290 | |||
| 1193 | Ga0068853_100000002 | |||
| 1194 | Ga0068853_100371264 | |||
| 1195 | Ga0070672_100006356 | |||
| 1196 | Ga0070672_100021583 | |||
| 1197 | Ga0070672_100189510 | |||
| 1198 | Ga0070672_100270691 | |||
| 1199 | Ga0070672_100544384 | |||
| 1200 | Ga0070696_100070536 | |||
| 1201 | Ga0070665_100033364 | |||
| 1202 | Ga0070665_100048215 | |||
| 1203 | Ga0070665_100094465 | |||
| 1204 | Ga0070665_100126059 | |||
| 1205 | Ga0070665_100539402 | |||
| 1206 | Ga0070704_100002924 | |||
| 1207 | Ga0070704_100074513 | |||
| 1208 | Ga0070704_100576357 | |||
| 1209 | Ga0068855_100013156 | |||
| 1210 | Ga0068855_100281988 | |||
| 1211 | Ga0068854_100266766 | |||
| 1212 | Ga0068854_100541044 | |||
| 1213 | Ga0068856_100096159 | |||
| 1214 | Ga0068856_100246292 | |||
| 1215 | Ga0068856_101426804 | |||
| 1216 | Ga0068856_101546904 | |||
| 1217 | Ga0070702_100086753 | |||
| 1218 | Ga0068859_100990974 | |||
| 1219 | Ga0068859_101132319 | |||
| 1220 | Ga0068864_100274762 | |||
| 1221 | Ga0068864_101170157 | |||
| 1222 | Ga0068866_10112301 | |||
| 1223 | Ga0068863_100003600 | |||
| 1224 | Ga0068863_100180547 | |||
| 1225 | Ga0068863_100240893 | |||
| 1226 | Ga0068863_100536375 | |||
| 1227 | Ga0068858_100010197 | |||
| 1228 | Ga0068858_100068419 | |||
| 1229 | Ga0068858_100320271 | |||
| 1230 | Ga0068860_100000576 | |||
| 1231 | Ga0068860_100037757 | |||
| 1232 | Ga0068860_100111877 | |||
| 1233 | Ga0068860_100350199 | |||
| 1234 | Ga0068860_100400993 | |||
| 1235 | Ga0068860_100889964 | |||
| 1236 | Ga0068862_100267237 | |||
| 1237 | Ga0081455_10001872 | |||
| 1238 | Ga0081455_10016935 | |||
| 1239 | Ga0081455_10044602 | |||
| 1240 | Ga0081455_10049102 | |||
| 1241 | Ga0081540_1000036 | |||
| 1242 | Ga0081540_1020870 | |||
| 1243 | Ga0081540_1034481 | |||
| 1244 | Ga0081539_10000671 | |||
| 1245 | Ga0081539_10001132 | |||
| 1246 | Ga0081539_10040243 | |||
| 1247 | Ga0081539_10175139 | |||
| 1248 | Ga0070717_10091589 | |||
| 1249 | Ga0070717_10093046 | |||
| 1250 | Ga0070717_10119455 | |||
| 1251 | Ga0070717_10143413 | |||
| 1252 | Ga0070717_10171272 | |||
| 1253 | Ga0070717_10183786 | |||
| 1254 | Ga0070717_10216627 | |||
| 1255 | Ga0075363_100028247 | |||
| 1256 | Ga0070715_10047133 | |||
| 1257 | Ga0070715_10052209 | |||
| 1258 | Ga0070716_100016121 | |||
| 1259 | Ga0070716_100071096 | |||
| 1260 | Ga0070716_100187760 | |||
| 1261 | Ga0070716_100326689 | |||
| 1262 | Ga0070716_100356862 | |||
| 1263 | Ga0070716_100496278 | |||
| 1264 | Ga0070712_100103548 | |||
| 1265 | Ga0070712_100103973 | |||
| 1266 | Ga0070712_100122575 | |||
| 1267 | Ga0070712_100217983 | |||
| 1268 | Ga0070712_100302264 | |||
| 1269 | Ga0070712_100350858 | |||
| 1270 | Ga0070712_100382815 | |||
| 1271 | Ga0070712_100432168 | |||
| 1272 | Ga0070712_100537545 | |||
| 1273 | Ga0070712_101037270 | |||
| 1274 | Ga0075362_10000662 | |||
| 1275 | Ga0075362_10018163 | |||
| 1276 | Ga0075369_10062924 | |||
| 1277 | Ga0097621_100014680 | |||
| 1278 | Ga0097621_100035139 | |||
| 1279 | Ga0097621_100097958 | |||
| 1280 | Ga0097621_100257754 | |||
| 1281 | Ga0097621_100713517 | |||
| 1282 | Ga0075370_10004090 | |||
| 1283 | Ga0068871_100012306 | |||
| 1284 | Ga0068871_100035252 | |||
| 1285 | Ga0068871_100097947 | |||
| 1286 | Ga0075428_100210081 | |||
| 1287 | Ga0075433_10296210 | |||
| 1288 | Ga0075433_10390907 | |||
| 1289 | Ga0075434_100698607 | |||
| 1290 | Ga0075434_100839157 | |||
| 1291 | Ga0075434_100933005 | |||
| 1292 | Ga0068865_100020657 | |||
| 1293 | Ga0068865_100063909 | |||
| 1294 | Ga0075436_100115767 | |||
| 1295 | Ga0075436_100464806 | |||
| 1296 | Ga0097620_100990952 | |||
| 1297 | Ga0097620_101132438 | |||
| 1298 | Ga0075435_100261554 | |||
| 1299 | Ga0075435_100334131 | |||
| 1300 | Ga0099794_10060393 | |||
| 1301 | Ga0099795_10003178 | |||
| 1302 | Ga0099795_10041176 | |||
| 1303 | Ga0099795_10075838 | |||
| 1304 | Ga0099795_10199188 | |||
| 1305 | Ga0105240_10000412 | |||
| 1306 | Ga0105240_10401552 | |||
| 1307 | Ga0111539_10172555 | |||
| 1308 | Ga0111539_10249144 | |||
| 1309 | Ga0111539_10796145 | |||
| 1310 | Ga0105245_10026583 | |||
| 1311 | Ga0105245_10283623 | |||
| 1312 | Ga0105245_10568739 | |||
| 1313 | Ga0105247_10191930 | |||
| 1314 | Ga0114129_10007418 | |||
| 1315 | Ga0114129_10162066 | |||
| 1316 | Ga0114129_10244078 | |||
| 1317 | Ga0114129_10598948 | |||
| 1318 | Ga0105243_10047154 | |||
| 1319 | Ga0105241_10118065 | |||
| 1320 | Ga0105241_10341507 | |||
| 1321 | Ga0105241_10688375 | |||
| 1322 | Ga0105242_10086583 | |||
| 1323 | Ga0105242_11341877 | |||
| 1324 | Ga0105237_10006408 | |||
| 1325 | Ga0105237_10215473 | |||
| 1326 | Ga0105237_10387062 | |||
| 1327 | Ga0105237_10580387 | |||
| 1328 | Ga0105249_10074161 | |||
| 1329 | Ga0099796_10029945 | |||
| 1330 | Ga0099796_10239664 | |||
| 1331 | Ga0105239_10086420 | |||
| 1332 | Ga0105239_10134580 | |||
| 1333 | Ga0105239_10135294 | |||
| 1334 | Ga0105239_10155992 | |||
| 1335 | Ga0105239_10217548 | |||
| 1336 | Ga0105239_11156063 | |||
| 1337 | Ga0157371_10227161 | |||
| 1338 | Ga0157370_10516754 | |||
| 1339 | Ga0157369_10441889 | |||
| 1340 | Ga0157369_10644028 | |||
| 1341 | Ga0157374_10000160 | |||
| 1342 | Ga0157374_10016198 | |||
| 1343 | Ga0157374_10033371 | |||
| 1344 | Ga0157374_10083550 | |||
| 1345 | Ga0157374_10111000 | |||
| 1346 | Ga0157374_10230839 | |||
| 1347 | Ga0157374_10267638 | |||
| 1348 | Ga0157374_10600091 | |||
| 1349 | Ga0157374_11118901 | |||
| 1350 | Ga0157374_11437729 | |||
| 1351 | Ga0157378_10006750 | |||
| 1352 | Ga0157378_10023174 | |||
| 1353 | Ga0157378_10033296 | |||
| 1354 | Ga0157378_10077204 | |||
| 1355 | Ga0157378_10097175 | |||
| 1356 | Ga0157378_10108165 | |||
| 1357 | Ga0157378_10202123 | |||
| 1358 | Ga0157378_10231751 | |||
| 1359 | Ga0157378_10231898 | |||
| 1360 | Ga0157378_10567103 | |||
| 1361 | Ga0157378_10616943 | |||
| 1362 | Ga0157378_10689553 | |||
| 1363 | Ga0157378_10991161 | |||
| 1364 | Ga0163162_10008629 | |||
| 1365 | Ga0163162_10013145 | |||
| 1366 | Ga0163162_10021558 | |||
| 1367 | Ga0163162_10021637 | |||
| 1368 | Ga0163162_10043308 | |||
| 1369 | Ga0163162_10057606 | |||
| 1370 | Ga0163162_10074321 | |||
| 1371 | Ga0163162_10224840 | |||
| 1372 | Ga0163162_10351894 | |||
| 1373 | Ga0157372_10414364 | |||
| 1374 | Ga0157372_10429439 | |||
| 1375 | Ga0157372_11358471 | |||
| 1376 | Ga0157375_10002485 | |||
| 1377 | Ga0157375_10011674 | |||
| 1378 | Ga0157375_10052405 | |||
| 1379 | Ga0157375_10063296 | |||
| 1380 | Ga0157375_10115628 | |||
| 1381 | Ga0157375_11130186 | |||
| 1382 | Ga0157375_11380639 | |||
| 1383 | Ga0157375_11598394 | |||
| 1384 | Ga0163163_10119296 | |||
| 1385 | Ga0163163_10141245 | |||
| 1386 | Ga0163163_10269781 | |||
| 1387 | Ga0163163_10273312 | |||
| 1388 | Ga0157377_10048614 | |||
| 1389 | Ga0157379_10343869 | |||
| 1390 | Ga0157376_10018271 | |||
| 1391 | Ga0157376_10081124 | |||
| 1392 | Ga0157376_10091651 | |||
| 1393 | Ga0157376_10135143 | |||
| 1394 | Ga0157376_10508681 | |||
| 1395 | Ga0157376_10584334 | |||
| 1396 | Ga0163161_10005833 | |||
| 1397 | Ga0163161_10119730 | |||
| 1398 | Ga0163161_10203079 | |||
| 1399 | Ga0163161_10529095 | |||
| 1400 | Ga0206350_11555172 | |||
| 1401 | Ga0213873_10081446 | |||
| 1402 | Ga0213872_10002738 | |||
| 1403 | Ga0213872_10016657 | |||
| 1404 | Ga0213872_10095450 | |||
| 1405 | Ga0213876_10000779 | |||
| 1406 | Ga0213876_10044348 | |||
| 1407 | Ga0213876_10055287 | |||
| 1408 | Ga0213871_10055446 | |||
| 1409 | Ga0207666_1001627 | |||
| 1410 | Ga0207666_1003597 | |||
| 1411 | Ga0207666_1005596 | |||
| 1412 | Ga0207673_1004302 | |||
| 1413 | Ga0209050_1006977 | |||
| 1414 | Ga0207697_10000116 | |||
| 1415 | Ga0207697_10000348 | |||
| 1416 | Ga0207697_10001294 | |||
| 1417 | Ga0207697_10001541 | |||
| 1418 | Ga0207697_10002095 | |||
| 1419 | Ga0207697_10012438 | |||
| 1420 | Ga0207697_10025316 | |||
| 1421 | Ga0207653_10026242 | |||
| 1422 | Ga0207682_10044496 | |||
| 1423 | Ga0207692_10035612 | |||
| 1424 | Ga0207692_10118584 | |||
| 1425 | Ga0207692_10165832 | |||
| 1426 | Ga0207692_10374500 | |||
| 1427 | Ga0207642_10296466 | |||
| 1428 | Ga0207688_10006712 | |||
| 1429 | Ga0207688_10016999 | |||
| 1430 | Ga0207688_10028348 | |||
| 1431 | Ga0207688_10091145 | |||
| 1432 | Ga0207680_10006888 | |||
| 1433 | Ga0207680_10070344 | |||
| 1434 | Ga0207680_10640881 | |||
| 1435 | Ga0207647_10004861 | |||
| 1436 | Ga0207685_10022911 | |||
| 1437 | Ga0207699_10023294 | |||
| 1438 | Ga0207645_10001573 | |||
| 1439 | Ga0207645_10004457 | |||
| 1440 | Ga0207645_10006861 | |||
| 1441 | Ga0207645_10036418 | |||
| 1442 | Ga0207645_10175933 | |||
| 1443 | Ga0207645_10178030 | |||
| 1444 | Ga0207643_10194845 | |||
| 1445 | Ga0207643_10476174 | |||
| 1446 | Ga0207705_10075617 | |||
| 1447 | Ga0207684_10000337 | |||
| 1448 | Ga0207684_10004700 | |||
| 1449 | Ga0207684_10011043 | |||
| 1450 | Ga0207684_10024895 | |||
| 1451 | Ga0207684_10075011 | |||
| 1452 | Ga0207684_10102137 | |||
| 1453 | Ga0207684_10104691 | |||
| 1454 | Ga0207684_10107589 | |||
| 1455 | Ga0207684_10111774 | |||
| 1456 | Ga0207684_10149719 | |||
| 1457 | Ga0207684_10194513 | |||
| 1458 | Ga0207684_10440190 | |||
| 1459 | Ga0207684_10509917 | |||
| 1460 | Ga0207684_10755332 | |||
| 1461 | Ga0207654_10196502 | |||
| 1462 | Ga0207707_10066916 | |||
| 1463 | Ga0207695_10000783 | |||
| 1464 | Ga0207671_10020513 | |||
| 1465 | Ga0207671_10669159 | |||
| 1466 | Ga0207693_10008693 | |||
| 1467 | Ga0207693_10015810 | |||
| 1468 | Ga0207693_10035674 | |||
| 1469 | Ga0207693_10038294 | |||
| 1470 | Ga0207693_10063349 | |||
| 1471 | Ga0207693_10084225 | |||
| 1472 | Ga0207693_10094418 | |||
| 1473 | Ga0207693_10213180 | |||
| 1474 | Ga0207693_10241245 | |||
| 1475 | Ga0207693_10382709 | |||
| 1476 | Ga0207693_10659598 | |||
| 1477 | Ga0207663_10029098 | |||
| 1478 | Ga0207663_10031762 | |||
| 1479 | Ga0207663_10055206 | |||
| 1480 | Ga0207663_10177341 | |||
| 1481 | Ga0207663_10375080 | |||
| 1482 | Ga0207663_10743878 | |||
| 1483 | Ga0207660_10022146 | |||
| 1484 | Ga0207660_10211559 | |||
| 1485 | Ga0207662_10042413 | |||
| 1486 | Ga0207662_10047832 | |||
| 1487 | Ga0207662_10298144 | |||
| 1488 | Ga0207657_10100597 | |||
| 1489 | Ga0207657_10204362 | |||
| 1490 | Ga0207657_10308443 | |||
| 1491 | Ga0207657_10417350 | |||
| 1492 | Ga0207649_10042935 | |||
| 1493 | Ga0207649_10249863 | |||
| 1494 | Ga0207652_10068891 | |||
| 1495 | Ga0207646_10004682 | |||
| 1496 | Ga0207646_10008619 | |||
| 1497 | Ga0207646_10053741 | |||
| 1498 | Ga0207646_10060600 | |||
| 1499 | Ga0207646_10066819 | |||
| 1500 | Ga0207646_10074837 | |||
| 1501 | Ga0207646_10113228 | |||
| 1502 | Ga0207646_10183571 | |||
| 1503 | Ga0207646_10191083 | |||
| 1504 | Ga0207646_10208566 | |||
| 1505 | Ga0207646_10258704 | |||
| 1506 | Ga0207646_10334473 | |||
| 1507 | Ga0207681_10008466 | |||
| 1508 | Ga0207681_10027254 | |||
| 1509 | Ga0207681_10038451 | |||
| 1510 | Ga0207681_10048813 | |||
| 1511 | Ga0207681_10057878 | |||
| 1512 | Ga0207681_10466460 | |||
| 1513 | Ga0207650_10045346 | |||
| 1514 | Ga0207650_10073429 | |||
| 1515 | Ga0207650_10154225 | |||
| 1516 | Ga0207650_10469961 | |||
| 1517 | Ga0207650_10576425 | |||
| 1518 | Ga0207659_10003753 | |||
| 1519 | Ga0207659_10011396 | |||
| 1520 | Ga0207659_10028169 | |||
| 1521 | Ga0207659_10166408 | |||
| 1522 | Ga0207659_10224742 | |||
| 1523 | Ga0207659_10372495 | |||
| 1524 | Ga0207659_11132218 | |||
| 1525 | Ga0207687_10242269 | |||
| 1526 | Ga0207687_10483870 | |||
| 1527 | Ga0207687_10756201 | |||
| 1528 | Ga0207700_10039447 | |||
| 1529 | Ga0207700_10546316 | |||
| 1530 | Ga0207700_11091293 | |||
| 1531 | Ga0207664_10085388 | |||
| 1532 | Ga0207664_10121339 | |||
| 1533 | Ga0207644_10009749 | |||
| 1534 | Ga0207644_10039292 | |||
| 1535 | Ga0207644_10159115 | |||
| 1536 | Ga0207644_10463191 | |||
| 1537 | Ga0207644_10504218 | |||
| 1538 | Ga0207690_10001481 | |||
| 1539 | Ga0207690_10025115 | |||
| 1540 | Ga0207706_10008614 | |||
| 1541 | Ga0207706_10049321 | |||
| 1542 | Ga0207706_10091217 | |||
| 1543 | Ga0207686_10144712 | |||
| 1544 | Ga0207670_10003100 | |||
| 1545 | Ga0207670_10047628 | |||
| 1546 | Ga0207670_10097423 | |||
| 1547 | Ga0207670_10128534 | |||
| 1548 | Ga0207670_10150698 | |||
| 1549 | Ga0207669_10003408 | |||
| 1550 | Ga0207669_10010427 | |||
| 1551 | Ga0207669_10102661 | |||
| 1552 | Ga0207669_10151515 | |||
| 1553 | Ga0207669_10281672 | |||
| 1554 | Ga0207669_10334333 | |||
| 1555 | Ga0207704_10022744 | |||
| 1556 | Ga0207704_10118581 | |||
| 1557 | Ga0207704_10211105 | |||
| 1558 | Ga0207665_10011275 | |||
| 1559 | Ga0207665_10026896 | |||
| 1560 | Ga0207665_10035745 | |||
| 1561 | Ga0207665_10050971 | |||
| 1562 | Ga0207665_10064244 | |||
| 1563 | Ga0207665_10079786 | |||
| 1564 | Ga0207665_10117148 | |||
| 1565 | Ga0207691_10000945 | |||
| 1566 | Ga0207691_10001082 | |||
| 1567 | Ga0207691_10032280 | |||
| 1568 | Ga0207691_10227062 | |||
| 1569 | Ga0207711_10418830 | |||
| 1570 | Ga0207689_10064409 | |||
| 1571 | Ga0207689_10284739 | |||
| 1572 | Ga0207661_10007132 | |||
| 1573 | Ga0207661_10026830 | |||
| 1574 | Ga0207661_10383409 | |||
| 1575 | Ga0207661_10394984 | |||
| 1576 | Ga0207679_10308419 | |||
| 1577 | Ga0207679_10612049 | |||
| 1578 | Ga0207679_11140952 | |||
| 1579 | Ga0207667_10024015 | |||
| 1580 | Ga0207667_10425115 | |||
| 1581 | Ga0207667_10535635 | |||
| 1582 | Ga0207651_10020043 | |||
| 1583 | Ga0207651_10028201 | |||
| 1584 | Ga0207651_10277099 | |||
| 1585 | Ga0207651_10389769 | |||
| 1586 | Ga0207651_10775826 | |||
| 1587 | Ga0207712_10012291 | |||
| 1588 | Ga0207712_10040060 | |||
| 1589 | Ga0207668_10011932 | |||
| 1590 | Ga0207668_10056103 | |||
| 1591 | Ga0207668_10057537 | |||
| 1592 | Ga0207668_10133557 | |||
| 1593 | Ga0207668_10186846 | |||
| 1594 | Ga0207668_10321354 | |||
| 1595 | Ga0207668_10583611 | |||
| 1596 | Ga0207668_10937950 | |||
| 1597 | Ga0207658_10004701 | |||
| 1598 | Ga0207658_10022282 | |||
| 1599 | Ga0207658_10067376 | |||
| 1600 | Ga0207658_10108410 | |||
| 1601 | Ga0207658_10136796 | |||
| 1602 | Ga0207658_10208729 | |||
| 1603 | Ga0207658_10241487 | |||
| 1604 | Ga0207658_10412705 | |||
| 1605 | Ga0207677_10018031 | |||
| 1606 | Ga0207677_10133745 | |||
| 1607 | Ga0207677_10218686 | |||
| 1608 | Ga0207677_10445762 | |||
| 1609 | Ga0207677_10902842 | |||
| 1610 | Ga0207703_10009368 | |||
| 1611 | Ga0207703_10015594 | |||
| 1612 | Ga0207703_10200678 | |||
| 1613 | Ga0207639_10000009 | |||
| 1614 | Ga0207678_10001585 | |||
| 1615 | Ga0207708_10038619 | |||
| 1616 | Ga0207702_10210848 | |||
| 1617 | Ga0207702_10777103 | |||
| 1618 | Ga0207641_10012427 | |||
| 1619 | Ga0207641_10064327 | |||
| 1620 | Ga0207641_10084465 | |||
| 1621 | Ga0207641_11067914 | |||
| 1622 | Ga0207648_10024504 | |||
| 1623 | Ga0207648_10094602 | |||
| 1624 | Ga0207648_10122198 | |||
| 1625 | Ga0207648_10131773 | |||
| 1626 | Ga0207648_10791194 | |||
| 1627 | Ga0207676_10582979 | |||
| 1628 | Ga0207675_100154766 | |||
| 1629 | Ga0207683_10017209 | |||
| 1630 | Ga0207683_10032547 | |||
| 1631 | Ga0207683_10086586 | |||
| 1632 | Ga0207683_10206441 | |||
| 1633 | Ga0207683_10235777 | |||
| 1634 | Ga0207698_10719248 | |||
| 1635 | Ga0209179_1021633 | |||
| 1636 | Ga0209971_1085204 | |||
| 1637 | Ga0209998_10023187 | |||
| 1638 | Ga0209974_10009094 | |||
| 1639 | Ga0209974_10014068 | |||
| 1640 | Ga0209974_10036286 | |||
| 1641 | Ga0268266_10008218 | |||
| 1642 | Ga0268266_10012253 | |||
| 1643 | Ga0268266_10141314 | |||
| 1644 | Ga0268266_10188497 | |||
| 1645 | Ga0268266_10331437 | |||
| 1646 | Ga0268265_10303422 | |||
| 1647 | Ga0268265_10536243 | |||
| 1648 | Ga0268265_10654136 | |||
| 1649 | Ga0268264_10001424 | |||
| 1650 | Ga0268264_10016515 | |||
| 1651 | Ga0268264_10324411 | |||
| 1652 | Ga0307513_10052043 | |||
| 1653 | Ga0307414_10133466 | |||
| 1654 | Ga0373929_0024211 | |||
| 1655 | Ga0373923_0126460 | |||
| 1656 | Ga0373923_0266310 | |||
| 1657 | Ga0373945_0020838 | |||
| 1658 | Ga0373953_0336164 | |||
| 1659 | Ga0373954_0262604 | |||
| 1660 | Ga0373956_0091350 | |||
| 1661 | Ga0373957_0230837 | |||
| 1662 | Ga0373943_0033870 | |||
| 1663 | Ga0373943_0101304 | |||
| 1664 | Ga0373946_0040914 | |||
| 1665 | Ga0373946_0064944 | |||
| 1666 | Ga0373946_0254646 | |||
| 1667 | Ga0373955_0055517 | |||
| 1668 | Ga0373942_0139937 | |||
| 1669 | Ga0373962_0058122 | |||
| 1670 | Ga0373924_0084042 | |||
| 1671 | Ga0373924_0109499 | |||
| 1672 | Ga0373931_0015102 | |||
| 1673 | Ga0373931_0043088 | |||
| 1674 | Ga0373931_0130682 | |||
| 1675 | Ga0373931_0667840 | |||
| 1676 | Ga0373935_0091805 | |||
| 1677 | Ga0373935_0173486 | |||
| 1678 | Ga0373935_0256526 | |||
| 1679 | Ga0373927_0076041 | |||
| 1680 | Ga0373927_0100471 | |||
| 1681 | Ga0373927_0117968 | |||
| 1682 | Ga0373927_0180641 | |||
| 1683 | Ga0373927_0246803 | |||
| 1684 | Ga0373933_0082536 | |||
| 1685 | Ga0373933_0124804 | |||
| 1686 | Ga0373947_0143887 | |||
| 1687 | Ga0373947_0169472 | |||
| 1688 | Ga0373937_0114240 | |||
| 1689 | Ga0373937_0423624 | |||
| 1690 | Ga0373937_0502707 | |||
| 1691 | Ga0373925_0010936 | |||
| 1692 | Ga0373925_0173166 | |||
| 1693 | Ga0395899_0202269 | |||
| 1694 | Ga0395899_0207320 | |||
| 1695 | Ga0395900_0090143 | |||
| 1696 | Ga0395900_0124762 | |||
| 1697 | Ga0395898_0032973 | |||
| 1698 | Ga0395898_0426733 | |||
| 1699 | Ga0436364_0573940 | |||
| 1700 | Ga0436364_1204737 | |||
| 1701 | Ga0436364_1459403 | |||
| 1702 | Ga0395901_0001548 | |||
| 1703 | Ga0395901_0003735 | |||
| 1704 | Ga0395901_0378666 | |||
| 1705 | Ga0395901_0501158 | |||
| 1706 | Ga0395901_0724371 | |||
| 1707 | Ga0395901_1135387 | |||
| 1708 | Ga0436365_0379833 | |||
| 1709 | Ga0436365_0530931 | |||
| 1710 | Ga0436365_0659259 | |||
| 1711 | Ga0436365_0960797 | |||
| 1712 | Ga0436365_1112867 | |||
| 1713 | Ga0436365_1117644 | |||
| 1714 | Ga0436360_0155647 | |||
| 1715 | Ga0436360_1341574 | |||
| 1716 | Ga0436361_0589004 | |||
| 1717 | Ga0436361_0591984 | |||
| 1718 | Ga0436361_0627296 | |||
| 1719 | Ga0436361_0756631 | |||
| 1720 | Ga0436361_0765849 | |||
| 1721 | Ga0436363_1091559 | |||
| 1722 | Ga0436362_0090010 | |||
| 1723 | Ga0436362_1255536 | |||
| 1724 | Ga0451798_1030054 | |||
| 1725 | Ga0451807_1769662 | |||
| 1726 | Ga0451839_1404823 | |||
| 1727 | Ga0451853_0577735 | |||
| 1728 | Ga0451853_4098400 | |||
| 1729 | Ga0439448_0018515 | |||
| 1730 | Ga0439450_075403 | |||
| 1731 | Ga0439451_040672 | |||
| 1732 | Ga0439455_0000520 | |||
| 1733 | Ga0439455_0015615 | |||
| 1734 | Ga0439458_0014766 | |||
| 1735 | Ga0439464_0017248 | |||
| 1736 | Ga0466959_0483443 | |||
| 1737 | Ga0451576_0279364 | |||
| 1738 | Ga0466967_0563433 | |||
| 1739 | Ga0466967_0870977 | |||
| 1740 | Ga0495592_0221815 | |||
| 1741 | Ga0495651_0014117 | |||
| 1742 | Ga0495580_0250338 | |||
| 1743 | Ga0495605_0090490 | |||
| 1744 | Ga0495662_0272770 | |||
| 1745 | Ga0495584_0108807 | |||
| 1746 | Ga0495584_0161081 | |||
| 1747 | Ga0495584_0303464 | |||
| 1748 | Ga0495584_0361714 | |||
| 1749 | Ga0495585_0028725 | |||
| 1750 | Ga0495628_0123486 | |||
| 1751 | Ga0495630_0142315 | |||
| 1752 | Ga0495643_0000443 | |||
| 1753 | Ga0495663_0037248 | |||
| 1754 | Ga0495642_0077726 | |||
| 1755 | Ga0495652_0048747 | |||
| 1756 | Ga0495587_0147204 | |||
| 1757 | Ga0495598_0009934 | |||
| 1758 | Ga0495598_0012805 | |||
| 1759 | Ga0495598_0122913 | |||
| 1760 | Ga0495645_0006709 | |||
| 1761 | Ga0495645_0094370 | |||
| 1762 | Ga0495667_0087550 | |||
| 1763 | Ga0495667_0214586 | |||
| 1764 | Ga0495634_0029418 | |||
| 1765 | Ga0495635_0357877 | |||
| 1766 | Ga0495659_0022858 | |||
| 1767 | Ga0495659_0191686 | |||
| 1768 | Ga0495661_0216664 | |||
| 1769 | Ga0495588_0176558 | |||
| 1770 | Ga0495657_0354579 | |||
| 1771 | Ga0495599_0002744 | |||
| 1772 | Ga0495623_0042456 | |||
| 1773 | Ga0495647_0099853 | |||
| 1774 | Ga0495658_0083075 | |||
| 1775 | Ga0495669_0017438 | |||
| 1776 | Ga0495669_0047039 | |||
| 1777 | Ga0495669_0074203 | |||
| 1778 | Ga0495669_0192932 | |||
| 1779 | Ga0495613_0501925 | |||
| 1780 | Ga0495624_0122878 | |||
| 1781 | Ga0495674_0231750 | |||
| 1782 | Ga0495674_0583287 | |||
| 1783 | Ga0495680_0297735 | |||
| 1784 | Ga0495680_0393522 | |||
| 1785 | Ga0495683_0153094 | |||
| 1786 | Ga0495675_0059492 | |||
| 1787 | Ga0495675_0154776 | |||
| 1788 | Ga0495681_0108882 | |||
| 1789 | Ga0495684_0010873 | |||
| 1790 | Ga0495684_0037920 | |||
| 1791 | Ga0495602_0107304 | |||
| 1792 | Ga0496100_0046887 | |||
| 1793 | Ga0496100_0063145 | |||
| 1794 | Ga0496100_0443269 | |||
| 1795 | Ga0496101_0000422 | |||
| 1796 | Ga0496101_0124446 | |||
| 1797 | Ga0496102_0054945 | |||
| 1798 | Ga0496102_0097697 | |||
| 1799 | Ga0496102_0291428 | |||
| 1800 | Ga0496102_0389554 | |||
| 1801 | Ga0496103_0031615 | |||
| 1802 | Ga0496104_0054985 | |||
| 1803 | Ga0496104_0065707 | |||
| 1804 | Ga0496104_0166797 | |||
| 1805 | Ga0496104_0228305 | |||
| 1806 | Ga0496104_0265953 | |||
| 1807 | Ga0496105_0133891 | |||
| 1808 | Ga0496105_0142286 | |||
| 1809 | Ga0496105_0212441 | |||
| 1810 | Ga0496105_0420953 | |||
| 1811 | Ga0496106_0234696 | |||
| 1812 | Ga0496106_0298970 | |||
| 1813 | Ga0496106_0327013 | |||
| 1814 | Ga0496106_0421414 | |||
| 1815 | Ga0496107_0010651 | |||
| 1816 | Ga0496107_0187658 | |||
| 1817 | Ga0496107_0845781 | |||
| 1818 | Ga0496108_0334790 | |||
| 1819 | Ga0496108_0521243 | |||
| 1820 | Ga0496108_0990047 | |||
| 1821 | Ga0496109_0005026 | |||
| 1822 | Ga0496109_0246726 | |||
| 1823 | Ga0496109_0254926 | |||
| 1824 | Ga0496109_0352420 | |||
| 1825 | Ga0496109_0458599 | |||
| 1826 | Ga0496109_0533444 | |||
| 1827 | Ga0496109_0745718 | |||
| 1828 | Ga0496110_0064443 | |||
| 1829 | Ga0496110_0076702 | |||
| 1830 | Ga0496110_0237909 | |||
| 1831 | Ga0496110_0586688 | |||
| 1832 | Ga0496111_0078935 | |||
| 1833 | Ga0496111_0216760 | |||
| 1834 | Ga0496112_0020455 | |||
| 1835 | Ga0496112_0034027 | |||
| 1836 | Ga0496112_0096332 | |||
| 1837 | Ga0496112_0205981 | |||
| 1838 | Ga0496112_0276295 | |||
| 1839 | Ga0496112_0298988 | |||
| 1840 | Ga0496112_0676835 | |||
| 1841 | Ga0496113_0040430 | |||
| 1842 | Ga0496113_0152026 | |||
| 1843 | Ga0496115_0006139 | |||
| 1844 | Ga0496115_0059623 | |||
| 1845 | Ga0496115_0098738 | |||
| 1846 | Ga0496115_0208927 | |||
| 1847 | Ga0496115_0288015 | |||
| 1848 | Ga0501080_0109190 | |||
| 1849 | nmdc:mga00v17_478168_c1 | |||
| 1850 | nmdc:mga0k408_137531_c1 | |||
| 1851 | nmdc:mga0k408_236189_c1 | |||
| 1852 | nmdc:mga0k408_351_c1 | |||
| 1853 | nmdc:mga0k408_437_c1 | |||
| 1854 | nmdc:mga0k408_600297_c1 | |||
| 1855 | nmdc:mga07m45_16569_c1 | |||
| 1856 | nmdc:mga07m45_377399_c1 | |||
| 1857 | nmdc:mga05p37_160571_c1 | |||
| 1858 | nmdc:mga05p37_4003_c1 | |||
| 1859 | nmdc:mga09592_503002_c1 | |||
| 1860 | nmdc:mga08y16_570412_c1 | |||
| 1861 | nmdc:mga0rr50_1021417_c1 | |||
| 1862 | nmdc:mga0rr50_285548_c1 | |||
| 1863 | nmdc:mga0rr50_570701_c1 | |||
| 1864 | nmdc:mga08x19_148929_c1 | |||
| 1865 | nmdc:mga08x19_215332_c1 | |||
| 1866 | nmdc:mga0a205_881180_c1 | |||
| 1867 | nmdc:mga0a205_938600_c1 | |||
| 1868 | nmdc:mga0sz30_59259_c1 | |||
| 1869 | Ga0495601_0003313 | |||
| 1870 | Ga0495601_0035889 | |||
| 1871 | Ga0500610_0164417 | |||
| 1872 | Ga0495595_0344038 | |||
| 1873 | Ga0495619_0616924 | |||
| 1874 | Ga0500556_0001824 | |||
| 1875 | Ga0500642_0002353 | |||
| 1876 | Ga0500616_0003203 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bhy-assembly1.cif.gz_B | dna-binding domain of deor in complex with the dna operator | 0.974 | 156 | 191 |
| 3vep-assembly4.cif.gz_H | crystal structure of sigd4 in complex with its negative regulator rsda | 0.9619 | 140 | 194 |
| 4lup-assembly2.cif.gz_C | crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand | 0.9609 | 10 | 102 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9586 | 137 | 192 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9556 | 137 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1or7B01 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9806 | 15 | 96 | 1.10.1740.10 |
| 3vepH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9682 | 143 | 194 | 1.10.10.10 |
| 2o8xC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9672 | 140 | 192 | 1.10.10.10 |
| 4lupA00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9672 | 12 | 102 | 1.10.1740.10 |
| 3vepE00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9634 | 143 | 196 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6H3B2-F1-model_v4 | RNA polymerase subunit sigma | 0.9331 | 1 | 97 |
GO:0006352
GO:0016987 |
| AF-A0A2V6H3B2-F1-model_v4 | RNA polymerase subunit sigma | 0.9143 | 1 | 97 |
GO:0006352
GO:0016987 |
| AF-A0A2V5L354-F1-model_v4 | RNA polymerase subunit sigma | 0.8487 | 1 | 112 |
GO:0006352
GO:0016987 |
| AF-A0A2V5L354-F1-model_v4 | RNA polymerase subunit sigma | 0.8414 | 1 | 112 |
GO:0006352
GO:0016987 |
| AF-A0A534N7F4-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.761 | 7 | 126 |
GO:0006352
GO:0016987 |