F486263

General Info

Members Datasets Scaffolds Average Seq Length
938 619 1876 234

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0180910|Ga0495672_0180910_75_779
Length 224
Sequence MSSLASFPIASRWPAQHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHAIDFNKDDQKTPEFLSLNPNGKIPAIIDPNGPGGRPLGLFESGAILEYLAEKTGKLVPADPARRWQAIQWVHFQMGGIGPMFGQVGFFHKFAGKDFEDKRPRDRYVAESKRLLGVMDRHLAGKQWFMGDEYTIADISMLGWVRNLIGFYGATVAAWLERGLARPAVKRGLEIPKRP

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
77 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
78 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
79 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
110 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
111 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
112 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
183 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
356 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
357 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
358 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
359 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
360 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
361 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
365 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
369 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
370 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
371 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
372 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
375 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
380 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
381 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
382 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
383 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
384 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
385 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
386 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
387 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
388 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
389 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
390 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
391 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
392 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
393 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
394 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
395 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
396 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
397 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
398 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
399 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
400 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
401 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
402 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
403 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
404 2643221640 Caulobacter sp. Root342 Isolate Unclassified
405 2643221642 Caulobacter sp. Root343 Isolate Unclassified
406 2643221651 Afipia sp. Root123D2 Isolate Unclassified
407 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
408 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
409 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
410 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
411 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
412 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
413 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
414 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
415 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
416 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
417 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
418 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
419 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
420 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
421 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
422 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
423 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
424 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
425 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
426 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
427 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
428 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
429 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
430 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
431 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
432 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
433 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
434 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
435 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
436 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
437 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
438 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
439 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
440 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
441 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
442 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
443 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
444 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
445 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
446 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
447 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
448 2851182111 Bosea sp. Tri-44 Isolate Nodule
449 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
450 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
451 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
452 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
453 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
454 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
455 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
456 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
457 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
458 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
459 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
460 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
461 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
462 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
463 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
464 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
465 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
466 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
467 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
468 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
469 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
470 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
471 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
472 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
473 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
474 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
475 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
476 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
477 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
478 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
479 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
480 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
481 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
482 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
483 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
484 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
485 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
486 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
487 2904699407
488 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
489 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
490 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
491 2906610324
492 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
493 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
494 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
495 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
496 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
497 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
498 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
499 2922368715
500 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
501 2922425934
502 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
503 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
504 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
505 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
506 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
507 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
508 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
509 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
510 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
511 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
512 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
513 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
514 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
515 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
516 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
517 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
518 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
519 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
520 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
521 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
522 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
523 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
524 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
525 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
526 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
527 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
528 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
529 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
530 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
531 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
532 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
533 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
534 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
535 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
536 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
537 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
538 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
539 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
540 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
541 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
542 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
543 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
544 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
545 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
546 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
547 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
548 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
549 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
550 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
551 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
552 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
553 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
554 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
555 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
556 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
557 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
558 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
559 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
560 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
561 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
562 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
563 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
564 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
565 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
566 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
567 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
568 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
569 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
570 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
571 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
572 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
573 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
574 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
575 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
576 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
577 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
578 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
579 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
580 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
581 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
582 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
583 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
584 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
585 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
586 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
587 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
588 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
589 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
590 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
591 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
592 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
593 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
594 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
595 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
596 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
597 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
598 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
599 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
600 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
601 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
602 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
603 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
604 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
605 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
606 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
607 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
608 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
609 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
610 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
611 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
612 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
613 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
614 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
615 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
616 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
617 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
618 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
619 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.52
Metatranscriptomes 0.11
Isolates 25.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.83
Nodule 19.51
Rhizoplane 3.84
Rhizosphere 51.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0180910 3300047320 Bacteria 1068
2 JGI25164J39214_1000189 3300002772 Bacteria 54411
3 JGI25153J46596_10001559 3300003215 Bacteria 13602
4 JGI25153J46596_10003422 3300003215 Bacteria 8882
5 JGI25153J46596_10023163 3300003215 Bacteria 2269
6 JGI25153J46596_10031632 3300003215 Bacteria 1777
7 JGI25160J50197_1003231 3300003354 Bacteria 7356
8 JGI25160J50197_1009074 3300003354 Bacteria 3722
9 JGI25404J52841_10004345 3300003659 Bacteria 2865
10 JGI25404J52841_10013922 3300003659 Bacteria 1745
11 Ga0055542_1007367 3300003762 Bacteria 2240
12 Ga0055529_1005701 3300003763 Bacteria 1778
13 Ga0055530_10000696 3300003791 Bacteria 28367
14 Ga0055530_10015442 3300003791 Bacteria 2493
15 Ga0055531_10000096 3300003794 Bacteria 95992
16 Ga0055531_10007547 3300003794 Bacteria 5907
17 Ga0065165_1000348 3300005262 Bacteria 75762
18 Ga0065165_1000702 3300005262 Bacteria 47623
19 Ga0065165_1001016 3300005262 Bacteria 34080
20 Ga0065165_1005603 3300005262 Bacteria 6960
21 Ga0065165_1025633 3300005262 Bacteria 1956
22 Ga0065712_10086954 3300005290 Bacteria 2593
23 Ga0070658_10026554 3300005327 Bacteria 4645
24 Ga0070676_10015986 3300005328 Bacteria 4143
25 Ga0070683_100021900 3300005329 Bacteria 5706
26 Ga0070683_100029266 3300005329 Bacteria 4984
27 Ga0070683_100276750 3300005329 Bacteria 1597
28 Ga0070690_100112342 3300005330 Bacteria 1819
29 Ga0070677_10001698 3300005333 Bacteria 6964
30 Ga0070666_10128929 3300005335 Bacteria 1757
31 Ga0070666_10377124 3300005335 Bacteria 1018
32 Ga0070680_100265510 3300005336 Bacteria 1453
33 Ga0070682_100001445 3300005337 Bacteria 13369
34 Ga0070682_100074518 3300005337 Bacteria 2180
35 Ga0070682_100155705 3300005337 Bacteria 1573
36 Ga0068868_100141300 3300005338 Bacteria 1976
37 Ga0068868_100641403 3300005338 Bacteria 945
38 Ga0070660_100008140 3300005339 Bacteria 7325
39 Ga0070660_100059705 3300005339 Bacteria 2958
40 Ga0070660_100185008 3300005339 Bacteria 1686
41 Ga0070660_100516854 3300005339 Bacteria 994
42 Ga0070687_100061307 3300005343 Bacteria 1988
43 Ga0070668_100024056 3300005347 Bacteria 4613
44 Ga0070668_100246487 3300005347 Bacteria 1482
45 Ga0070668_100511849 3300005347 Bacteria 1040
46 Ga0070669_100037434 3300005353 Bacteria 3519
47 Ga0070675_100474517 3300005354 Bacteria 1124
48 Ga0070671_100073521 3300005355 Bacteria 2855
49 Ga0070674_100012317 3300005356 Bacteria 5249
50 Ga0070674_100057529 3300005356 Bacteria 2699
51 Ga0070673_100001613 3300005364 Bacteria 13330
52 Ga0070673_100262677 3300005364 Bacteria 1509
53 Ga0070688_100032200 3300005365 Bacteria 3159
54 Ga0070659_100003891 3300005366 Bacteria 10637
55 Ga0070659_100037203 3300005366 Bacteria 3794
56 Ga0070659_100445550 3300005366 Bacteria 1098
57 Ga0070667_100325051 3300005367 Bacteria 1388
58 Ga0070709_10009416 3300005434 Bacteria 5389
59 Ga0070709_10312544 3300005434 Bacteria 1151
60 Ga0070713_100117716 3300005436 Bacteria 2325
61 Ga0070713_100248850 3300005436 Bacteria 1621
62 Ga0070713_101036817 3300005436 Bacteria 792
63 Ga0070710_10024044 3300005437 Bacteria 3210
64 Ga0070711_100007910 3300005439 Bacteria 6482
65 Ga0070700_100082011 3300005441 Bacteria 2085
66 Ga0070663_100005434 3300005455 Bacteria 7566
67 Ga0070663_100133811 3300005455 Bacteria 1886
68 Ga0070678_100096629 3300005456 Bacteria 2279
69 Ga0070678_100105659 3300005456 Bacteria 2192
70 Ga0070681_10004759 3300005458 Bacteria 13009
71 Ga0070681_10036596 3300005458 Bacteria 4928
72 Ga0070681_10195456 3300005458 Bacteria 1942
73 Ga0068867_100029208 3300005459 Bacteria 3971
74 Ga0068867_100065386 3300005459 Bacteria 2706
75 Ga0068867_100846509 3300005459 Bacteria 819
76 Ga0070685_10028035 3300005466 Bacteria 3117
77 Ga0070679_100045820 3300005530 Bacteria 4357
78 Ga0070679_100055996 3300005530 Bacteria 3928
79 Ga0070679_100087682 3300005530 Bacteria 3099
80 Ga0070679_100339187 3300005530 Bacteria 1451
81 Ga0070679_100381635 3300005530 Bacteria 1356
82 Ga0070684_100009657 3300005535 Bacteria 7608
83 Ga0070684_100061681 3300005535 Bacteria 3282
84 Ga0070684_100418896 3300005535 Bacteria 1236
85 Ga0068853_100005284 3300005539 Bacteria 10107
86 Ga0068853_100043433 3300005539 Bacteria 3845
87 Ga0070672_100114844 3300005543 Bacteria 2198
88 Ga0070672_100703926 3300005543 Bacteria 885
89 Ga0070686_100052026 3300005544 Bacteria 2610
90 Ga0070693_100344088 3300005547 Bacteria 1019
91 Ga0070665_100033643 3300005548 Bacteria 5157
92 Ga0070665_100036349 3300005548 Bacteria 4954
93 Ga0068855_100014433 3300005563 Bacteria 9511
94 Ga0068855_100015331 3300005563 Bacteria 9228
95 Ga0068855_100175003 3300005563 Bacteria 2429
96 Ga0068855_100334726 3300005563 Bacteria 1670
97 Ga0070664_100043072 3300005564 Bacteria 3808
98 Ga0068856_100001367 3300005614 Bacteria 25662
99 Ga0068852_100082248 3300005616 Bacteria 2861
100 Ga0068852_100168774 3300005616 Bacteria 2049
101 Ga0068852_100292451 3300005616 Bacteria 1574
102 Ga0068859_100438765 3300005617 Bacteria 1402
103 Ga0068864_100014639 3300005618 Bacteria 6516
104 Ga0068864_100420272 3300005618 Bacteria 1274
105 Ga0068861_100010878 3300005719 Bacteria 6322
106 Ga0068861_100104980 3300005719 Bacteria 2255
107 Ga0068861_100297949 3300005719 Bacteria 1395
108 Ga0068851_10401261 3300005834 Bacteria 807
109 Ga0068870_10034444 3300005840 Bacteria 2591
110 Ga0068870_10402853 3300005840 Bacteria 891
111 Ga0068858_100124019 3300005842 Bacteria 2418
112 Ga0068860_100048744 3300005843 Bacteria 4037
113 Ga0081455_10001796 3300005937 Bacteria 25915
114 Ga0081455_10007694 3300005937 Bacteria 11311
115 Ga0081455_10019440 3300005937 Bacteria 6426
116 Ga0081540_1006483 3300005983 Bacteria 8514
117 Ga0081540_1010556 3300005983 Bacteria 6240
118 Ga0081540_1057268 3300005983 Bacteria 1886
119 Ga0081540_1068131 3300005983 Bacteria 1659
120 Ga0081539_10001457 3300005985 Bacteria 40268
121 Ga0081539_10037769 3300005985 Bacteria 2871
122 Ga0070717_10019845 3300006028 Bacteria 5277
123 Ga0070717_10021496 3300006028 Bacteria 5085
124 Ga0075365_10012572 3300006038 Bacteria 5033
125 Ga0075368_10042844 3300006042 Bacteria 1782
126 Ga0075363_100005334 3300006048 Bacteria 5708
127 Ga0075364_10000029 3300006051 Bacteria 50718
128 Ga0070712_100808299 3300006175 Bacteria 805
129 Ga0075367_10035218 3300006178 Bacteria 2896
130 Ga0075367_10082863 3300006178 Bacteria 1942
131 Ga0075367_10111934 3300006178 Bacteria 1676
132 Ga0075366_10070043 3300006195 Bacteria 2088
133 Ga0075366_10148807 3300006195 Bacteria 1417
134 Ga0097621_100104474 3300006237 Bacteria 2387
135 Ga0097621_100117216 3300006237 Bacteria 2256
136 Ga0075370_10023165 3300006353 Bacteria 3418
137 Ga0075370_10334723 3300006353 Bacteria 903
138 Ga0068871_100216390 3300006358 Bacteria 1658
139 Ga0075434_100249921 3300006871 Bacteria 1792
140 Ga0097620_100438806 3300006931 Bacteria 1402
141 Ga0099825_1022094 3300006941 Bacteria 4177
142 Ga0099824_1019192 3300006942 Bacteria 5407
143 Ga0099822_1006420 3300006943 Bacteria 15307
144 Ga0099823_1037379 3300006944 Bacteria 3675
145 Ga0099794_10014352 3300007265 Bacteria 3470
146 Ga0099794_10031300 3300007265 Bacteria 2490
147 Ga0099795_10053323 3300007788 Bacteria 1480
148 Ga0105251_10000140 3300009011 Bacteria 73761
149 Ga0105244_10000450 3300009036 Bacteria 37505
150 Ga0105240_10059600 3300009093 Bacteria 4763
151 Ga0105240_10064647 3300009093 Bacteria 4545
152 Ga0105240_10072787 3300009093 Bacteria 4246
153 Ga0105240_10322138 3300009093 Bacteria 1761
154 Ga0111539_10184170 3300009094 Bacteria 2439
155 Ga0111539_10380187 3300009094 Bacteria 1644
156 Ga0111539_10488752 3300009094 Bacteria 1434
157 Ga0105245_10045520 3300009098 Bacteria 3919
158 Ga0105245_10045758 3300009098 Bacteria 3908
159 Ga0105245_10128906 3300009098 Bacteria 2371
160 Ga0105245_10160430 3300009098 Bacteria 2133
161 Ga0105247_10486950 3300009101 Bacteria 896
162 Ga0105241_10005048 3300009174 Bacteria 9740
163 Ga0105241_10009607 3300009174 Bacteria 7111
164 Ga0105241_10377196 3300009174 Bacteria 1238
165 Ga0105242_10330486 3300009176 Bacteria 1401
166 Ga0105248_10707860 3300009177 Bacteria 1136
167 Ga0105237_10007243 3300009545 Bacteria 12168
168 Ga0105237_10028934 3300009545 Bacteria 5637
169 Ga0105237_10258878 3300009545 Bacteria 1742
170 Ga0105237_10425430 3300009545 Bacteria 1333
171 Ga0105238_10011544 3300009551 Bacteria 8900
172 Ga0105238_10047571 3300009551 Bacteria 4324
173 Ga0105238_10051736 3300009551 Bacteria 4130
174 Ga0105238_10095876 3300009551 Bacteria 2953
175 Ga0105249_10459647 3300009553 Bacteria 1313
176 Ga0099796_10057231 3300010159 Bacteria 1371
177 Ga0099796_10205069 3300010159 Bacteria 802
178 Ga0105239_10018947 3300010375 Bacteria 7606
179 Ga0105239_10022922 3300010375 Bacteria 6884
180 Ga0105239_10032243 3300010375 Bacteria 5758
181 Ga0105239_10699726 3300010375 Bacteria 1159
182 Ga0105246_10568998 3300011119 Bacteria 974
183 Ga0157371_10129523 3300013102 Bacteria 1795
184 Ga0157370_10029293 3300013104 Bacteria 5406
185 Ga0157370_10038434 3300013104 Bacteria 4629
186 Ga0157370_10080305 3300013104 Bacteria 3070
187 Ga0157369_10007212 3300013105 Bacteria 12812
188 Ga0157369_10010870 3300013105 Bacteria 10368
189 Ga0157369_10131324 3300013105 Bacteria 2654
190 Ga0157369_10521498 3300013105 Bacteria 1229
191 Ga0157369_10585892 3300013105 Bacteria 1152
192 Ga0157374_10361256 3300013296 Bacteria 1444
193 Ga0157378_11226853 3300013297 Bacteria 790
194 Ga0163162_10049474 3300013306 Bacteria 4213
195 Ga0157372_10030328 3300013307 Bacteria 5917
196 Ga0157372_10370736 3300013307 Bacteria 1668
197 Ga0157372_10414155 3300013307 Bacteria 1570
198 Ga0157372_10415937 3300013307 Bacteria 1567
199 Ga0157375_10496748 3300013308 Bacteria 1384
200 Ga0157375_10503912 3300013308 Bacteria 1375
201 Ga0163163_10044270 3300014325 Bacteria 4366
202 Ga0163163_10087404 3300014325 Bacteria 3128
203 Ga0157380_10024366 3300014326 Bacteria 4579
204 Ga0157380_10776031 3300014326 Bacteria 973
205 Ga0157376_10473694 3300014969 Bacteria 1226
206 Ga0163161_10179009 3300017792 Bacteria 1625
207 Ga0214544_1000002 3300021320 Bacteria 753857
208 Ga0214542_1000001 3300021321 Bacteria 1018696
209 Ga0214545_1000001 3300021324 Bacteria 1092817
210 Ga0214543_1000001 3300021327 Bacteria 776921
211 Ga0213873_10000007 3300021358 Bacteria 309961
212 Ga0213873_10009473 3300021358 Bacteria 2024
213 Ga0213874_10018432 3300021377 Bacteria 1886
214 Ga0213874_10028596 3300021377 Bacteria 1594
215 Ga0213876_10000005 3300021384 Bacteria 727326
216 Ga0213876_10000766 3300021384 Bacteria 22166
217 Ga0213876_10000830 3300021384 Bacteria 20830
218 Ga0213876_10138185 3300021384 Bacteria 1296
219 Ga0224712_10024112 3300022467 Bacteria 2121
220 Ga0209563_100864 3300025230 Bacteria 9008
221 Ga0207425_1025476 3300025245 Bacteria 1221
222 Ga0209677_100423 3300025253 Bacteria 25097
223 Ga0209677_105063 3300025253 Bacteria 3565
224 Ga0209148_1000841 3300025254 Bacteria 21793
225 Ga0209233_1000666 3300025261 Bacteria 16578
226 Ga0209233_1000944 3300025261 Bacteria 12603
227 Ga0209233_1003515 3300025261 Bacteria 5509
228 Ga0209455_1002230 3300025272 Bacteria 7635
229 Ga0209455_1014196 3300025272 Bacteria 1813
230 Ga0209676_1000072 3300025292 Bacteria 307347
231 Ga0209676_1010460 3300025292 Bacteria 3862
232 Ga0209564_1003323 3300025295 Bacteria 11173
233 Ga0209758_1000138 3300025297 Bacteria 175187
234 Ga0209758_1000140 3300025297 Bacteria 174267
235 Ga0209758_1001346 3300025297 Bacteria 29651
236 Ga0209758_1003974 3300025297 Bacteria 12817
237 Ga0209758_1009576 3300025297 Bacteria 5986
238 Ga0209758_1011045 3300025297 Bacteria 5291
239 Ga0209758_1014372 3300025297 Bacteria 4216
240 Ga0209758_1030251 3300025297 Bacteria 2246
241 Ga0209050_1000073 3300025298 Bacteria 292046
242 Ga0209050_1000077 3300025298 Bacteria 278985
243 Ga0209256_1006541 3300025299 Bacteria 6115
244 Ga0209256_1023263 3300025299 Bacteria 1852
245 Ga0207426_1000822 3300025302 Bacteria 33249
246 Ga0207426_1002280 3300025302 Bacteria 12650
247 Ga0207426_1002722 3300025302 Bacteria 10753
248 Ga0207426_1016750 3300025302 Bacteria 2621
249 Ga0207426_1050245 3300025302 Bacteria 1244
250 Ga0209051_1025802 3300025303 Bacteria 2382
251 Ga0209257_1000088 3300025304 Bacteria 279014
252 Ga0209257_1000099 3300025304 Bacteria 255304
253 Ga0209257_1000568 3300025304 Bacteria 62433
254 Ga0209257_1001778 3300025304 Bacteria 23796
255 Ga0209257_1002227 3300025304 Bacteria 19938
256 Ga0209257_1012092 3300025304 Bacteria 4048
257 Ga0209257_1037497 3300025304 Bacteria 1478
258 Ga0207697_10021991 3300025315 Bacteria 2613
259 Ga0207655_1000011 3300025728 Bacteria 643321
260 Ga0207713_1001079 3300025735 Bacteria 23471
261 Ga0207682_10000930 3300025893 Bacteria 13586
262 Ga0207682_10001910 3300025893 Bacteria 9458
263 Ga0207682_10067632 3300025893 Bacteria 1508
264 Ga0207692_10093069 3300025898 Bacteria 1639
265 Ga0207688_10085019 3300025901 Bacteria 1811
266 Ga0207680_10284738 3300025903 Bacteria 1149
267 Ga0207647_10139717 3300025904 Bacteria 1420
268 Ga0207699_10018621 3300025906 Bacteria 3684
269 Ga0207699_10019715 3300025906 Bacteria 3602
270 Ga0207699_10020512 3300025906 Bacteria 3544
271 Ga0207699_10145340 3300025906 Bacteria 1563
272 Ga0207645_10010071 3300025907 Bacteria 6509
273 Ga0207643_10168227 3300025908 Bacteria 1322
274 Ga0207705_10000263 3300025909 Bacteria 50599
275 Ga0207705_10436914 3300025909 Bacteria 1014
276 Ga0207654_10032770 3300025911 Bacteria 2874
277 Ga0207707_10002222 3300025912 Bacteria 17546
278 Ga0207707_10012908 3300025912 Bacteria 7272
279 Ga0207707_10044120 3300025912 Bacteria 3888
280 Ga0207707_10240855 3300025912 Bacteria 1573
281 Ga0207695_10000549 3300025913 Bacteria 77356
282 Ga0207695_10036731 3300025913 Bacteria 5292
283 Ga0207695_10191018 3300025913 Bacteria 1965
284 Ga0207671_10006943 3300025914 Bacteria 9965
285 Ga0207671_10086551 3300025914 Bacteria 2356
286 Ga0207671_10420367 3300025914 Bacteria 1063
287 Ga0207660_10003044 3300025917 Bacteria 10964
288 Ga0207662_10135397 3300025918 Bacteria 1557
289 Ga0207657_10000114 3300025919 Bacteria 79120
290 Ga0207657_10043244 3300025919 Bacteria 3970
291 Ga0207657_10437256 3300025919 Bacteria 1027
292 Ga0207649_10173356 3300025920 Bacteria 1504
293 Ga0207652_10004942 3300025921 Bacteria 10792
294 Ga0207652_10010650 3300025921 Bacteria 7405
295 Ga0207652_10023252 3300025921 Bacteria 5133
296 Ga0207652_10374555 3300025921 Bacteria 1285
297 Ga0207652_10510097 3300025921 Bacteria 1082
298 Ga0207694_10183968 3300025924 Bacteria 1695
299 Ga0207694_10198864 3300025924 Bacteria 1630
300 Ga0207694_10406470 3300025924 Bacteria 1132
301 Ga0207650_10012479 3300025925 Bacteria 5865
302 Ga0207650_10043294 3300025925 Bacteria 3304
303 Ga0207659_10018283 3300025926 Bacteria 4593
304 Ga0207659_10030514 3300025926 Bacteria 3685
305 Ga0207687_10069831 3300025927 Bacteria 2506
306 Ga0207700_10417270 3300025928 Bacteria 1178
307 Ga0207644_10014552 3300025931 Bacteria 5265
308 Ga0207690_10504324 3300025932 Bacteria 979
309 Ga0207706_10331829 3300025933 Bacteria 1323
310 Ga0207709_10630526 3300025935 Bacteria 852
311 Ga0207669_10006976 3300025937 Bacteria 5196
312 Ga0207669_10075540 3300025937 Bacteria 2135
313 Ga0207704_10552692 3300025938 Bacteria 936
314 Ga0207691_10002250 3300025940 Bacteria 18932
315 Ga0207691_10028549 3300025940 Bacteria 5223
316 Ga0207689_10031392 3300025942 Bacteria 4423
317 Ga0207689_10223762 3300025942 Bacteria 1555
318 Ga0207661_10006099 3300025944 Bacteria 8514
319 Ga0207661_10040076 3300025944 Bacteria 3680
320 Ga0207661_10190066 3300025944 Bacteria 1800
321 Ga0207679_10093724 3300025945 Bacteria 2330
322 Ga0207667_10016633 3300025949 Bacteria 8304
323 Ga0207667_10059569 3300025949 Bacteria 3998
324 Ga0207667_10551985 3300025949 Bacteria 1165
325 Ga0207667_10613445 3300025949 Bacteria 1096
326 Ga0207651_10001535 3300025960 Bacteria 10540
327 Ga0207651_10035786 3300025960 Bacteria 3233
328 Ga0207651_10308344 3300025960 Bacteria 1319
329 Ga0207668_10362816 3300025972 Bacteria 1214
330 Ga0207658_10145398 3300025986 Bacteria 1925
331 Ga0207639_10075112 3300026041 Bacteria 2656
332 Ga0207639_10082420 3300026041 Bacteria 2550
333 Ga0207639_10118578 3300026041 Bacteria 2170
334 Ga0207639_10420266 3300026041 Bacteria 1208
335 Ga0207678_10007352 3300026067 Bacteria 9752
336 Ga0207678_10046476 3300026067 Bacteria 3753
337 Ga0207678_10159935 3300026067 Bacteria 1924
338 Ga0207678_10304660 3300026067 Bacteria 1369
339 Ga0207708_10355884 3300026075 Bacteria 1202
340 Ga0207702_10000761 3300026078 Bacteria 34283
341 Ga0207702_10302424 3300026078 Bacteria 1518
342 Ga0207702_10673737 3300026078 Bacteria 1018
343 Ga0207641_10036925 3300026088 Bacteria 4079
344 Ga0207641_10401199 3300026088 Bacteria 1317
345 Ga0207648_10021087 3300026089 Bacteria 5860
346 Ga0207648_10345368 3300026089 Bacteria 1341
347 Ga0207676_10243205 3300026095 Bacteria 1615
348 Ga0207674_10048677 3300026116 Bacteria 4338
349 Ga0207674_10144413 3300026116 Bacteria 2339
350 Ga0207675_100079138 3300026118 Bacteria 3080
351 Ga0207683_10020310 3300026121 Bacteria 5680
352 Ga0207683_10025713 3300026121 Bacteria 5078
353 Ga0207698_10025402 3300026142 Bacteria 4173
354 Ga0207698_10158552 3300026142 Bacteria 1975
355 Ga0209389_1000061 3300027296 Bacteria 105698
356 Ga0209389_1000201 3300027296 Bacteria 42938
357 Ga0209589_1000465 3300027357 Bacteria 56891
358 Ga0209489_100006 3300027361 Bacteria 475698
359 Ga0209489_100035 3300027361 Bacteria 168255
360 Ga0209700_100005 3300027363 Bacteria 573969
361 Ga0209588_1010823 3300027671 Bacteria 2748
362 Ga0209813_10026207 3300027866 Bacteria 1684
363 Ga0268266_10001162 3300028379 Bacteria 32576
364 Ga0268266_10106420 3300028379 Bacteria 2479
365 Ga0268264_10019043 3300028381 Bacteria 5612
366 Ga0268264_10596921 3300028381 Bacteria 1088
367 Ga0265325_10022046 3300031241 Bacteria 3492
368 Ga0265340_10050185 3300031247 Bacteria 2025
369 Ga0265339_10004749 3300031249 Bacteria 9210
370 Ga0265339_10011211 3300031249 Bacteria 5531
371 Ga0307513_10168825 3300031456 Bacteria 2068
372 Ga0307513_10257633 3300031456 Bacteria 1536
373 Ga0307509_10559595 3300031507 Bacteria 820
374 Ga0307508_10076540 3300031616 Bacteria 2924
375 Ga0265314_10010506 3300031711 Bacteria 7715
376 Ga0265342_10140604 3300031712 Bacteria 1347
377 Ga0307405_10328580 3300031731 Bacteria 1171
378 Ga0307410_10305807 3300031852 Bacteria 1256
379 Ga0307414_10171692 3300032004 Bacteria 1734
380 Ga0307411_10075978 3300032005 Bacteria 2295
381 Ga0307510_10216556 3300033180 Bacteria 1431
382 Ga0315911_1000006 3300033442 Bacteria 414563
383 Ga0373934_0069533 3300035086 Bacteria 1407
384 Ga0373936_0107282 3300035113 Bacteria 1183
385 Ga0373953_0081087 3300035117 Bacteria 1349
386 Ga0373954_0021937 3300035118 Bacteria 2894
387 Ga0373956_0242017 3300035119 Bacteria 857
388 Ga0373955_0047917 3300035172 Bacteria 2315
389 Ga0373924_0124360 3300035410 Bacteria 1120
390 Ga0373935_0076449 3300035692 Bacteria 2168
391 Ga0373927_0044811 3300035695 Bacteria 2862
392 Ga0373933_0000445 3300035724 Bacteria 25820
393 Ga0373925_0048880 3300037068 Bacteria 3152
394 Ga0395900_0015214 3300037418 Bacteria 7845
395 Ga0395900_0019170 3300037418 Bacteria 6975
396 Ga0395898_0142928 3300037466 Bacteria 2291
397 Ga0395905_0009199 3300037471 Bacteria 9673
398 Ga0395905_0024432 3300037471 Bacteria 5704
399 Ga0395905_0118090 3300037471 Bacteria 2493
400 Ga0395905_0185648 3300037471 Bacteria 1952
401 Ga0395905_0270738 3300037471 Bacteria 1584
402 Ga0436364_0949293 3300037853 Bacteria 2216
403 Ga0395901_0020301 3300038443 Bacteria 6801
404 Ga0395901_0047344 3300038443 Bacteria 4465
405 Ga0395901_0103938 3300038443 Bacteria 2981
406 Ga0395901_0122995 3300038443 Bacteria 2727
407 Ga0395901_0475794 3300038443 Bacteria 1275
408 Ga0436365_0010969 3300039437 Bacteria 175809
409 Ga0436365_0292687 3300039437 Bacteria 785
410 Ga0436365_0309417 3300039437 Bacteria 1577
411 Ga0436365_0352550 3300039437 Bacteria 74350
412 Ga0436365_0421020 3300039437 Bacteria 15417
413 Ga0436365_0886350 3300039437 Bacteria 8084
414 Ga0436365_1135741 3300039437 Bacteria 3045
415 Ga0436365_1162056 3300039437 Bacteria 983
416 Ga0436365_1497206 3300039437 Bacteria 2430
417 Ga0436365_1885891 3300039437 Bacteria 1411
418 Ga0436360_0770718 3300039438 Bacteria 915
419 Ga0436360_1140654 3300039438 Bacteria 766
420 Ga0436363_0877352 3300039450 Bacteria 2767
421 Ga0436363_1064860 3300039450 Bacteria 9311
422 Ga0436363_1626939 3300039450 Bacteria 1895
423 Ga0436362_0180148 3300039453 Bacteria 4288
424 Ga0436362_0976836 3300039453 Bacteria 135942
425 Ga0451802_0508379 3300041460 Bacteria 1009
426 Ga0451807_1455468 3300041486 Bacteria 1074
427 Ga0439435_0001507 3300042436 Bacteria 4334
428 Ga0439464_0099158 3300042439 Bacteria 884
429 Ga0466972_0000189 3300044658 Bacteria 47501
430 Ga0466972_0014313 3300044658 Bacteria 3974
431 Ga0466965_0042687 3300044683 Bacteria 2238
432 Ga0466966_0000196 3300044684 Bacteria 40708
433 Ga0466966_0063196 3300044684 Bacteria 2333
434 Ga0466961_0000239 3300044693 Bacteria 36887
435 Ga0466963_0008928 3300044694 Bacteria 6017
436 Ga0466968_0013036 3300044735 Bacteria 3263
437 Ga0466957_0023419 3300044842 Bacteria 3651
438 Ga0466960_0004190 3300044901 Bacteria 5610
439 Ga0466959_0012195 3300045049 Bacteria 6203
440 Ga0466958_0085394 3300045836 Bacteria 1947
441 Ga0466967_0029516 3300045976 Bacteria 4590
442 Ga0466967_0172349 3300045976 Bacteria 2037
443 Ga0495592_0011425 3300046454 Bacteria 6719
444 Ga0495592_0099434 3300046454 Bacteria 2075
445 Ga0495592_0229714 3300046454 Bacteria 1236
446 Ga0495629_0012017 3300046459 Bacteria 6276
447 Ga0495638_0012019 3300046460 Bacteria 5950
448 Ga0495638_0055750 3300046460 Bacteria 2453
449 Ga0495638_0172511 3300046460 Bacteria 1240
450 Ga0495651_0004537 3300046462 Bacteria 10621
451 Ga0495651_0056064 3300046462 Bacteria 3027
452 Ga0495653_0230971 3300046463 Bacteria 1238
453 Ga0495650_0060492 3300046471 Bacteria 1521
454 Ga0495582_0010030 3300046473 Bacteria 5214
455 Ga0495639_0030353 3300046475 Bacteria 2402
456 Ga0495662_0062168 3300046476 Bacteria 1804
457 Ga0495664_0004197 3300046477 Bacteria 7872
458 Ga0495664_0006231 3300046477 Bacteria 6584
459 Ga0495606_0048655 3300046507 Bacteria 2786
460 Ga0495606_0222162 3300046507 Bacteria 1063
461 Ga0495606_0340077 3300046507 Bacteria 800
462 Ga0495608_0006784 3300046511 Bacteria 8117
463 Ga0495610_0007739 3300046512 Bacteria 7091
464 Ga0495610_0108519 3300046512 Bacteria 1233
465 Ga0495616_0194458 3300046513 Bacteria 895
466 Ga0495618_0045559 3300046514 Bacteria 2767
467 Ga0495628_0023187 3300046516 Bacteria 5097
468 Ga0495628_0189158 3300046516 Bacteria 1555
469 Ga0495630_0032174 3300046517 Bacteria 3907
470 Ga0495637_0017856 3300046520 Bacteria 3298
471 Ga0495648_0011449 3300046524 Bacteria 6679
472 Ga0495652_0082645 3300046529 Bacteria 2646
473 Ga0495652_0101427 3300046529 Bacteria 2333
474 Ga0495652_0326238 3300046529 Bacteria 1107
475 Ga0495665_0115084 3300046531 Bacteria 1409
476 Ga0495640_0023262 3300046533 Bacteria 4519
477 Ga0495640_0035031 3300046533 Bacteria 3555
478 Ga0495640_0119622 3300046533 Bacteria 1713
479 Ga0495586_0184588 3300046535 Bacteria 1181
480 Ga0495587_0006350 3300046536 Bacteria 7708
481 Ga0495598_0001085 3300046537 Bacteria 5218
482 Ga0495645_0019888 3300046543 Bacteria 4840
483 Ga0495667_0255844 3300046559 Bacteria 1114
484 Ga0495668_0083861 3300046616 Bacteria 1748
485 Ga0495668_0083935 3300046616 Bacteria 1747
486 Ga0495668_0197025 3300046616 Bacteria 1103
487 Ga0495634_0031088 3300046642 Bacteria 3680
488 Ga0495634_0088702 3300046642 Bacteria 2011
489 Ga0495625_0152949 3300046660 Bacteria 1550
490 Ga0495635_0007466 3300046663 Bacteria 7631
491 Ga0495635_0032693 3300046663 Bacteria 3608
492 Ga0495657_0004893 3300046675 Bacteria 10663
493 Ga0495657_0018228 3300046675 Bacteria 5086
494 Ga0495599_0003791 3300046678 Bacteria 8876
495 Ga0495599_0258049 3300046678 Bacteria 1060
496 Ga0495623_0014751 3300046679 Bacteria 5051
497 Ga0495646_0019009 3300046680 Bacteria 4352
498 Ga0495658_0074029 3300046683 Bacteria 1984
499 Ga0495613_0016662 3300046689 Bacteria 5471
500 Ga0495613_0171578 3300046689 Bacteria 1539
501 Ga0495624_0060099 3300046690 Bacteria 2383
502 Ga0495671_0016031 3300046692 Bacteria 4008
503 Ga0495649_0000982 3300046694 Bacteria 22492
504 Ga0495600_0015463 3300046809 Bacteria 4823
505 Ga0495600_0039650 3300046809 Bacteria 3067
506 Ga0495600_0171720 3300046809 Bacteria 1399
507 Ga0495604_0000711 3300047317 Bacteria 28174
508 Ga0495604_0024032 3300047317 Bacteria 4864
509 Ga0495674_0023553 3300047319 Bacteria 5673
510 Ga0495674_0137325 3300047319 Bacteria 2056
511 Ga0495672_0009250 3300047320 Bacteria 7164
512 Ga0495676_0121840 3300047321 Bacteria 1896
513 Ga0495676_0297157 3300047321 Bacteria 1090
514 Ga0495680_0012590 3300047322 Bacteria 7434
515 Ga0495675_0042499 3300047444 Bacteria 2896
516 Ga0495675_0241672 3300047444 Bacteria 1087
517 Ga0495673_0021038 3300047469 Bacteria 3231
518 Ga0495684_0022121 3300047471 Bacteria 4896
519 Ga0495686_0089754 3300047472 Bacteria 1867
520 Ga0495686_0129020 3300047472 Bacteria 1501
521 Ga0495593_0032600 3300047673 Bacteria 2839
522 Ga0496100_0111814 3300048903 Bacteria 1899
523 Ga0496100_0502419 3300048903 Bacteria 934
524 Ga0496101_0111236 3300048904 Bacteria 2062
525 Ga0496101_0118982 3300048904 Bacteria 1996
526 Ga0496101_0533205 3300048904 Bacteria 928
527 Ga0496102_0115433 3300048905 Bacteria 2505
528 Ga0496103_0166231 3300048906 Bacteria 1415
529 Ga0496103_0334622 3300048906 Bacteria 974
530 Ga0496104_0008067 3300048907 Bacteria 9341
531 Ga0496104_0154682 3300048907 Bacteria 2201
532 Ga0496105_0000463 3300048908 Bacteria 26695
533 Ga0496105_0104810 3300048908 Bacteria 2335
534 Ga0496105_0590604 3300048908 Bacteria 863
535 Ga0496106_0240755 3300048909 Bacteria 1446
536 Ga0496106_0253896 3300048909 Bacteria 1406
537 Ga0496107_0110492 3300048910 Bacteria 2020
538 Ga0496107_0409942 3300048910 Bacteria 1008
539 Ga0496108_0434229 3300048911 Bacteria 1147
540 Ga0496109_0130786 3300048912 Bacteria 2342
541 Ga0496109_0728193 3300048912 Bacteria 930
542 Ga0496110_0034086 3300048913 Bacteria 4408
543 Ga0496110_0080243 3300048913 Bacteria 2907
544 Ga0496110_0194476 3300048913 Bacteria 1842
545 Ga0496110_0275338 3300048913 Bacteria 1533
546 Ga0496111_0202113 3300048914 Bacteria 1477
547 Ga0496112_0243792 3300048915 Bacteria 1749
548 Ga0496112_0312095 3300048915 Bacteria 1517
549 Ga0496112_0348427 3300048915 Bacteria 1424
550 Ga0496113_0091159 3300048916 Bacteria 2349
551 Ga0496114_0149465 3300048917 Bacteria 2026
552 Ga0496114_0732675 3300048917 Bacteria 865
553 Ga0496115_0228713 3300048918 Bacteria 1534
554 Ga0496116_0091797 3300048919 Bacteria 1844
555 Ga0496117_0037502 3300048920 Bacteria 3610
556 Ga0496117_0040088 3300048920 Bacteria 3450
557 Ga0496117_0040435 3300048920 Bacteria 3429
558 Ga0496117_0087819 3300048920 Bacteria 2014
559 Ga0496118_0012253 3300048921 Bacteria 8256
560 Ga0496119_0047089 3300048922 Bacteria 2686
561 Ga0496119_0113005 3300048922 Bacteria 1504
562 Ga0496119_0119533 3300048922 Bacteria 1451
563 Ga0496120_0000724 3300048923 Bacteria 48314
564 Ga0496120_0017276 3300048923 Bacteria 4685
565 Ga0496120_0047664 3300048923 Bacteria 2469
566 Ga0496121_0001254 3300048924 Bacteria 43970
567 Ga0496121_0001728 3300048924 Bacteria 35654
568 Ga0496121_0036298 3300048924 Bacteria 4394
569 Ga0496121_0048068 3300048924 Bacteria 3634
570 Ga0496121_0063602 3300048924 Bacteria 3013
571 Ga0496121_0075832 3300048924 Bacteria 2685
572 Ga0496121_0077256 3300048924 Bacteria 2652
573 Ga0496121_0122541 3300048924 Bacteria 1961
574 Ga0496121_0183101 3300048924 Bacteria 1509
575 Ga0496121_0198577 3300048924 Bacteria 1431
576 Ga0496121_0445098 3300048924 Bacteria 836
577 Ga0496122_0113521 3300048925 Bacteria 1770
578 Ga0496122_0182116 3300048925 Bacteria 1252
579 Ga0496124_0000004 3300048927 Bacteria 976131
580 Ga0496124_0198511 3300048927 Bacteria 1528
581 Ga0496125_0038178 3300048928 Bacteria 4162
582 Ga0496125_0056746 3300048928 Bacteria 3177
583 Ga0496125_0077077 3300048928 Bacteria 2572
584 Ga0496125_0091414 3300048928 Bacteria 2280
585 Ga0496125_0136882 3300048928 Bacteria 1711
586 Ga0496126_0001940 3300048929 Bacteria 29487
587 Ga0496126_0027545 3300048929 Bacteria 5426
588 Ga0496126_0027737 3300048929 Bacteria 5404
589 Ga0496126_0030278 3300048929 Bacteria 5129
590 Ga0496126_0152729 3300048929 Bacteria 1978
591 Ga0496126_0159356 3300048929 Bacteria 1929
592 Ga0496126_0193947 3300048929 Bacteria 1719
593 Ga0496126_0297736 3300048929 Bacteria 1332
594 Ga0496126_0634773 3300048929 Bacteria 838
595 Ga0495682_0036095 3300049460 Bacteria 1820
596 Ga0501032_0021110 3300049569 Bacteria 4529
597 Ga0501033_0140674 3300049570 Bacteria 1744
598 Ga0501034_0000820 3300049571 Bacteria 46252
599 Ga0501034_0135726 3300049571 Bacteria 2441
600 Ga0501036_0000216 3300049572 Bacteria 38518
601 Ga0501036_0115391 3300049572 Bacteria 2269
602 Ga0501037_0003053 3300049573 Bacteria 12140
603 Ga0501037_0018965 3300049573 Bacteria 5070
604 Ga0501037_0073172 3300049573 Bacteria 2492
605 Ga0501037_0195092 3300049573 Bacteria 1432
606 Ga0501038_0157875 3300049574 Bacteria 1845
607 Ga0501039_0023629 3300049575 Bacteria 4718
608 Ga0501039_0095112 3300049575 Bacteria 2322
609 Ga0501041_0233156 3300049577 Bacteria 1156
610 Ga0501043_0023520 3300049579 Bacteria 4833
611 Ga0501043_0051032 3300049579 Bacteria 3252
612 Ga0501043_0146533 3300049579 Bacteria 1848
613 Ga0501047_0000124 3300049581 Bacteria 94721
614 Ga0501047_0058289 3300049581 Bacteria 3731
615 Ga0501047_0221102 3300049581 Bacteria 1750
616 Ga0501048_0000375 3300049582 Bacteria 31006
617 Ga0501067_0005409 3300049583 Bacteria 7091
618 Ga0501067_0053899 3300049583 Bacteria 2228
619 Ga0501068_0105412 3300049584 Bacteria 1750
620 Ga0501069_0019919 3300049585 Bacteria 3630
621 Ga0501070_0005426 3300049586 Bacteria 10884
622 Ga0501070_0035267 3300049586 Bacteria 4181
623 Ga0501072_0150978 3300049588 Bacteria 1852
624 Ga0501072_0410092 3300049588 Bacteria 1074
625 Ga0501073_0051155 3300049589 Bacteria 2894
626 Ga0501074_0015301 3300049590 Bacteria 5576
627 Ga0501079_0466351 3300049741 Bacteria 992
628 Ga0501080_0000074 3300049742 Bacteria 66985
629 Ga0501080_0097372 3300049742 Bacteria 2731
630 Ga0501080_0225507 3300049742 Bacteria 1714
631 Ga0501080_0276055 3300049742 Bacteria 1529
632 Ga0501083_0005619 3300049744 Bacteria 8878
633 Ga0501035_0301223 3300049822 Bacteria 1351
634 Ga0501035_0563052 3300049822 Bacteria 932
635 Ga0501044_0001469 3300049823 Bacteria 27682
636 Ga0501044_0123542 3300049823 Bacteria 2587
637 Ga0501044_0131206 3300049823 Bacteria 2500
638 Ga0501045_0005982 3300049824 Bacteria 8415
639 Ga0501045_0270763 3300049824 Bacteria 1264
640 nmdc:mga00v17_144_c1 3300050491 Bacteria 41064
641 nmdc:mga0yw44_16919_c1 3300050492 Bacteria 3952
642 nmdc:mga0yw44_65641_c1 3300050492 Bacteria 2237
643 nmdc:mga0k408_103613_c1 3300050493 Bacteria 1679
644 nmdc:mga07m45_156151_c1 3300050496 Bacteria 1324
645 nmdc:mga07m45_7081_c1 3300050496 Bacteria 5708
646 nmdc:mga0qj67_136015_c1 3300050509 Bacteria 1991
647 nmdc:mga08y16_39495_c1 3300050511 Bacteria 4951
648 nmdc:mga0n895_204243_c1 3300050512 Bacteria 2006
649 Ga0495601_0055954 3300053077 Bacteria 2498
650 Ga0495601_0103868 3300053077 Bacteria 1837
651 Ga0495601_0150036 3300053077 Bacteria 1522
652 Ga0495601_0191706 3300053077 Bacteria 1336
653 Ga0495612_0110138 3300053078 Bacteria 1178
654 Ga0495655_0057018 3300053083 Bacteria 1053
655 Ga0495619_0007164 3300053085 Bacteria 7065
656 Ga0495619_0255595 3300053085 Bacteria 1214
657 Ga0495619_0284662 3300053085 Bacteria 1145
658 Ga0500578_0115378 3300053086 Bacteria 1691
659 Ga0500578_0207570 3300053086 Bacteria 1196
660 Ga0500643_000032 3300053087 Bacteria 200350
661 Ga0500583_0148964 3300053092 Bacteria 1164
662 Ga0500566_0000009 3300053094 Bacteria 131668
663 Ga0500566_0000246 3300053094 Bacteria 28960
664 Ga0500566_0007043 3300053094 Bacteria 6657
665 Ga0500556_0022202 3300053104 Bacteria 2058
666 Ga0500569_002947 3300053109 Bacteria 3416
667 Ga0500572_000070 3300053111 Bacteria 32133
668 Ga0500572_010809 3300053111 Bacteria 2194
669 Ga0500591_082891 3300053115 Bacteria 1420
670 Ga0500592_008686 3300053116 Bacteria 1614
671 Ga0500595_018973 3300053119 Bacteria 2503
672 Ga0500614_001151 3300053123 Bacteria 6500
673 Ga0500642_0000173 3300053130 Bacteria 26732
674 Ga0500642_0042944 3300053130 Bacteria 1962
675 Ga0500642_0186553 3300053130 Bacteria 969
676 Ga0500559_0020697 3300053136 Bacteria 2783
677 Ga0500577_0025165 3300053142 Bacteria 2011
678 Ga0500577_0091249 3300053142 Bacteria 1231
679 Ga0500604_0032388 3300053151 Bacteria 1540
680 Ga0500616_0048085 3300053153 Bacteria 2263
681 Ga0500622_0006007 3300053156 Bacteria 7133
682 Ga0500622_0012668 3300053156 Bacteria 4562
683 Ga0500630_000240 3300053159 Bacteria 21822
684 Ga0500638_000252 3300053162 Bacteria 11670
685 Ga0500638_018423 3300053162 Bacteria 3257
686 Ga0500639_000545 3300053163 Bacteria 18833
687 Ga0500636_0000122 3300053177 Bacteria 40577
688 Ga0500636_0016336 3300053177 Bacteria 4377
689 Ga0500637_0000142 3300053178 Bacteria 26117
690 Ga0500645_001654 3300053730 Bacteria 10957
691 Ga0500599_003744 3300053736 Bacteria 1864
692 Ga0500601_000050 3300053737 Bacteria 24752
693 Ga0501084_0095078 3300054114 Bacteria 2502
694 Ga0500661_000128 3300055283 Bacteria 12754
695 Ga0500661_002648 3300055283 Bacteria 3385
696 Ga0501082_0178882 3300060353 Bacteria 1845
697 Ga0501082_0352930 3300060353 Bacteria 1282
698 2507508408 2507262055 Bacteria 8048963
699 2508542475 2508501009 Bacteria 7784016
700 2508691751 2508501042 Bacteria 8719808
701 2511393921 2511231028 Bacteria 8046582
702 2513610707 2513237090 Bacteria 7096802
703 2513625560 2513237092 Bacteria 8341956
704 2513644458 2513237094 Bacteria 8789602
705 2513645662 2513237095 Bacteria 8976980
706 2513692745 2513237101 Bacteria 7952346
707 2513701107 2513237102 Bacteria 7703324
708 2513717128 2513237104 Bacteria 10034502
709 2513872950 2513237139 Bacteria 8737671
710 2513894715 2513237141 Bacteria 8496279
711 2514013710 2513237161 Bacteria 8871253
712 2514586411 2513237351 Bacteria 6968952
713 2515627099 2515154112 Bacteria 8294334
714 2517107789 2517093001 Bacteria 9002274
715 2523106374 2522572158 Bacteria 6514390
716 2524437531 2524023205 Bacteria 8918781
717 2524466097 2524023210 Bacteria 9029266
718 2524534323 2524023228 Bacteria 10118060
719 2528852408 2528768022 Bacteria 10457665
720 2587918873 2585428106 Bacteria 5179711
721 2599935305 2599185301 Bacteria 6161860
722 2617347334 2617270735 Bacteria 9163226
723 2644225517 2643221640 Bacteria 5258820
724 2644232827 2643221642 Bacteria 5357871
725 2644290606 2643221651 Bacteria 4798932
726 2694628021 2693429783 Bacteria 7019804
727 2728747413 2728368998 Bacteria 8720350
728 2745076477 2744054633 Bacteria 8678936
729 2753764390 2751185897 Bacteria 5322941
730 2765464050 2765235802 Bacteria 5618596
731 2793068698 2791355197 Bacteria 8420563
732 2805915152 2802429603 Bacteria 8777136
733 2818238705 2816332527 Bacteria 8933356
734 2819685198 2818991461 Bacteria 7026071
735 2824604051 2824600985 Bacteria 8488197
736 2824610320 2824609381 Bacteria 8672835
737 2824617911 2824617872 Bacteria 8814715
738 2824626579 2824626560 Bacteria 8813858
739 2824638596 2824635225 Bacteria 8785348
740 2824646064 2824644064 Bacteria 8743947
741 2824658039 2824653114 Bacteria 8493680
742 2824668324 2824661429 Bacteria 9877870
743 2824676863 2824671348 Bacteria 8369588
744 2824684514 2824679649 Bacteria 8248951
745 2824693186 2824687955 Bacteria 8360029
746 2824701818 2824696289 Bacteria 8335049
747 2824708991 2824704595 Bacteria 9667483
748 2824716250 2824714736 Bacteria 8717648
749 2824726549 2824723954 Bacteria 8758240
750 2824735290 2824732956 Bacteria 7810675
751 2824759573 2824753945 Bacteria 9787441
752 2824770024 2824763712 Bacteria 9792355
753 2824775459 2824773399 Bacteria 8360218
754 2838123558 2838122688 Bacteria 8803140
755 2841946797 2841941048 Bacteria 8688029
756 2841949658 2841949485 Bacteria 8680857
757 2841958841 2841957949 Bacteria 8652217
758 2841971835 2841966195 Bacteria 8673214
759 2841974819 2841974524 Bacteria 8931498
760 2841983619 2841983080 Bacteria 8395090
761 2842038877 2842038055 Bacteria 8002051
762 2842048177 2842045827 Bacteria 8006841
763 2844319247 2844315083 Bacteria 8138177
764 2847936400 2847930680 Bacteria 9342022
765 2847946749 2847939898 Bacteria 8606328
766 2849079133 2849076700 Bacteria 7039503
767 2851185253 2851182111 Bacteria 6047226
768 2857514121 2857509624 Bacteria 7472071
769 2857545717 2857542790 Bacteria 5326616
770 2874598228 2874590934 Bacteria 8299676
771 2874605403 2874604998 Bacteria 7834745
772 2874615104 2874612657 Bacteria 8252029
773 2874627658 2874620515 Bacteria 8290088
774 2874632038 2874628541 Bacteria 8630250
775 2874652717 2874645413 Bacteria 8214782
776 2876385021 2876377896 Bacteria 6565995
777 2876764699 2876761206 Bacteria 10111113
778 2876778294 2876771140 Bacteria 8287509
779 2876809932 2876808645 Bacteria 8824342
780 2876825837 2876818435 Bacteria 8274608
781 2879082088 2879074833 Bacteria 8279565
782 2879090183 2879083081 Bacteria 8587928
783 2879105722 2879099564 Bacteria 10442239
784 2879110225 2879110137 Bacteria 8907982
785 2879135235 2879127579 Bacteria 8294491
786 2879145406 2879142872 Bacteria 8267021
787 2881368661 2881364244 Bacteria 7710352
788 2881673498 2881665667 Bacteria 8175609
789 2883293417 2883291878 Bacteria 5894118
790 2885373505 2885366525 Bacteria 8326213
791 2885381947 2885374607 Bacteria 8927485
792 2885392114 2885383462 Bacteria 9473874
793 2885412484 2885409591 Bacteria 9235467
794 2885431116 2885429604 Bacteria 3642894
795 2888352967 2888350351 Bacteria 7372807
796 2888384247 2888378607 Bacteria 9652610
797 2888393628 2888388044 Bacteria 7304136
798 2888424721 2888419890 Bacteria 7857137
799 2889014738 2889010040 Bacteria 6749192
800 2889020272 2889016732 Bacteria 6700763
801 2903731089 2903727486 Bacteria 8281579
802 2903751637 2903748898 Bacteria 9972761
803 2904579303 2904578770 Bacteria 5302906
804 2904673022 2904666416 Bacteria 8226587
805 2904694634 2904690495 Bacteria 9412302
806 2904702379
807 2904714849 2904711408 Bacteria 9771557
808 2906357406 2906354277 Bacteria 6991324
809 2906607404 2906602504 Bacteria 8295279
810 2906617349
811 2906649005 2906643746 Bacteria 8722424
812 2908742507 2908739725 Bacteria 8628932
813 2908760189 2908756301 Bacteria 8864324
814 2919121871 2919119836 Bacteria 5208557
815 2919453825 2919450847 Bacteria 5631160
816 2922134599 2922130491 Bacteria 7173936
817 2922188789 2922185730 Bacteria 7113964
818 2922374595
819 2922400622 2922393267 Bacteria 8285685
820 2922430472
821 2928535581 2928531327 Bacteria 5101314
822 2929618259 2929615660 Bacteria 9193770
823 2929632447 2929624759 Bacteria 9339455
824 2932790553 2932784394 Bacteria 9704911
825 2932799771 2932794094 Bacteria 7915132
826 2932806978 2932801729 Bacteria 7987968
827 2932810974 2932809354 Bacteria 9135765
828 2932823696 2932818245 Bacteria 9955613
829 2932830184 2932828146 Bacteria 9745859
830 2933580187 2933577622 Bacteria 9116884
831 2935609051 2935608549 Bacteria 8203142
832 2935622590 2935616580 Bacteria 9032984
833 2935642610 2935638405 Bacteria 10015038
834 2935653239 2935648319 Bacteria 8801166
835 2935660442 2935656913 Bacteria 8965014
836 2935668086 2935665750 Bacteria 9571747
837 2935676119 2935675223 Bacteria 9928132
838 2935686103 2935684952 Bacteria 9590419
839 2935701271 2935694250 Bacteria 9291695
840 2935705946 2935703347 Bacteria 10242284
841 2935714655 2935713505 Bacteria 9608509
842 2935725274 2935722832 Bacteria 9608746
843 2935732366 2935732158 Bacteria 9706831
844 2935741745 2935741537 Bacteria 9707219
845 2935752068 2935750917 Bacteria 9590372
846 2935766416 2935760218 Bacteria 9817913
847 2935771861 2935769743 Bacteria 7878163
848 2935778702 2935777560 Bacteria 8077691
849 2935788912 2935785616 Bacteria 7962367
850 2935795288 2935793552 Bacteria 8012592
851 2935802945 2935801545 Bacteria 9301974
852 2935814262 2935810662 Bacteria 9401221
853 2935822211 2935819856 Bacteria 8261050
854 2935831399 2935827899 Bacteria 10038562
855 2935838259 2935837841 Bacteria 9454360
856 2935847793 2935847175 Bacteria 8228321
857 2935860839 2935855204 Bacteria 9035059
858 2935869824 2935864058 Bacteria 9784707
859 2935878757 2935873716 Bacteria 9632195
860 2935886898 2935883170 Bacteria 7964738
861 2935908935 2935908558 Bacteria 8568796
862 2935919653 2935916978 Bacteria 9113783
863 2935926491 2935926038 Bacteria 8601059
864 2935934941 2935934488 Bacteria 8602579
865 2935943391 2935942939 Bacteria 8599779
866 2935951829 2935951376 Bacteria 8602333
867 2935960592 2935959822 Bacteria 7869783
868 2935967954 2935967501 Bacteria 8603075
869 2935978582 2935975950 Bacteria 8347125
870 2935987565 2935984226 Bacteria 8302647
871 2935994847 2935992306 Bacteria 9802711
872 2936003489 2936002035 Bacteria 9362176
873 2936016109 2936011229 Bacteria 8801034
874 2936024742 2936019824 Bacteria 8804134
875 2936031838 2936028420 Bacteria 8965941
876 2936039818 2936037263 Bacteria 9446081
877 2936049699 2936046547 Bacteria 8903709
878 2936060803 2936055302 Bacteria 8785755
879 2938019813 2938014810 Bacteria 6700592
880 2940557129 2940556831 Bacteria 9590747
881 2941533001 2941531003 Bacteria 7653939
882 2941539073 2941538514 Bacteria 9402094
883 2958101677 2958100919 Bacteria 6800575
884 2958177945 2958172287 Bacteria 6716688
885 2965123582 2965119406 Bacteria 6956431
886 2977977206 2977971508 Bacteria 7472917
887 2979712762 2979710463 Bacteria 6785254
888 2979749585 2979742915 Bacteria 7301278
889 2987655299 2987652177 Bacteria 6969023
890 3005480383 3005474847 Bacteria 9259049
891 3005484497 3005483717 Bacteria 7877331
892 3005510510 3005506211 Bacteria 6943378
893 3005587864 3005587118 Bacteria 7794411
894 3005599417 3005594810 Bacteria 8716512
895 3005722492 3005718088 Bacteria 8283608
896 3007808808 3007803356 Bacteria 5931491
897 8001846775 8001845381 Bacteria 5804942
898 8006929113 8006926726 Bacteria 6749210
899 8006940492 8006933436 Bacteria 10410654
900 8006967127 8006964411 Bacteria 8966052
901 8006980181 8006973647 Bacteria 10679141
902 8016522126 8016511872 Bacteria 9921665
903 8016529438 8016522445 Bacteria 8156687
904 8016534647 8016530956 Bacteria 8155261
905 8016547867 8016539877 Bacteria 8155419
906 8016554267 8016548790 Bacteria 8155074
907 8016562642 8016557553 Bacteria 8154380
908 8016572993 8016566248 Bacteria 8158151
909 8016577145 8016575299 Bacteria 8154085
910 8016591550 8016583857 Bacteria 10421953
911 8016600425 8016595262 Bacteria 8149947
912 8016610313 8016603502 Bacteria 8731218
913 8016614617 8016613128 Bacteria 8794220
914 8016626380 8016622563 Bacteria 7999408
915 8016640137 8016630954 Bacteria 9217207
916 8017063543 8017057580 Bacteria 10023680
917 8018151302 8018150411 Bacteria 5549903
918 8019534413 8019530166 Bacteria 8155624
919 8019545056 8019538911 Bacteria 7872763
920 8019553471 8019547302 Bacteria 7996444
921 8019556565 8019555841 Bacteria 9642137
922 8019568743 8019565922 Bacteria 9639779
923 8019582862 8019576017 Bacteria 10049540
924 8019590657 8019586578 Bacteria 10212056
925 8019600694 8019597564 Bacteria 10041141
926 8019617853 8019608314 Bacteria 10042931
927 8019628367 8019619141 Bacteria 9218857
928 8019634262 8019629233 Bacteria 8687553
929 8019645472 8019638758 Bacteria 9062356
930 8019658585 8019648815 Bacteria 10014479
931 8019671653 8019668869 Bacteria 8791617
932 8019684447 8019678201 Bacteria 8863603
933 8019690254 8019687851 Bacteria 8712826
934 8054930207 8054929484 Bacteria 5599761
935 8055746152 8055742211 Bacteria 9226248
936 8056688188 8056681323 Bacteria 8472857
937 8056691343 8056689827 Bacteria 6712655
938 8056968208 8056967851 Bacteria 9038162
939 Ga0495672_0180910
940 JGI25164J39214_1000189
941 JGI25153J46596_10001559
942 JGI25153J46596_10003422
943 JGI25153J46596_10023163
944 JGI25153J46596_10031632
945 JGI25160J50197_1003231
946 JGI25160J50197_1009074
947 JGI25404J52841_10004345
948 JGI25404J52841_10013922
949 Ga0055542_1007367
950 Ga0055529_1005701
951 Ga0055530_10000696
952 Ga0055530_10015442
953 Ga0055531_10000096
954 Ga0055531_10007547
955 Ga0065165_1000348
956 Ga0065165_1000702
957 Ga0065165_1001016
958 Ga0065165_1005603
959 Ga0065165_1025633
960 Ga0065712_10086954
961 Ga0070658_10026554
962 Ga0070676_10015986
963 Ga0070683_100021900
964 Ga0070683_100029266
965 Ga0070683_100276750
966 Ga0070690_100112342
967 Ga0070677_10001698
968 Ga0070666_10128929
969 Ga0070666_10377124
970 Ga0070680_100265510
971 Ga0070682_100001445
972 Ga0070682_100074518
973 Ga0070682_100155705
974 Ga0068868_100141300
975 Ga0068868_100641403
976 Ga0070660_100008140
977 Ga0070660_100059705
978 Ga0070660_100185008
979 Ga0070660_100516854
980 Ga0070687_100061307
981 Ga0070668_100024056
982 Ga0070668_100246487
983 Ga0070668_100511849
984 Ga0070669_100037434
985 Ga0070675_100474517
986 Ga0070671_100073521
987 Ga0070674_100012317
988 Ga0070674_100057529
989 Ga0070673_100001613
990 Ga0070673_100262677
991 Ga0070688_100032200
992 Ga0070659_100003891
993 Ga0070659_100037203
994 Ga0070659_100445550
995 Ga0070667_100325051
996 Ga0070709_10009416
997 Ga0070709_10312544
998 Ga0070713_100117716
999 Ga0070713_100248850
1000 Ga0070713_101036817
1001 Ga0070710_10024044
1002 Ga0070711_100007910
1003 Ga0070700_100082011
1004 Ga0070663_100005434
1005 Ga0070663_100133811
1006 Ga0070678_100096629
1007 Ga0070678_100105659
1008 Ga0070681_10004759
1009 Ga0070681_10036596
1010 Ga0070681_10195456
1011 Ga0068867_100029208
1012 Ga0068867_100065386
1013 Ga0068867_100846509
1014 Ga0070685_10028035
1015 Ga0070679_100045820
1016 Ga0070679_100055996
1017 Ga0070679_100087682
1018 Ga0070679_100339187
1019 Ga0070679_100381635
1020 Ga0070684_100009657
1021 Ga0070684_100061681
1022 Ga0070684_100418896
1023 Ga0068853_100005284
1024 Ga0068853_100043433
1025 Ga0070672_100114844
1026 Ga0070672_100703926
1027 Ga0070686_100052026
1028 Ga0070693_100344088
1029 Ga0070665_100033643
1030 Ga0070665_100036349
1031 Ga0068855_100014433
1032 Ga0068855_100015331
1033 Ga0068855_100175003
1034 Ga0068855_100334726
1035 Ga0070664_100043072
1036 Ga0068856_100001367
1037 Ga0068852_100082248
1038 Ga0068852_100168774
1039 Ga0068852_100292451
1040 Ga0068859_100438765
1041 Ga0068864_100014639
1042 Ga0068864_100420272
1043 Ga0068861_100010878
1044 Ga0068861_100104980
1045 Ga0068861_100297949
1046 Ga0068851_10401261
1047 Ga0068870_10034444
1048 Ga0068870_10402853
1049 Ga0068858_100124019
1050 Ga0068860_100048744
1051 Ga0081455_10001796
1052 Ga0081455_10007694
1053 Ga0081455_10019440
1054 Ga0081540_1006483
1055 Ga0081540_1010556
1056 Ga0081540_1057268
1057 Ga0081540_1068131
1058 Ga0081539_10001457
1059 Ga0081539_10037769
1060 Ga0070717_10019845
1061 Ga0070717_10021496
1062 Ga0075365_10012572
1063 Ga0075368_10042844
1064 Ga0075363_100005334
1065 Ga0075364_10000029
1066 Ga0070712_100808299
1067 Ga0075367_10035218
1068 Ga0075367_10082863
1069 Ga0075367_10111934
1070 Ga0075366_10070043
1071 Ga0075366_10148807
1072 Ga0097621_100104474
1073 Ga0097621_100117216
1074 Ga0075370_10023165
1075 Ga0075370_10334723
1076 Ga0068871_100216390
1077 Ga0075434_100249921
1078 Ga0097620_100438806
1079 Ga0099825_1022094
1080 Ga0099824_1019192
1081 Ga0099822_1006420
1082 Ga0099823_1037379
1083 Ga0099794_10014352
1084 Ga0099794_10031300
1085 Ga0099795_10053323
1086 Ga0105251_10000140
1087 Ga0105244_10000450
1088 Ga0105240_10059600
1089 Ga0105240_10064647
1090 Ga0105240_10072787
1091 Ga0105240_10322138
1092 Ga0111539_10184170
1093 Ga0111539_10380187
1094 Ga0111539_10488752
1095 Ga0105245_10045520
1096 Ga0105245_10045758
1097 Ga0105245_10128906
1098 Ga0105245_10160430
1099 Ga0105247_10486950
1100 Ga0105241_10005048
1101 Ga0105241_10009607
1102 Ga0105241_10377196
1103 Ga0105242_10330486
1104 Ga0105248_10707860
1105 Ga0105237_10007243
1106 Ga0105237_10028934
1107 Ga0105237_10258878
1108 Ga0105237_10425430
1109 Ga0105238_10011544
1110 Ga0105238_10047571
1111 Ga0105238_10051736
1112 Ga0105238_10095876
1113 Ga0105249_10459647
1114 Ga0099796_10057231
1115 Ga0099796_10205069
1116 Ga0105239_10018947
1117 Ga0105239_10022922
1118 Ga0105239_10032243
1119 Ga0105239_10699726
1120 Ga0105246_10568998
1121 Ga0157371_10129523
1122 Ga0157370_10029293
1123 Ga0157370_10038434
1124 Ga0157370_10080305
1125 Ga0157369_10007212
1126 Ga0157369_10010870
1127 Ga0157369_10131324
1128 Ga0157369_10521498
1129 Ga0157369_10585892
1130 Ga0157374_10361256
1131 Ga0157378_11226853
1132 Ga0163162_10049474
1133 Ga0157372_10030328
1134 Ga0157372_10370736
1135 Ga0157372_10414155
1136 Ga0157372_10415937
1137 Ga0157375_10496748
1138 Ga0157375_10503912
1139 Ga0163163_10044270
1140 Ga0163163_10087404
1141 Ga0157380_10024366
1142 Ga0157380_10776031
1143 Ga0157376_10473694
1144 Ga0163161_10179009
1145 Ga0214544_1000002
1146 Ga0214542_1000001
1147 Ga0214545_1000001
1148 Ga0214543_1000001
1149 Ga0213873_10000007
1150 Ga0213873_10009473
1151 Ga0213874_10018432
1152 Ga0213874_10028596
1153 Ga0213876_10000005
1154 Ga0213876_10000766
1155 Ga0213876_10000830
1156 Ga0213876_10138185
1157 Ga0224712_10024112
1158 Ga0209563_100864
1159 Ga0207425_1025476
1160 Ga0209677_100423
1161 Ga0209677_105063
1162 Ga0209148_1000841
1163 Ga0209233_1000666
1164 Ga0209233_1000944
1165 Ga0209233_1003515
1166 Ga0209455_1002230
1167 Ga0209455_1014196
1168 Ga0209676_1000072
1169 Ga0209676_1010460
1170 Ga0209564_1003323
1171 Ga0209758_1000138
1172 Ga0209758_1000140
1173 Ga0209758_1001346
1174 Ga0209758_1003974
1175 Ga0209758_1009576
1176 Ga0209758_1011045
1177 Ga0209758_1014372
1178 Ga0209758_1030251
1179 Ga0209050_1000073
1180 Ga0209050_1000077
1181 Ga0209256_1006541
1182 Ga0209256_1023263
1183 Ga0207426_1000822
1184 Ga0207426_1002280
1185 Ga0207426_1002722
1186 Ga0207426_1016750
1187 Ga0207426_1050245
1188 Ga0209051_1025802
1189 Ga0209257_1000088
1190 Ga0209257_1000099
1191 Ga0209257_1000568
1192 Ga0209257_1001778
1193 Ga0209257_1002227
1194 Ga0209257_1012092
1195 Ga0209257_1037497
1196 Ga0207697_10021991
1197 Ga0207655_1000011
1198 Ga0207713_1001079
1199 Ga0207682_10000930
1200 Ga0207682_10001910
1201 Ga0207682_10067632
1202 Ga0207692_10093069
1203 Ga0207688_10085019
1204 Ga0207680_10284738
1205 Ga0207647_10139717
1206 Ga0207699_10018621
1207 Ga0207699_10019715
1208 Ga0207699_10020512
1209 Ga0207699_10145340
1210 Ga0207645_10010071
1211 Ga0207643_10168227
1212 Ga0207705_10000263
1213 Ga0207705_10436914
1214 Ga0207654_10032770
1215 Ga0207707_10002222
1216 Ga0207707_10012908
1217 Ga0207707_10044120
1218 Ga0207707_10240855
1219 Ga0207695_10000549
1220 Ga0207695_10036731
1221 Ga0207695_10191018
1222 Ga0207671_10006943
1223 Ga0207671_10086551
1224 Ga0207671_10420367
1225 Ga0207660_10003044
1226 Ga0207662_10135397
1227 Ga0207657_10000114
1228 Ga0207657_10043244
1229 Ga0207657_10437256
1230 Ga0207649_10173356
1231 Ga0207652_10004942
1232 Ga0207652_10010650
1233 Ga0207652_10023252
1234 Ga0207652_10374555
1235 Ga0207652_10510097
1236 Ga0207694_10183968
1237 Ga0207694_10198864
1238 Ga0207694_10406470
1239 Ga0207650_10012479
1240 Ga0207650_10043294
1241 Ga0207659_10018283
1242 Ga0207659_10030514
1243 Ga0207687_10069831
1244 Ga0207700_10417270
1245 Ga0207644_10014552
1246 Ga0207690_10504324
1247 Ga0207706_10331829
1248 Ga0207709_10630526
1249 Ga0207669_10006976
1250 Ga0207669_10075540
1251 Ga0207704_10552692
1252 Ga0207691_10002250
1253 Ga0207691_10028549
1254 Ga0207689_10031392
1255 Ga0207689_10223762
1256 Ga0207661_10006099
1257 Ga0207661_10040076
1258 Ga0207661_10190066
1259 Ga0207679_10093724
1260 Ga0207667_10016633
1261 Ga0207667_10059569
1262 Ga0207667_10551985
1263 Ga0207667_10613445
1264 Ga0207651_10001535
1265 Ga0207651_10035786
1266 Ga0207651_10308344
1267 Ga0207668_10362816
1268 Ga0207658_10145398
1269 Ga0207639_10075112
1270 Ga0207639_10082420
1271 Ga0207639_10118578
1272 Ga0207639_10420266
1273 Ga0207678_10007352
1274 Ga0207678_10046476
1275 Ga0207678_10159935
1276 Ga0207678_10304660
1277 Ga0207708_10355884
1278 Ga0207702_10000761
1279 Ga0207702_10302424
1280 Ga0207702_10673737
1281 Ga0207641_10036925
1282 Ga0207641_10401199
1283 Ga0207648_10021087
1284 Ga0207648_10345368
1285 Ga0207676_10243205
1286 Ga0207674_10048677
1287 Ga0207674_10144413
1288 Ga0207675_100079138
1289 Ga0207683_10020310
1290 Ga0207683_10025713
1291 Ga0207698_10025402
1292 Ga0207698_10158552
1293 Ga0209389_1000061
1294 Ga0209389_1000201
1295 Ga0209589_1000465
1296 Ga0209489_100006
1297 Ga0209489_100035
1298 Ga0209700_100005
1299 Ga0209588_1010823
1300 Ga0209813_10026207
1301 Ga0268266_10001162
1302 Ga0268266_10106420
1303 Ga0268264_10019043
1304 Ga0268264_10596921
1305 Ga0265325_10022046
1306 Ga0265340_10050185
1307 Ga0265339_10004749
1308 Ga0265339_10011211
1309 Ga0307513_10168825
1310 Ga0307513_10257633
1311 Ga0307509_10559595
1312 Ga0307508_10076540
1313 Ga0265314_10010506
1314 Ga0265342_10140604
1315 Ga0307405_10328580
1316 Ga0307410_10305807
1317 Ga0307414_10171692
1318 Ga0307411_10075978
1319 Ga0307510_10216556
1320 Ga0315911_1000006
1321 Ga0373934_0069533
1322 Ga0373936_0107282
1323 Ga0373953_0081087
1324 Ga0373954_0021937
1325 Ga0373956_0242017
1326 Ga0373955_0047917
1327 Ga0373924_0124360
1328 Ga0373935_0076449
1329 Ga0373927_0044811
1330 Ga0373933_0000445
1331 Ga0373925_0048880
1332 Ga0395900_0015214
1333 Ga0395900_0019170
1334 Ga0395898_0142928
1335 Ga0395905_0009199
1336 Ga0395905_0024432
1337 Ga0395905_0118090
1338 Ga0395905_0185648
1339 Ga0395905_0270738
1340 Ga0436364_0949293
1341 Ga0395901_0020301
1342 Ga0395901_0047344
1343 Ga0395901_0103938
1344 Ga0395901_0122995
1345 Ga0395901_0475794
1346 Ga0436365_0010969
1347 Ga0436365_0292687
1348 Ga0436365_0309417
1349 Ga0436365_0352550
1350 Ga0436365_0421020
1351 Ga0436365_0886350
1352 Ga0436365_1135741
1353 Ga0436365_1162056
1354 Ga0436365_1497206
1355 Ga0436365_1885891
1356 Ga0436360_0770718
1357 Ga0436360_1140654
1358 Ga0436363_0877352
1359 Ga0436363_1064860
1360 Ga0436363_1626939
1361 Ga0436362_0180148
1362 Ga0436362_0976836
1363 Ga0451802_0508379
1364 Ga0451807_1455468
1365 Ga0439435_0001507
1366 Ga0439464_0099158
1367 Ga0466972_0000189
1368 Ga0466972_0014313
1369 Ga0466965_0042687
1370 Ga0466966_0000196
1371 Ga0466966_0063196
1372 Ga0466961_0000239
1373 Ga0466963_0008928
1374 Ga0466968_0013036
1375 Ga0466957_0023419
1376 Ga0466960_0004190
1377 Ga0466959_0012195
1378 Ga0466958_0085394
1379 Ga0466967_0029516
1380 Ga0466967_0172349
1381 Ga0495592_0011425
1382 Ga0495592_0099434
1383 Ga0495592_0229714
1384 Ga0495629_0012017
1385 Ga0495638_0012019
1386 Ga0495638_0055750
1387 Ga0495638_0172511
1388 Ga0495651_0004537
1389 Ga0495651_0056064
1390 Ga0495653_0230971
1391 Ga0495650_0060492
1392 Ga0495582_0010030
1393 Ga0495639_0030353
1394 Ga0495662_0062168
1395 Ga0495664_0004197
1396 Ga0495664_0006231
1397 Ga0495606_0048655
1398 Ga0495606_0222162
1399 Ga0495606_0340077
1400 Ga0495608_0006784
1401 Ga0495610_0007739
1402 Ga0495610_0108519
1403 Ga0495616_0194458
1404 Ga0495618_0045559
1405 Ga0495628_0023187
1406 Ga0495628_0189158
1407 Ga0495630_0032174
1408 Ga0495637_0017856
1409 Ga0495648_0011449
1410 Ga0495652_0082645
1411 Ga0495652_0101427
1412 Ga0495652_0326238
1413 Ga0495665_0115084
1414 Ga0495640_0023262
1415 Ga0495640_0035031
1416 Ga0495640_0119622
1417 Ga0495586_0184588
1418 Ga0495587_0006350
1419 Ga0495598_0001085
1420 Ga0495645_0019888
1421 Ga0495667_0255844
1422 Ga0495668_0083861
1423 Ga0495668_0083935
1424 Ga0495668_0197025
1425 Ga0495634_0031088
1426 Ga0495634_0088702
1427 Ga0495625_0152949
1428 Ga0495635_0007466
1429 Ga0495635_0032693
1430 Ga0495657_0004893
1431 Ga0495657_0018228
1432 Ga0495599_0003791
1433 Ga0495599_0258049
1434 Ga0495623_0014751
1435 Ga0495646_0019009
1436 Ga0495658_0074029
1437 Ga0495613_0016662
1438 Ga0495613_0171578
1439 Ga0495624_0060099
1440 Ga0495671_0016031
1441 Ga0495649_0000982
1442 Ga0495600_0015463
1443 Ga0495600_0039650
1444 Ga0495600_0171720
1445 Ga0495604_0000711
1446 Ga0495604_0024032
1447 Ga0495674_0023553
1448 Ga0495674_0137325
1449 Ga0495672_0009250
1450 Ga0495676_0121840
1451 Ga0495676_0297157
1452 Ga0495680_0012590
1453 Ga0495675_0042499
1454 Ga0495675_0241672
1455 Ga0495673_0021038
1456 Ga0495684_0022121
1457 Ga0495686_0089754
1458 Ga0495686_0129020
1459 Ga0495593_0032600
1460 Ga0496100_0111814
1461 Ga0496100_0502419
1462 Ga0496101_0111236
1463 Ga0496101_0118982
1464 Ga0496101_0533205
1465 Ga0496102_0115433
1466 Ga0496103_0166231
1467 Ga0496103_0334622
1468 Ga0496104_0008067
1469 Ga0496104_0154682
1470 Ga0496105_0000463
1471 Ga0496105_0104810
1472 Ga0496105_0590604
1473 Ga0496106_0240755
1474 Ga0496106_0253896
1475 Ga0496107_0110492
1476 Ga0496107_0409942
1477 Ga0496108_0434229
1478 Ga0496109_0130786
1479 Ga0496109_0728193
1480 Ga0496110_0034086
1481 Ga0496110_0080243
1482 Ga0496110_0194476
1483 Ga0496110_0275338
1484 Ga0496111_0202113
1485 Ga0496112_0243792
1486 Ga0496112_0312095
1487 Ga0496112_0348427
1488 Ga0496113_0091159
1489 Ga0496114_0149465
1490 Ga0496114_0732675
1491 Ga0496115_0228713
1492 Ga0496116_0091797
1493 Ga0496117_0037502
1494 Ga0496117_0040088
1495 Ga0496117_0040435
1496 Ga0496117_0087819
1497 Ga0496118_0012253
1498 Ga0496119_0047089
1499 Ga0496119_0113005
1500 Ga0496119_0119533
1501 Ga0496120_0000724
1502 Ga0496120_0017276
1503 Ga0496120_0047664
1504 Ga0496121_0001254
1505 Ga0496121_0001728
1506 Ga0496121_0036298
1507 Ga0496121_0048068
1508 Ga0496121_0063602
1509 Ga0496121_0075832
1510 Ga0496121_0077256
1511 Ga0496121_0122541
1512 Ga0496121_0183101
1513 Ga0496121_0198577
1514 Ga0496121_0445098
1515 Ga0496122_0113521
1516 Ga0496122_0182116
1517 Ga0496124_0000004
1518 Ga0496124_0198511
1519 Ga0496125_0038178
1520 Ga0496125_0056746
1521 Ga0496125_0077077
1522 Ga0496125_0091414
1523 Ga0496125_0136882
1524 Ga0496126_0001940
1525 Ga0496126_0027545
1526 Ga0496126_0027737
1527 Ga0496126_0030278
1528 Ga0496126_0152729
1529 Ga0496126_0159356
1530 Ga0496126_0193947
1531 Ga0496126_0297736
1532 Ga0496126_0634773
1533 Ga0495682_0036095
1534 Ga0501032_0021110
1535 Ga0501033_0140674
1536 Ga0501034_0000820
1537 Ga0501034_0135726
1538 Ga0501036_0000216
1539 Ga0501036_0115391
1540 Ga0501037_0003053
1541 Ga0501037_0018965
1542 Ga0501037_0073172
1543 Ga0501037_0195092
1544 Ga0501038_0157875
1545 Ga0501039_0023629
1546 Ga0501039_0095112
1547 Ga0501041_0233156
1548 Ga0501043_0023520
1549 Ga0501043_0051032
1550 Ga0501043_0146533
1551 Ga0501047_0000124
1552 Ga0501047_0058289
1553 Ga0501047_0221102
1554 Ga0501048_0000375
1555 Ga0501067_0005409
1556 Ga0501067_0053899
1557 Ga0501068_0105412
1558 Ga0501069_0019919
1559 Ga0501070_0005426
1560 Ga0501070_0035267
1561 Ga0501072_0150978
1562 Ga0501072_0410092
1563 Ga0501073_0051155
1564 Ga0501074_0015301
1565 Ga0501079_0466351
1566 Ga0501080_0000074
1567 Ga0501080_0097372
1568 Ga0501080_0225507
1569 Ga0501080_0276055
1570 Ga0501083_0005619
1571 Ga0501035_0301223
1572 Ga0501035_0563052
1573 Ga0501044_0001469
1574 Ga0501044_0123542
1575 Ga0501044_0131206
1576 Ga0501045_0005982
1577 Ga0501045_0270763
1578 nmdc:mga00v17_144_c1
1579 nmdc:mga0yw44_16919_c1
1580 nmdc:mga0yw44_65641_c1
1581 nmdc:mga0k408_103613_c1
1582 nmdc:mga07m45_156151_c1
1583 nmdc:mga07m45_7081_c1
1584 nmdc:mga0qj67_136015_c1
1585 nmdc:mga08y16_39495_c1
1586 nmdc:mga0n895_204243_c1
1587 Ga0495601_0055954
1588 Ga0495601_0103868
1589 Ga0495601_0150036
1590 Ga0495601_0191706
1591 Ga0495612_0110138
1592 Ga0495655_0057018
1593 Ga0495619_0007164
1594 Ga0495619_0255595
1595 Ga0495619_0284662
1596 Ga0500578_0115378
1597 Ga0500578_0207570
1598 Ga0500643_000032
1599 Ga0500583_0148964
1600 Ga0500566_0000009
1601 Ga0500566_0000246
1602 Ga0500566_0007043
1603 Ga0500556_0022202
1604 Ga0500569_002947
1605 Ga0500572_000070
1606 Ga0500572_010809
1607 Ga0500591_082891
1608 Ga0500592_008686
1609 Ga0500595_018973
1610 Ga0500614_001151
1611 Ga0500642_0000173
1612 Ga0500642_0042944
1613 Ga0500642_0186553
1614 Ga0500559_0020697
1615 Ga0500577_0025165
1616 Ga0500577_0091249
1617 Ga0500604_0032388
1618 Ga0500616_0048085
1619 Ga0500622_0006007
1620 Ga0500622_0012668
1621 Ga0500630_000240
1622 Ga0500638_000252
1623 Ga0500638_018423
1624 Ga0500639_000545
1625 Ga0500636_0000122
1626 Ga0500636_0016336
1627 Ga0500637_0000142
1628 Ga0500645_001654
1629 Ga0500599_003744
1630 Ga0500601_000050
1631 Ga0501084_0095078
1632 Ga0500661_000128
1633 Ga0500661_002648
1634 Ga0501082_0178882
1635 Ga0501082_0352930
1636 2507508408
1637 2508542475
1638 2508691751
1639 2511393921
1640 2513610707
1641 2513625560
1642 2513644458
1643 2513645662
1644 2513692745
1645 2513701107
1646 2513717128
1647 2513872950
1648 2513894715
1649 2514013710
1650 2514586411
1651 2515627099
1652 2517107789
1653 2523106374
1654 2524437531
1655 2524466097
1656 2524534323
1657 2528852408
1658 2587918873
1659 2599935305
1660 2617347334
1661 2644225517
1662 2644232827
1663 2644290606
1664 2694628021
1665 2728747413
1666 2745076477
1667 2753764390
1668 2765464050
1669 2793068698
1670 2805915152
1671 2818238705
1672 2819685198
1673 2824604051
1674 2824610320
1675 2824617911
1676 2824626579
1677 2824638596
1678 2824646064
1679 2824658039
1680 2824668324
1681 2824676863
1682 2824684514
1683 2824693186
1684 2824701818
1685 2824708991
1686 2824716250
1687 2824726549
1688 2824735290
1689 2824759573
1690 2824770024
1691 2824775459
1692 2838123558
1693 2841946797
1694 2841949658
1695 2841958841
1696 2841971835
1697 2841974819
1698 2841983619
1699 2842038877
1700 2842048177
1701 2844319247
1702 2847936400
1703 2847946749
1704 2849079133
1705 2851185253
1706 2857514121
1707 2857545717
1708 2874598228
1709 2874605403
1710 2874615104
1711 2874627658
1712 2874632038
1713 2874652717
1714 2876385021
1715 2876764699
1716 2876778294
1717 2876809932
1718 2876825837
1719 2879082088
1720 2879090183
1721 2879105722
1722 2879110225
1723 2879135235
1724 2879145406
1725 2881368661
1726 2881673498
1727 2883293417
1728 2885373505
1729 2885381947
1730 2885392114
1731 2885412484
1732 2885431116
1733 2888352967
1734 2888384247
1735 2888393628
1736 2888424721
1737 2889014738
1738 2889020272
1739 2903731089
1740 2903751637
1741 2904579303
1742 2904673022
1743 2904694634
1744 2904702379
1745 2904714849
1746 2906357406
1747 2906607404
1748 2906617349
1749 2906649005
1750 2908742507
1751 2908760189
1752 2919121871
1753 2919453825
1754 2922134599
1755 2922188789
1756 2922374595
1757 2922400622
1758 2922430472
1759 2928535581
1760 2929618259
1761 2929632447
1762 2932790553
1763 2932799771
1764 2932806978
1765 2932810974
1766 2932823696
1767 2932830184
1768 2933580187
1769 2935609051
1770 2935622590
1771 2935642610
1772 2935653239
1773 2935660442
1774 2935668086
1775 2935676119
1776 2935686103
1777 2935701271
1778 2935705946
1779 2935714655
1780 2935725274
1781 2935732366
1782 2935741745
1783 2935752068
1784 2935766416
1785 2935771861
1786 2935778702
1787 2935788912
1788 2935795288
1789 2935802945
1790 2935814262
1791 2935822211
1792 2935831399
1793 2935838259
1794 2935847793
1795 2935860839
1796 2935869824
1797 2935878757
1798 2935886898
1799 2935908935
1800 2935919653
1801 2935926491
1802 2935934941
1803 2935943391
1804 2935951829
1805 2935960592
1806 2935967954
1807 2935978582
1808 2935987565
1809 2935994847
1810 2936003489
1811 2936016109
1812 2936024742
1813 2936031838
1814 2936039818
1815 2936049699
1816 2936060803
1817 2938019813
1818 2940557129
1819 2941533001
1820 2941539073
1821 2958101677
1822 2958177945
1823 2965123582
1824 2977977206
1825 2979712762
1826 2979749585
1827 2987655299
1828 3005480383
1829 3005484497
1830 3005510510
1831 3005587864
1832 3005599417
1833 3005722492
1834 3007808808
1835 8001846775
1836 8006929113
1837 8006940492
1838 8006967127
1839 8006980181
1840 8016522126
1841 8016529438
1842 8016534647
1843 8016547867
1844 8016554267
1845 8016562642
1846 8016572993
1847 8016577145
1848 8016591550
1849 8016600425
1850 8016610313
1851 8016614617
1852 8016626380
1853 8016640137
1854 8017063543
1855 8018151302
1856 8019534413
1857 8019545056
1858 8019553471
1859 8019556565
1860 8019568743
1861 8019582862
1862 8019590657
1863 8019600694
1864 8019617853
1865 8019628367
1866 8019634262
1867 8019645472
1868 8019658585
1869 8019671653
1870 8019684447
1871 8019690254
1872 8054930207
1873 8055746152
1874 8056688188
1875 8056691343
1876 8056968208

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

19

99

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

28

100

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

23

114

0.87

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

147

216

0.82

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

128

212

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nhz-assembly2.cif.gz_D crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9924 3 232
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.9899 7 229
4nhz-assembly4.cif.gz_H crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9896 1 232
4mf6-assembly1.cif.gz_A crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit 0.9875 1 232
4nax-assembly1.cif.gz_B crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit 0.9875 3 230
ID Description Score Start End Superfamily
4nhzB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9946 106 219 1.20.1050.10
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9932 7 103 3.40.30.10
4naxB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9818 106 219 1.20.1050.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9697 21 103 3.40.30.10
4nhzB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9692 106 219 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A258D0G9-F1-model_v4 Glutathione S-transferase 1.002 1 106 GO:0016740
AF-A0A519KSC6-F1-model_v4 Glutathione S-transferase 0.9993 1 92 GO:0016740
AF-A0A521SM90-F1-model_v4 deleted 0.9981 65 232
AF-A0A242MN16-F1-model_v4 Glutathione S-transferase 0.9978 4 232 GO:0016740
AF-A0A125QIH4-F1-model_v4 Disulfide-bond oxidoreductase YfcG (EC 1.8.4.-) 0.9977 121 229 GO:0016491

Map