F486265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 420 | 901 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_1259757|Ga0501034_1259757_205_591 |
| Length | 128 |
| Sequence | MRRLIAPLVCASAGYSRETIMAVKPRIKLDKKEAKKGDIVEVKALVSHIMETGQRKDASGNVIPRKILNKFVCTVAGKQVFSADFEPAISANPYIQFKFRAETSGPVVLTWIDDDGSTIVGEETIKVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 4 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 5 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 6 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 9 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 10 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 11 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 12 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 13 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 14 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 15 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 16 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 17 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 18 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 19 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 20 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 21 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 22 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 23 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 24 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 25 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 26 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 27 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 28 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 29 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 30 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 31 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 32 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 33 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 34 | 2906610324 | |||
| 35 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 36 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 37 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 38 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 253 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 259 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 260 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 268 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 269 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 389 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 390 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 392 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 399 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 406 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 407 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 408 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 411 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 420 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 0 |
| Isolates | 3.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.35 |
| Nodule | 2.24 |
| Rhizoplane | 4.8 |
| Rhizosphere | 71.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214578602 | 2209111006 | Bacteria | 525 |
| 2 | JGI25406J46586_10155184 | 3300003203 | Bacteria | 668 |
| 3 | JGI25407J50210_10152214 | 3300003373 | Bacteria | 569 |
| 4 | JGI25404J52841_10016298 | 3300003659 | Bacteria | 1612 |
| 5 | JGI25404J52841_10030164 | 3300003659 | Bacteria | 1162 |
| 6 | Ga0065165_1000209 | 3300005262 | Bacteria | 101834 |
| 7 | Ga0065712_10041572 | 3300005290 | Bacteria | 811 |
| 8 | Ga0065712_10109852 | 3300005290 | Bacteria | 1848 |
| 9 | Ga0065715_10149271 | 3300005293 | Bacteria | 1745 |
| 10 | Ga0065715_10473769 | 3300005293 | Bacteria | 804 |
| 11 | Ga0065715_11108973 | 3300005293 | Bacteria | 518 |
| 12 | Ga0065707_10353061 | 3300005295 | Bacteria | 915 |
| 13 | Ga0065707_10915669 | 3300005295 | Bacteria | 562 |
| 14 | Ga0070658_10051167 | 3300005327 | Bacteria | 3348 |
| 15 | Ga0070676_10082647 | 3300005328 | Bacteria | 1952 |
| 16 | Ga0070676_10588801 | 3300005328 | Bacteria | 801 |
| 17 | Ga0070670_100691710 | 3300005331 | Bacteria | 917 |
| 18 | Ga0070677_10005339 | 3300005333 | Bacteria | 4230 |
| 19 | Ga0068869_100418842 | 3300005334 | Bacteria | 1105 |
| 20 | Ga0070666_10457265 | 3300005335 | Bacteria | 922 |
| 21 | Ga0070666_10516274 | 3300005335 | Bacteria | 867 |
| 22 | Ga0070680_100013998 | 3300005336 | Bacteria | 6262 |
| 23 | Ga0070680_100776942 | 3300005336 | Bacteria | 825 |
| 24 | Ga0070682_101010531 | 3300005337 | Bacteria | 691 |
| 25 | Ga0070682_101980250 | 3300005337 | Bacteria | 512 |
| 26 | Ga0068868_100436736 | 3300005338 | Bacteria | 1136 |
| 27 | Ga0068868_100536470 | 3300005338 | Bacteria | 1029 |
| 28 | Ga0068868_101075155 | 3300005338 | Bacteria | 739 |
| 29 | Ga0068868_101098853 | 3300005338 | Bacteria | 731 |
| 30 | Ga0070660_100068441 | 3300005339 | Bacteria | 2767 |
| 31 | Ga0070689_101600186 | 3300005340 | Bacteria | 592 |
| 32 | Ga0070689_101641183 | 3300005340 | Bacteria | 584 |
| 33 | Ga0070691_10038192 | 3300005341 | Bacteria | 2267 |
| 34 | Ga0070691_10278604 | 3300005341 | Unclassified | 906 |
| 35 | Ga0070687_100192906 | 3300005343 | Bacteria | 1229 |
| 36 | Ga0070687_100241285 | 3300005343 | Bacteria | 1118 |
| 37 | Ga0070661_100132513 | 3300005344 | Bacteria | 1873 |
| 38 | Ga0070692_10877072 | 3300005345 | Bacteria | 619 |
| 39 | Ga0070692_10927052 | 3300005345 | Bacteria | 604 |
| 40 | Ga0070668_100046891 | 3300005347 | Bacteria | 3321 |
| 41 | Ga0070668_100156589 | 3300005347 | Bacteria | 1846 |
| 42 | Ga0070668_100453176 | 3300005347 | Bacteria | 1103 |
| 43 | Ga0070668_100750281 | 3300005347 | Bacteria | 864 |
| 44 | Ga0070668_101945558 | 3300005347 | Bacteria | 542 |
| 45 | Ga0070669_100154343 | 3300005353 | Bacteria | 1779 |
| 46 | Ga0070669_101234906 | 3300005353 | Bacteria | 646 |
| 47 | Ga0070669_101311396 | 3300005353 | Bacteria | 627 |
| 48 | Ga0070675_100053020 | 3300005354 | Bacteria | 3335 |
| 49 | Ga0070675_100399015 | 3300005354 | Bacteria | 1227 |
| 50 | Ga0070675_100912966 | 3300005354 | Bacteria | 805 |
| 51 | Ga0070675_101484049 | 3300005354 | Bacteria | 625 |
| 52 | Ga0070671_100042683 | 3300005355 | Bacteria | 3769 |
| 53 | Ga0070671_100364071 | 3300005355 | Bacteria | 1235 |
| 54 | Ga0070671_100920699 | 3300005355 | Bacteria | 764 |
| 55 | Ga0070671_100932751 | 3300005355 | Bacteria | 759 |
| 56 | Ga0070674_100049857 | 3300005356 | Bacteria | 2880 |
| 57 | Ga0070674_100118576 | 3300005356 | Bacteria | 1956 |
| 58 | Ga0070674_100972696 | 3300005356 | Bacteria | 743 |
| 59 | Ga0070674_101199435 | 3300005356 | Bacteria | 674 |
| 60 | Ga0070673_100071920 | 3300005364 | Bacteria | 2780 |
| 61 | Ga0070673_100207545 | 3300005364 | Bacteria | 1690 |
| 62 | Ga0070673_100368452 | 3300005364 | Bacteria | 1278 |
| 63 | Ga0070688_100766106 | 3300005365 | Bacteria | 752 |
| 64 | Ga0070688_101651374 | 3300005365 | Bacteria | 524 |
| 65 | Ga0070688_101800320 | 3300005365 | Bacteria | 503 |
| 66 | Ga0070659_100892224 | 3300005366 | Bacteria | 777 |
| 67 | Ga0070659_101368238 | 3300005366 | Bacteria | 629 |
| 68 | Ga0070667_100271139 | 3300005367 | Bacteria | 1522 |
| 69 | Ga0070667_100985939 | 3300005367 | Bacteria | 786 |
| 70 | Ga0070667_101423708 | 3300005367 | Bacteria | 650 |
| 71 | Ga0070709_11087828 | 3300005434 | Bacteria | 639 |
| 72 | Ga0070714_100424389 | 3300005435 | Bacteria | 1260 |
| 73 | Ga0070713_100865579 | 3300005436 | Bacteria | 868 |
| 74 | Ga0070701_11249118 | 3300005438 | Bacteria | 529 |
| 75 | Ga0070705_100242665 | 3300005440 | Bacteria | 1260 |
| 76 | Ga0070705_101889051 | 3300005440 | Bacteria | 508 |
| 77 | Ga0070700_100258480 | 3300005441 | Bacteria | 1253 |
| 78 | Ga0070700_100855913 | 3300005441 | Bacteria | 737 |
| 79 | Ga0070700_100892536 | 3300005441 | Bacteria | 723 |
| 80 | Ga0070700_101245636 | 3300005441 | Bacteria | 623 |
| 81 | Ga0070663_100036370 | 3300005455 | Bacteria | 3421 |
| 82 | Ga0070678_100151387 | 3300005456 | Bacteria | 1869 |
| 83 | Ga0070678_100317943 | 3300005456 | Bacteria | 1328 |
| 84 | Ga0070678_100494993 | 3300005456 | Bacteria | 1078 |
| 85 | Ga0070662_100024505 | 3300005457 | Bacteria | 4157 |
| 86 | Ga0070662_101024112 | 3300005457 | Bacteria | 707 |
| 87 | Ga0070662_101458471 | 3300005457 | Bacteria | 590 |
| 88 | Ga0070681_10411752 | 3300005458 | Bacteria | 1264 |
| 89 | Ga0070681_11137461 | 3300005458 | Bacteria | 702 |
| 90 | Ga0068867_100180068 | 3300005459 | Bacteria | 1680 |
| 91 | Ga0068867_100980316 | 3300005459 | Bacteria | 765 |
| 92 | Ga0068867_101603280 | 3300005459 | Bacteria | 608 |
| 93 | Ga0070685_10099508 | 3300005466 | Bacteria | 1773 |
| 94 | Ga0070698_101769061 | 3300005471 | Bacteria | 571 |
| 95 | Ga0070679_100039578 | 3300005530 | Bacteria | 4685 |
| 96 | Ga0070679_100439501 | 3300005530 | Bacteria | 1249 |
| 97 | Ga0070684_101917378 | 3300005535 | Bacteria | 559 |
| 98 | Ga0068853_100238749 | 3300005539 | Bacteria | 1665 |
| 99 | Ga0068853_100924617 | 3300005539 | Bacteria | 838 |
| 100 | Ga0068853_102303650 | 3300005539 | Bacteria | 522 |
| 101 | Ga0070672_100575537 | 3300005543 | Bacteria | 979 |
| 102 | Ga0070672_100968129 | 3300005543 | Bacteria | 753 |
| 103 | Ga0070672_101050852 | 3300005543 | Bacteria | 723 |
| 104 | Ga0070672_101122515 | 3300005543 | Bacteria | 699 |
| 105 | Ga0070686_100402150 | 3300005544 | Bacteria | 1042 |
| 106 | Ga0070686_101134246 | 3300005544 | Bacteria | 647 |
| 107 | Ga0070695_101224100 | 3300005545 | Bacteria | 618 |
| 108 | Ga0070693_100164029 | 3300005547 | Bacteria | 1418 |
| 109 | Ga0070665_100542628 | 3300005548 | Bacteria | 1175 |
| 110 | Ga0070664_100954992 | 3300005564 | Bacteria | 805 |
| 111 | Ga0068857_100276960 | 3300005577 | Bacteria | 1542 |
| 112 | Ga0068857_102025324 | 3300005577 | Bacteria | 565 |
| 113 | Ga0068854_100609290 | 3300005578 | Bacteria | 933 |
| 114 | Ga0068854_102071140 | 3300005578 | Bacteria | 525 |
| 115 | Ga0068856_100813319 | 3300005614 | Bacteria | 954 |
| 116 | Ga0068852_100914230 | 3300005616 | Bacteria | 895 |
| 117 | Ga0068859_100207856 | 3300005617 | Bacteria | 2043 |
| 118 | Ga0068859_100244509 | 3300005617 | Bacteria | 1884 |
| 119 | Ga0068859_101182952 | 3300005617 | Bacteria | 842 |
| 120 | Ga0068864_100080657 | 3300005618 | Bacteria | 2851 |
| 121 | Ga0068864_100869790 | 3300005618 | Bacteria | 889 |
| 122 | Ga0068861_100306416 | 3300005719 | Bacteria | 1378 |
| 123 | Ga0068861_100975804 | 3300005719 | Bacteria | 807 |
| 124 | Ga0068861_101336858 | 3300005719 | Bacteria | 698 |
| 125 | Ga0068861_101535742 | 3300005719 | Bacteria | 654 |
| 126 | Ga0068861_102016707 | 3300005719 | Bacteria | 576 |
| 127 | Ga0068870_10264555 | 3300005840 | Bacteria | 1072 |
| 128 | Ga0068870_10644837 | 3300005840 | Bacteria | 725 |
| 129 | Ga0068863_100937727 | 3300005841 | Bacteria | 867 |
| 130 | Ga0068858_100110809 | 3300005842 | Bacteria | 2563 |
| 131 | Ga0068860_102644452 | 3300005843 | Bacteria | 521 |
| 132 | Ga0068862_100019045 | 3300005844 | Bacteria | 5723 |
| 133 | Ga0068862_101791972 | 3300005844 | Bacteria | 623 |
| 134 | Ga0081455_10000196 | 3300005937 | Bacteria | 76949 |
| 135 | Ga0081455_10030097 | 3300005937 | Bacteria | 4938 |
| 136 | Ga0081455_10288312 | 3300005937 | Bacteria | 1183 |
| 137 | Ga0081455_10467233 | 3300005937 | Bacteria | 857 |
| 138 | Ga0081455_10767238 | 3300005937 | Bacteria | 608 |
| 139 | Ga0081455_10770091 | 3300005937 | Bacteria | 607 |
| 140 | Ga0081538_10010509 | 3300005981 | Bacteria | 7589 |
| 141 | Ga0081538_10026508 | 3300005981 | Bacteria | 4051 |
| 142 | Ga0081538_10066481 | 3300005981 | Bacteria | 2021 |
| 143 | Ga0081538_10152432 | 3300005981 | Bacteria | 1044 |
| 144 | Ga0081538_10336367 | 3300005981 | Bacteria | 548 |
| 145 | Ga0081540_1000045 | 3300005983 | Bacteria | 134124 |
| 146 | Ga0081540_1000293 | 3300005983 | Bacteria | 52532 |
| 147 | Ga0081540_1005974 | 3300005983 | Bacteria | 8967 |
| 148 | Ga0081540_1041402 | 3300005983 | Bacteria | 2389 |
| 149 | Ga0081540_1259249 | 3300005983 | Bacteria | 604 |
| 150 | Ga0081539_10002257 | 3300005985 | Bacteria | 28023 |
| 151 | Ga0081539_10005839 | 3300005985 | Bacteria | 12218 |
| 152 | Ga0081539_10015916 | 3300005985 | Bacteria | 5420 |
| 153 | Ga0081539_10043106 | 3300005985 | Bacteria | 2619 |
| 154 | Ga0081539_10421400 | 3300005985 | Bacteria | 554 |
| 155 | Ga0070717_11889230 | 3300006028 | Bacteria | 539 |
| 156 | Ga0075365_10004179 | 3300006038 | Bacteria | 7601 |
| 157 | Ga0075365_10225049 | 3300006038 | Bacteria | 1316 |
| 158 | Ga0075365_10963058 | 3300006038 | Bacteria | 601 |
| 159 | Ga0075365_11144497 | 3300006038 | Bacteria | 548 |
| 160 | Ga0075368_10002447 | 3300006042 | Bacteria | 6063 |
| 161 | Ga0075368_10044175 | 3300006042 | Bacteria | 1757 |
| 162 | Ga0075368_10104614 | 3300006042 | Bacteria | 1164 |
| 163 | Ga0075368_10475193 | 3300006042 | Bacteria | 556 |
| 164 | Ga0075363_100047388 | 3300006048 | Bacteria | 2282 |
| 165 | Ga0075363_100101691 | 3300006048 | Bacteria | 1591 |
| 166 | Ga0075363_100251267 | 3300006048 | Bacteria | 1018 |
| 167 | Ga0075363_100540210 | 3300006048 | Bacteria | 695 |
| 168 | Ga0075364_10021661 | 3300006051 | Bacteria | 4051 |
| 169 | Ga0075364_10155242 | 3300006051 | Bacteria | 1543 |
| 170 | Ga0075364_10486711 | 3300006051 | Bacteria | 843 |
| 171 | Ga0075364_10954163 | 3300006051 | Bacteria | 583 |
| 172 | Ga0070715_10573342 | 3300006163 | Bacteria | 657 |
| 173 | Ga0075362_10103278 | 3300006177 | Bacteria | 1335 |
| 174 | Ga0075362_10190721 | 3300006177 | Bacteria | 995 |
| 175 | Ga0075362_10193124 | 3300006177 | Bacteria | 989 |
| 176 | Ga0075362_10207732 | 3300006177 | Bacteria | 954 |
| 177 | Ga0075362_10317903 | 3300006177 | Bacteria | 775 |
| 178 | Ga0075362_10323043 | 3300006177 | Bacteria | 769 |
| 179 | Ga0075367_10037371 | 3300006178 | Bacteria | 2821 |
| 180 | Ga0075367_10097412 | 3300006178 | Bacteria | 1794 |
| 181 | Ga0075367_10104264 | 3300006178 | Bacteria | 1736 |
| 182 | Ga0075367_10425883 | 3300006178 | Bacteria | 840 |
| 183 | Ga0075369_10022004 | 3300006186 | Bacteria | 2627 |
| 184 | Ga0075369_10029118 | 3300006186 | Bacteria | 2318 |
| 185 | Ga0075369_10310598 | 3300006186 | Bacteria | 737 |
| 186 | Ga0075369_10495105 | 3300006186 | Bacteria | 581 |
| 187 | Ga0075366_10003832 | 3300006195 | Bacteria | 8009 |
| 188 | Ga0075366_10191871 | 3300006195 | Bacteria | 1241 |
| 189 | Ga0075366_10223416 | 3300006195 | Bacteria | 1147 |
| 190 | Ga0075366_10702648 | 3300006195 | Bacteria | 628 |
| 191 | Ga0075366_10802218 | 3300006195 | Bacteria | 586 |
| 192 | Ga0075366_10980056 | 3300006195 | Bacteria | 527 |
| 193 | Ga0097621_100760050 | 3300006237 | Bacteria | 896 |
| 194 | Ga0075370_10111276 | 3300006353 | Bacteria | 1590 |
| 195 | Ga0075370_10227312 | 3300006353 | Bacteria | 1104 |
| 196 | Ga0075370_10428665 | 3300006353 | Bacteria | 795 |
| 197 | Ga0075428_100118754 | 3300006844 | Bacteria | 2879 |
| 198 | Ga0075428_100179086 | 3300006844 | Bacteria | 2295 |
| 199 | Ga0075428_100182655 | 3300006844 | Bacteria | 2270 |
| 200 | Ga0075428_100302389 | 3300006844 | Bacteria | 1720 |
| 201 | Ga0075428_100464305 | 3300006844 | Bacteria | 1355 |
| 202 | Ga0075428_100595785 | 3300006844 | Bacteria | 1181 |
| 203 | Ga0075428_101349636 | 3300006844 | Bacteria | 749 |
| 204 | Ga0075428_101878361 | 3300006844 | Bacteria | 622 |
| 205 | Ga0075428_102042025 | 3300006844 | Bacteria | 594 |
| 206 | Ga0075430_100315400 | 3300006846 | Bacteria | 1293 |
| 207 | Ga0075430_100635753 | 3300006846 | Bacteria | 880 |
| 208 | Ga0075430_100733528 | 3300006846 | Bacteria | 814 |
| 209 | Ga0075430_101796853 | 3300006846 | Bacteria | 503 |
| 210 | Ga0075431_100217230 | 3300006847 | Bacteria | 1951 |
| 211 | Ga0075431_100259704 | 3300006847 | Bacteria | 1763 |
| 212 | Ga0075431_101929329 | 3300006847 | Bacteria | 546 |
| 213 | Ga0075433_10000349 | 3300006852 | Bacteria | 28807 |
| 214 | Ga0075433_10237570 | 3300006852 | Bacteria | 1618 |
| 215 | Ga0075434_100002239 | 3300006871 | Bacteria | 16904 |
| 216 | Ga0075434_100825207 | 3300006871 | Bacteria | 943 |
| 217 | Ga0075429_100367620 | 3300006880 | Bacteria | 1259 |
| 218 | Ga0068865_100068815 | 3300006881 | Bacteria | 2504 |
| 219 | Ga0097620_100207870 | 3300006931 | Bacteria | 2043 |
| 220 | Ga0097620_100244532 | 3300006931 | Bacteria | 1884 |
| 221 | Ga0097620_101183088 | 3300006931 | Bacteria | 842 |
| 222 | Ga0105240_11836601 | 3300009093 | Bacteria | 631 |
| 223 | Ga0111539_10012734 | 3300009094 | Bacteria | 10533 |
| 224 | Ga0111539_10021737 | 3300009094 | Bacteria | 7889 |
| 225 | Ga0111539_10772926 | 3300009094 | Bacteria | 1118 |
| 226 | Ga0111539_10905049 | 3300009094 | Bacteria | 1026 |
| 227 | Ga0111539_11106387 | 3300009094 | Bacteria | 921 |
| 228 | Ga0111539_11179906 | 3300009094 | Bacteria | 889 |
| 229 | Ga0111539_11249317 | 3300009094 | Bacteria | 862 |
| 230 | Ga0105245_10089093 | 3300009098 | Bacteria | 2836 |
| 231 | Ga0105245_12678660 | 3300009098 | Bacteria | 552 |
| 232 | Ga0105247_10106654 | 3300009101 | Bacteria | 1798 |
| 233 | Ga0105247_10637354 | 3300009101 | Bacteria | 795 |
| 234 | Ga0105247_11092863 | 3300009101 | Bacteria | 629 |
| 235 | Ga0114129_10050036 | 3300009147 | Bacteria | 5871 |
| 236 | Ga0114129_10176057 | 3300009147 | Bacteria | 2914 |
| 237 | Ga0114129_10348670 | 3300009147 | Bacteria | 1962 |
| 238 | Ga0114129_10532367 | 3300009147 | Bacteria | 1530 |
| 239 | Ga0114129_10739919 | 3300009147 | Bacteria | 1260 |
| 240 | Ga0114129_11938248 | 3300009147 | Bacteria | 714 |
| 241 | Ga0114129_11952726 | 3300009147 | Bacteria | 711 |
| 242 | Ga0105243_10120148 | 3300009148 | Bacteria | 2214 |
| 243 | Ga0105243_10538936 | 3300009148 | Bacteria | 1113 |
| 244 | Ga0105243_11419579 | 3300009148 | Bacteria | 715 |
| 245 | Ga0105243_12048742 | 3300009148 | Bacteria | 607 |
| 246 | Ga0105243_12330739 | 3300009148 | Bacteria | 573 |
| 247 | Ga0105241_10773668 | 3300009174 | Bacteria | 882 |
| 248 | Ga0105242_10028530 | 3300009176 | Bacteria | 4445 |
| 249 | Ga0105242_10126286 | 3300009176 | Bacteria | 2202 |
| 250 | Ga0105242_10915164 | 3300009176 | Bacteria | 878 |
| 251 | Ga0105242_13081227 | 3300009176 | Bacteria | 516 |
| 252 | Ga0105248_12284510 | 3300009177 | Bacteria | 616 |
| 253 | Ga0105237_11122493 | 3300009545 | Bacteria | 793 |
| 254 | Ga0105238_10052564 | 3300009551 | Bacteria | 4096 |
| 255 | Ga0105238_12076525 | 3300009551 | Bacteria | 602 |
| 256 | Ga0105238_12816528 | 3300009551 | Bacteria | 523 |
| 257 | Ga0105249_10325553 | 3300009553 | Bacteria | 1549 |
| 258 | Ga0105249_10427743 | 3300009553 | Bacteria | 1359 |
| 259 | Ga0105249_11156726 | 3300009553 | Bacteria | 844 |
| 260 | Ga0105249_12103459 | 3300009553 | Bacteria | 637 |
| 261 | Ga0105249_12963999 | 3300009553 | Unclassified | 545 |
| 262 | Ga0105033_127389 | 3300009986 | Bacteria | 524 |
| 263 | Ga0105239_11371255 | 3300010375 | Bacteria | 816 |
| 264 | Ga0105239_11511145 | 3300010375 | Bacteria | 776 |
| 265 | Ga0105239_12711056 | 3300010375 | Bacteria | 578 |
| 266 | Ga0105246_10503784 | 3300011119 | Bacteria | 1029 |
| 267 | Ga0105246_10574124 | 3300011119 | Bacteria | 970 |
| 268 | Ga0105246_11068936 | 3300011119 | Bacteria | 735 |
| 269 | Ga0105246_11204281 | 3300011119 | Bacteria | 697 |
| 270 | Ga0171462_1019 | 3300013250 | Bacteria | 146628 |
| 271 | Ga0157374_11751972 | 3300013296 | Bacteria | 646 |
| 272 | Ga0157378_10652755 | 3300013297 | Bacteria | 1068 |
| 273 | Ga0157378_10719677 | 3300013297 | Bacteria | 1019 |
| 274 | Ga0157378_11053755 | 3300013297 | Bacteria | 849 |
| 275 | Ga0157378_11626389 | 3300013297 | Bacteria | 692 |
| 276 | Ga0157378_11969916 | 3300013297 | Bacteria | 634 |
| 277 | Ga0163162_10264081 | 3300013306 | Bacteria | 1853 |
| 278 | Ga0163162_11388182 | 3300013306 | Bacteria | 799 |
| 279 | Ga0163162_11589783 | 3300013306 | Bacteria | 746 |
| 280 | Ga0157372_10265167 | 3300013307 | Bacteria | 1994 |
| 281 | Ga0157375_10095534 | 3300013308 | Bacteria | 3043 |
| 282 | Ga0157375_10613731 | 3300013308 | Bacteria | 1246 |
| 283 | Ga0157375_11647247 | 3300013308 | Bacteria | 759 |
| 284 | Ga0157375_12373474 | 3300013308 | Bacteria | 633 |
| 285 | Ga0163163_10274635 | 3300014325 | Bacteria | 1736 |
| 286 | Ga0163163_10376107 | 3300014325 | Bacteria | 1478 |
| 287 | Ga0163163_11554449 | 3300014325 | Bacteria | 723 |
| 288 | Ga0163163_11737403 | 3300014325 | Bacteria | 684 |
| 289 | Ga0163163_12943638 | 3300014325 | Bacteria | 531 |
| 290 | Ga0157380_10182965 | 3300014326 | Bacteria | 1843 |
| 291 | Ga0157380_10233581 | 3300014326 | Bacteria | 1653 |
| 292 | Ga0157380_10238944 | 3300014326 | Bacteria | 1637 |
| 293 | Ga0157380_10354008 | 3300014326 | Bacteria | 1375 |
| 294 | Ga0157380_10399625 | 3300014326 | Bacteria | 1303 |
| 295 | Ga0157380_10560860 | 3300014326 | Bacteria | 1122 |
| 296 | Ga0157380_11121781 | 3300014326 | Bacteria | 826 |
| 297 | Ga0157380_11350319 | 3300014326 | Bacteria | 762 |
| 298 | Ga0157377_10568648 | 3300014745 | Bacteria | 804 |
| 299 | Ga0157379_10257636 | 3300014968 | Bacteria | 1585 |
| 300 | Ga0157379_10689022 | 3300014968 | Bacteria | 959 |
| 301 | Ga0157379_10767813 | 3300014968 | Bacteria | 908 |
| 302 | Ga0157379_11487286 | 3300014968 | Bacteria | 658 |
| 303 | Ga0157379_12214182 | 3300014968 | Bacteria | 546 |
| 304 | Ga0157376_10218970 | 3300014969 | Bacteria | 1762 |
| 305 | Ga0157376_10528577 | 3300014969 | Bacteria | 1164 |
| 306 | Ga0163161_10239411 | 3300017792 | Bacteria | 1411 |
| 307 | Ga0163161_10556768 | 3300017792 | Bacteria | 940 |
| 308 | Ga0163161_10787817 | 3300017792 | Bacteria | 798 |
| 309 | Ga0163161_11150669 | 3300017792 | Bacteria | 669 |
| 310 | Ga0163161_11363935 | 3300017792 | Bacteria | 618 |
| 311 | Ga0163161_11417323 | 3300017792 | Bacteria | 607 |
| 312 | Ga0213873_10151259 | 3300021358 | Bacteria | 699 |
| 313 | Ga0213876_10016344 | 3300021384 | Bacteria | 3923 |
| 314 | Ga0209563_111903 | 3300025230 | Bacteria | 1209 |
| 315 | Ga0209130_1000902 | 3300025284 | Bacteria | 23951 |
| 316 | Ga0209025_1002026 | 3300025294 | Bacteria | 23125 |
| 317 | Ga0209564_1018758 | 3300025295 | Bacteria | 2620 |
| 318 | Ga0209758_1000217 | 3300025297 | Bacteria | 124619 |
| 319 | Ga0209758_1011197 | 3300025297 | Bacteria | 5232 |
| 320 | Ga0209758_1056197 | 3300025297 | Bacteria | 1331 |
| 321 | Ga0207426_1011624 | 3300025302 | Bacteria | 3342 |
| 322 | Ga0207697_10068546 | 3300025315 | Bacteria | 1484 |
| 323 | Ga0207697_10519618 | 3300025315 | Bacteria | 525 |
| 324 | Ga0207682_10004236 | 3300025893 | Bacteria | 6060 |
| 325 | Ga0207688_10108544 | 3300025901 | Bacteria | 1609 |
| 326 | Ga0207688_10238838 | 3300025901 | Bacteria | 1098 |
| 327 | Ga0207688_10274329 | 3300025901 | Bacteria | 1026 |
| 328 | Ga0207688_10381604 | 3300025901 | Bacteria | 872 |
| 329 | Ga0207680_10747833 | 3300025903 | Bacteria | 701 |
| 330 | Ga0207680_10763552 | 3300025903 | Bacteria | 693 |
| 331 | Ga0207647_10499691 | 3300025904 | Bacteria | 678 |
| 332 | Ga0207685_10036835 | 3300025905 | Bacteria | 1797 |
| 333 | Ga0207645_10158842 | 3300025907 | Bacteria | 1478 |
| 334 | Ga0207645_10902106 | 3300025907 | Bacteria | 600 |
| 335 | Ga0207643_10031625 | 3300025908 | Bacteria | 2951 |
| 336 | Ga0207643_10052375 | 3300025908 | Bacteria | 2318 |
| 337 | Ga0207705_10197107 | 3300025909 | Bacteria | 1525 |
| 338 | Ga0207705_10446602 | 3300025909 | Bacteria | 1002 |
| 339 | Ga0207707_11115763 | 3300025912 | Bacteria | 642 |
| 340 | Ga0207671_10909534 | 3300025914 | Bacteria | 695 |
| 341 | Ga0207693_10479360 | 3300025915 | Bacteria | 971 |
| 342 | Ga0207660_10033192 | 3300025917 | Bacteria | 3568 |
| 343 | Ga0207660_10159978 | 3300025917 | Bacteria | 1737 |
| 344 | Ga0207660_10526299 | 3300025917 | Bacteria | 960 |
| 345 | Ga0207662_10789813 | 3300025918 | Bacteria | 669 |
| 346 | Ga0207657_10036283 | 3300025919 | Bacteria | 4413 |
| 347 | Ga0207649_10812100 | 3300025920 | Bacteria | 730 |
| 348 | Ga0207649_10879712 | 3300025920 | Bacteria | 702 |
| 349 | Ga0207652_10087919 | 3300025921 | Bacteria | 2725 |
| 350 | Ga0207652_11013140 | 3300025921 | Bacteria | 729 |
| 351 | Ga0207681_10504468 | 3300025923 | Bacteria | 991 |
| 352 | Ga0207694_10034613 | 3300025924 | Bacteria | 3873 |
| 353 | Ga0207694_10785825 | 3300025924 | Bacteria | 804 |
| 354 | Ga0207650_10072997 | 3300025925 | Bacteria | 2584 |
| 355 | Ga0207650_10571018 | 3300025925 | Bacteria | 949 |
| 356 | Ga0207659_10194783 | 3300025926 | Bacteria | 1615 |
| 357 | Ga0207659_10248543 | 3300025926 | Bacteria | 1442 |
| 358 | Ga0207659_10427521 | 3300025926 | Bacteria | 1112 |
| 359 | Ga0207687_10073143 | 3300025927 | Bacteria | 2454 |
| 360 | Ga0207687_10082073 | 3300025927 | Bacteria | 2331 |
| 361 | Ga0207700_11057627 | 3300025928 | Bacteria | 726 |
| 362 | Ga0207664_10660810 | 3300025929 | Bacteria | 939 |
| 363 | Ga0207664_11041069 | 3300025929 | Bacteria | 733 |
| 364 | Ga0207644_10816364 | 3300025931 | Bacteria | 780 |
| 365 | Ga0207644_11353943 | 3300025931 | Bacteria | 598 |
| 366 | Ga0207690_10226205 | 3300025932 | Bacteria | 1434 |
| 367 | Ga0207690_10701773 | 3300025932 | Bacteria | 832 |
| 368 | Ga0207706_10193394 | 3300025933 | Bacteria | 1785 |
| 369 | Ga0207706_10687813 | 3300025933 | Bacteria | 874 |
| 370 | Ga0207686_10472432 | 3300025934 | Bacteria | 968 |
| 371 | Ga0207686_10507210 | 3300025934 | Bacteria | 937 |
| 372 | Ga0207686_10807081 | 3300025934 | Bacteria | 752 |
| 373 | Ga0207686_11402580 | 3300025934 | Bacteria | 575 |
| 374 | Ga0207709_10427329 | 3300025935 | Bacteria | 1019 |
| 375 | Ga0207709_11354802 | 3300025935 | Bacteria | 589 |
| 376 | Ga0207670_10261065 | 3300025936 | Bacteria | 1343 |
| 377 | Ga0207670_10513944 | 3300025936 | Bacteria | 974 |
| 378 | Ga0207670_10758267 | 3300025936 | Bacteria | 806 |
| 379 | Ga0207670_11510678 | 3300025936 | Bacteria | 571 |
| 380 | Ga0207669_10089327 | 3300025937 | Bacteria | 2001 |
| 381 | Ga0207669_10131129 | 3300025937 | Bacteria | 1722 |
| 382 | Ga0207669_10321847 | 3300025937 | Bacteria | 1184 |
| 383 | Ga0207669_10690468 | 3300025937 | Bacteria | 838 |
| 384 | Ga0207669_11084327 | 3300025937 | Bacteria | 675 |
| 385 | Ga0207669_11085933 | 3300025937 | Bacteria | 675 |
| 386 | Ga0207704_10081617 | 3300025938 | Bacteria | 2092 |
| 387 | Ga0207704_11935384 | 3300025938 | Bacteria | 507 |
| 388 | Ga0207665_10158317 | 3300025939 | Bacteria | 1627 |
| 389 | Ga0207665_11000299 | 3300025939 | Bacteria | 665 |
| 390 | Ga0207691_10000889 | 3300025940 | Bacteria | 29629 |
| 391 | Ga0207691_10211291 | 3300025940 | Bacteria | 1685 |
| 392 | Ga0207691_11454699 | 3300025940 | Bacteria | 561 |
| 393 | Ga0207711_10145410 | 3300025941 | Bacteria | 2136 |
| 394 | Ga0207689_10219148 | 3300025942 | Bacteria | 1572 |
| 395 | Ga0207689_11515400 | 3300025942 | Bacteria | 560 |
| 396 | Ga0207661_12089559 | 3300025944 | Bacteria | 512 |
| 397 | Ga0207679_10467741 | 3300025945 | Bacteria | 1120 |
| 398 | Ga0207679_11072224 | 3300025945 | Bacteria | 739 |
| 399 | Ga0207651_10088947 | 3300025960 | Bacteria | 2253 |
| 400 | Ga0207651_10120816 | 3300025960 | Bacteria | 1986 |
| 401 | Ga0207651_10276221 | 3300025960 | Bacteria | 1386 |
| 402 | Ga0207651_11039147 | 3300025960 | Bacteria | 733 |
| 403 | Ga0207712_10114548 | 3300025961 | Bacteria | 2028 |
| 404 | Ga0207712_10505893 | 3300025961 | Bacteria | 1033 |
| 405 | Ga0207712_10579609 | 3300025961 | Bacteria | 968 |
| 406 | Ga0207668_10130855 | 3300025972 | Bacteria | 1916 |
| 407 | Ga0207668_10177886 | 3300025972 | Bacteria | 1675 |
| 408 | Ga0207668_10807762 | 3300025972 | Bacteria | 831 |
| 409 | Ga0207668_10918208 | 3300025972 | Bacteria | 780 |
| 410 | Ga0207658_10097946 | 3300025986 | Bacteria | 2291 |
| 411 | Ga0207677_10360834 | 3300026023 | Bacteria | 1220 |
| 412 | Ga0207677_10377408 | 3300026023 | Bacteria | 1196 |
| 413 | Ga0207677_10992209 | 3300026023 | Bacteria | 761 |
| 414 | Ga0207677_11141255 | 3300026023 | Bacteria | 712 |
| 415 | Ga0207703_10470694 | 3300026035 | Bacteria | 1176 |
| 416 | Ga0207703_10472201 | 3300026035 | Bacteria | 1174 |
| 417 | Ga0207703_10801611 | 3300026035 | Bacteria | 899 |
| 418 | Ga0207639_10486751 | 3300026041 | Bacteria | 1125 |
| 419 | Ga0207639_11320472 | 3300026041 | Bacteria | 677 |
| 420 | Ga0207639_11752006 | 3300026041 | Bacteria | 582 |
| 421 | Ga0207678_10093158 | 3300026067 | Bacteria | 2574 |
| 422 | Ga0207678_10215433 | 3300026067 | Bacteria | 1643 |
| 423 | Ga0207708_10267660 | 3300026075 | Bacteria | 1381 |
| 424 | Ga0207708_10531335 | 3300026075 | Bacteria | 989 |
| 425 | Ga0207708_10568734 | 3300026075 | Bacteria | 957 |
| 426 | Ga0207708_10630715 | 3300026075 | Bacteria | 911 |
| 427 | Ga0207702_11029361 | 3300026078 | Bacteria | 817 |
| 428 | Ga0207702_11269118 | 3300026078 | Bacteria | 731 |
| 429 | Ga0207641_11200030 | 3300026088 | Bacteria | 758 |
| 430 | Ga0207648_10018063 | 3300026089 | Bacteria | 6389 |
| 431 | Ga0207648_11208915 | 3300026089 | Bacteria | 710 |
| 432 | Ga0207676_10077147 | 3300026095 | Bacteria | 2694 |
| 433 | Ga0207676_10714352 | 3300026095 | Bacteria | 972 |
| 434 | Ga0207674_10030080 | 3300026116 | Bacteria | 5713 |
| 435 | Ga0207674_10472557 | 3300026116 | Bacteria | 1212 |
| 436 | Ga0207675_100087107 | 3300026118 | Bacteria | 2933 |
| 437 | Ga0207675_100204833 | 3300026118 | Bacteria | 1896 |
| 438 | Ga0207675_100423784 | 3300026118 | Bacteria | 1315 |
| 439 | Ga0207675_102506247 | 3300026118 | Bacteria | 527 |
| 440 | Ga0207683_10010378 | 3300026121 | Bacteria | 7947 |
| 441 | Ga0207683_10013613 | 3300026121 | Bacteria | 6939 |
| 442 | Ga0207683_10247194 | 3300026121 | Bacteria | 1627 |
| 443 | Ga0207698_10459905 | 3300026142 | Bacteria | 1230 |
| 444 | Ga0207698_10881938 | 3300026142 | Bacteria | 901 |
| 445 | Ga0207698_12478612 | 3300026142 | Bacteria | 529 |
| 446 | Ga0209813_10161979 | 3300027866 | Bacteria | 808 |
| 447 | Ga0209813_10256961 | 3300027866 | Bacteria | 666 |
| 448 | Ga0207428_10017950 | 3300027907 | Bacteria | 6060 |
| 449 | Ga0207428_10040717 | 3300027907 | Bacteria | 3766 |
| 450 | Ga0207428_10110162 | 3300027907 | Bacteria | 2120 |
| 451 | Ga0268266_10207967 | 3300028379 | Bacteria | 1794 |
| 452 | Ga0268266_10969032 | 3300028379 | Bacteria | 823 |
| 453 | Ga0268266_11661538 | 3300028379 | Bacteria | 614 |
| 454 | Ga0268266_12309932 | 3300028379 | Bacteria | 509 |
| 455 | Ga0268265_10401654 | 3300028380 | Bacteria | 1267 |
| 456 | Ga0268265_11362447 | 3300028380 | Bacteria | 711 |
| 457 | Ga0268265_11911601 | 3300028380 | Bacteria | 600 |
| 458 | Ga0268265_12668205 | 3300028380 | Bacteria | 505 |
| 459 | Ga0268264_10227117 | 3300028381 | Bacteria | 1721 |
| 460 | Ga0268264_10433727 | 3300028381 | Bacteria | 1269 |
| 461 | Ga0307515_10091522 | 3300028794 | Bacteria | 3799 |
| 462 | Ga0265325_10000492 | 3300031241 | Bacteria | 28656 |
| 463 | Ga0265340_10038117 | 3300031247 | Bacteria | 2379 |
| 464 | Ga0265340_10076710 | 3300031247 | Bacteria | 1578 |
| 465 | Ga0265316_10048868 | 3300031344 | Bacteria | 3336 |
| 466 | Ga0265316_10092702 | 3300031344 | Bacteria | 2303 |
| 467 | Ga0307513_10021442 | 3300031456 | Bacteria | 7626 |
| 468 | Ga0307513_10248609 | 3300031456 | Bacteria | 1577 |
| 469 | Ga0307513_10369951 | 3300031456 | Bacteria | 1176 |
| 470 | Ga0307513_10618677 | 3300031456 | Bacteria | 791 |
| 471 | Ga0307509_10815100 | 3300031507 | Bacteria | 598 |
| 472 | Ga0307408_100903089 | 3300031548 | Bacteria | 809 |
| 473 | Ga0265342_10057614 | 3300031712 | Bacteria | 2299 |
| 474 | Ga0307405_11152041 | 3300031731 | Bacteria | 669 |
| 475 | Ga0307405_11411564 | 3300031731 | Bacteria | 609 |
| 476 | Ga0307406_10154832 | 3300031901 | Bacteria | 1640 |
| 477 | Ga0307406_10458211 | 3300031901 | Bacteria | 1025 |
| 478 | Ga0307412_11666693 | 3300031911 | Bacteria | 584 |
| 479 | Ga0307412_11688076 | 3300031911 | Bacteria | 580 |
| 480 | Ga0307412_11793923 | 3300031911 | Bacteria | 564 |
| 481 | Ga0307412_12308429 | 3300031911 | Bacteria | 502 |
| 482 | Ga0307409_100454418 | 3300031995 | Bacteria | 1237 |
| 483 | Ga0307409_100628485 | 3300031995 | Bacteria | 1065 |
| 484 | Ga0307409_101353277 | 3300031995 | Bacteria | 738 |
| 485 | Ga0307416_100733300 | 3300032002 | Bacteria | 1080 |
| 486 | Ga0307411_11355194 | 3300032005 | Bacteria | 650 |
| 487 | Ga0307415_100052547 | 3300032126 | Bacteria | 2772 |
| 488 | Ga0307415_102467610 | 3300032126 | Bacteria | 512 |
| 489 | Ga0373950_0028275 | 3300034818 | Bacteria | 1027 |
| 490 | Ga0373958_0094967 | 3300034819 | Bacteria | 692 |
| 491 | Ga0373928_0012494 | 3300035084 | Bacteria | 1694 |
| 492 | Ga0373928_0242371 | 3300035084 | Unclassified | 534 |
| 493 | Ga0373940_0002719 | 3300035088 | Bacteria | 3493 |
| 494 | Ga0373949_0024472 | 3300035090 | Bacteria | 1404 |
| 495 | Ga0373949_0048777 | 3300035090 | Bacteria | 1062 |
| 496 | Ga0373960_0335040 | 3300035121 | Bacteria | 570 |
| 497 | Ga0373942_0067068 | 3300035207 | Bacteria | 1040 |
| 498 | Ga0316574_0241910 | 3300035398 | Bacteria | 1154 |
| 499 | Ga0373931_0455752 | 3300035691 | Bacteria | 819 |
| 500 | Ga0373931_0612353 | 3300035691 | Bacteria | 713 |
| 501 | Ga0395898_1138396 | 3300037466 | Bacteria | 713 |
| 502 | Ga0395905_0571708 | 3300037471 | Bacteria | 1032 |
| 503 | Ga0237816_08265 | 3300039145 | Bacteria | 640 |
| 504 | Ga0436365_0755682 | 3300039437 | Bacteria | 1128 |
| 505 | Ga0436365_1027753 | 3300039437 | Bacteria | 677 |
| 506 | Ga0436365_1252986 | 3300039437 | Bacteria | 961 |
| 507 | Ga0436365_1289747 | 3300039437 | Bacteria | 769 |
| 508 | Ga0436365_1651064 | 3300039437 | Bacteria | 4965 |
| 509 | Ga0436365_1890676 | 3300039437 | Bacteria | 7132 |
| 510 | Ga0436360_1181788 | 3300039438 | Bacteria | 819 |
| 511 | Ga0436362_0604495 | 3300039453 | Bacteria | 1329 |
| 512 | Ga0439439_0235279 | 3300041406 | Bacteria | 540 |
| 513 | Ga0439453_0016915 | 3300041408 | Bacteria | 1276 |
| 514 | Ga0439453_0027963 | 3300041408 | Bacteria | 1053 |
| 515 | Ga0439453_0039775 | 3300041408 | Bacteria | 918 |
| 516 | Ga0439461_0071616 | 3300041410 | Bacteria | 804 |
| 517 | Ga0451789_0411068 | 3300041443 | Bacteria | 1418 |
| 518 | Ga0451791_0426884 | 3300041451 | Bacteria | 524 |
| 519 | Ga0451797_0687038 | 3300041453 | Bacteria | 778 |
| 520 | Ga0451839_1270928 | 3300041496 | Bacteria | 651 |
| 521 | Ga0451841_0805672 | 3300041498 | Bacteria | 661 |
| 522 | Ga0451843_0255968 | 3300041509 | Bacteria | 666 |
| 523 | Ga0451843_0427283 | 3300041509 | Bacteria | 507 |
| 524 | Ga0451853_3383827 | 3300041512 | Bacteria | 572 |
| 525 | Ga0439441_008039 | 3300042001 | Bacteria | 1715 |
| 526 | Ga0439441_130143 | 3300042001 | Bacteria | 582 |
| 527 | Ga0439443_028971 | 3300042003 | Bacteria | 905 |
| 528 | Ga0439446_0027497 | 3300042156 | Bacteria | 1633 |
| 529 | Ga0439434_0212964 | 3300042435 | Bacteria | 654 |
| 530 | Ga0439435_0019364 | 3300042436 | Bacteria | 1743 |
| 531 | Ga0439444_0016539 | 3300042437 | Bacteria | 1258 |
| 532 | Ga0439464_0056449 | 3300042439 | Bacteria | 1144 |
| 533 | Ga0439440_0027727 | 3300042993 | Bacteria | 1318 |
| 534 | Ga0466967_0234889 | 3300045976 | Bacteria | 1747 |
| 535 | Ga0495603_0281648 | 3300046455 | Bacteria | 956 |
| 536 | Ga0495629_0947594 | 3300046459 | Bacteria | 562 |
| 537 | Ga0495638_0001856 | 3300046460 | Bacteria | 18277 |
| 538 | Ga0495638_0017590 | 3300046460 | Bacteria | 4763 |
| 539 | Ga0495638_0050217 | 3300046460 | Bacteria | 2605 |
| 540 | Ga0495605_0143411 | 3300046474 | Bacteria | 1070 |
| 541 | Ga0495664_0345171 | 3300046477 | Bacteria | 897 |
| 542 | Ga0495584_0489114 | 3300046491 | Bacteria | 627 |
| 543 | Ga0495596_0332611 | 3300046500 | Bacteria | 591 |
| 544 | Ga0495607_0031262 | 3300046501 | Bacteria | 3260 |
| 545 | Ga0495606_0063802 | 3300046507 | Bacteria | 2347 |
| 546 | Ga0495608_0213092 | 3300046511 | Bacteria | 1214 |
| 547 | Ga0495616_0040932 | 3300046513 | Bacteria | 2366 |
| 548 | Ga0495618_0764146 | 3300046514 | Bacteria | 565 |
| 549 | Ga0495620_0129614 | 3300046515 | Bacteria | 990 |
| 550 | Ga0495620_0187261 | 3300046515 | Bacteria | 799 |
| 551 | Ga0495631_0286363 | 3300046518 | Bacteria | 701 |
| 552 | Ga0495632_0500947 | 3300046519 | Bacteria | 524 |
| 553 | Ga0495637_0180815 | 3300046520 | Bacteria | 782 |
| 554 | Ga0495643_0088042 | 3300046522 | Bacteria | 1606 |
| 555 | Ga0495648_0000859 | 3300046524 | Bacteria | 32055 |
| 556 | Ga0495663_0117853 | 3300046525 | Bacteria | 887 |
| 557 | Ga0495654_0456257 | 3300046530 | Bacteria | 502 |
| 558 | Ga0495598_0025940 | 3300046537 | Bacteria | 1602 |
| 559 | Ga0495597_0075048 | 3300046542 | Bacteria | 1452 |
| 560 | Ga0495622_0021150 | 3300046557 | Bacteria | 3031 |
| 561 | Ga0495667_0059393 | 3300046559 | Bacteria | 2510 |
| 562 | Ga0495656_0008096 | 3300046615 | Bacteria | 3742 |
| 563 | Ga0495668_0521141 | 3300046616 | Bacteria | 655 |
| 564 | Ga0495668_0834524 | 3300046616 | Bacteria | 511 |
| 565 | Ga0495611_0220783 | 3300046648 | Bacteria | 882 |
| 566 | Ga0495625_0199459 | 3300046660 | Bacteria | 1321 |
| 567 | Ga0495625_0794855 | 3300046660 | Bacteria | 551 |
| 568 | Ga0495661_0037786 | 3300046665 | Bacteria | 3012 |
| 569 | Ga0495670_0117268 | 3300046691 | Bacteria | 1381 |
| 570 | Ga0495671_0033442 | 3300046692 | Bacteria | 2619 |
| 571 | Ga0495660_0027480 | 3300046810 | Bacteria | 3219 |
| 572 | Ga0495581_0765410 | 3300047315 | Bacteria | 555 |
| 573 | Ga0495636_0142587 | 3300047318 | Bacteria | 1071 |
| 574 | Ga0495672_0075809 | 3300047320 | Bacteria | 1890 |
| 575 | Ga0495673_0215055 | 3300047469 | Bacteria | 714 |
| 576 | Ga0495673_0297914 | 3300047469 | Bacteria | 579 |
| 577 | Ga0495686_0144734 | 3300047472 | Bacteria | 1400 |
| 578 | Ga0495686_0452624 | 3300047472 | Bacteria | 682 |
| 579 | Ga0495615_0120012 | 3300048090 | Bacteria | 760 |
| 580 | Ga0495626_0022268 | 3300048091 | Bacteria | 3131 |
| 581 | Ga0496100_0032369 | 3300048903 | Bacteria | 3261 |
| 582 | Ga0496100_0212125 | 3300048903 | Bacteria | 1417 |
| 583 | Ga0496100_0412854 | 3300048903 | Bacteria | 1030 |
| 584 | Ga0496100_0756373 | 3300048903 | Bacteria | 760 |
| 585 | Ga0496100_1478921 | 3300048903 | Bacteria | 536 |
| 586 | Ga0496101_0379805 | 3300048904 | Bacteria | 1112 |
| 587 | Ga0496101_0702501 | 3300048904 | Unclassified | 798 |
| 588 | Ga0496102_0183530 | 3300048905 | Bacteria | 1971 |
| 589 | Ga0496102_0317457 | 3300048905 | Bacteria | 1468 |
| 590 | Ga0496104_0002236 | 3300048907 | Bacteria | 16698 |
| 591 | Ga0496104_0015358 | 3300048907 | Bacteria | 6934 |
| 592 | Ga0496104_0224291 | 3300048907 | Bacteria | 1791 |
| 593 | Ga0496105_0007126 | 3300048908 | Bacteria | 8625 |
| 594 | Ga0496105_0087197 | 3300048908 | Bacteria | 2579 |
| 595 | Ga0496106_0063854 | 3300048909 | Bacteria | 2800 |
| 596 | Ga0496106_0316621 | 3300048909 | Bacteria | 1252 |
| 597 | Ga0496106_1517416 | 3300048909 | Bacteria | 515 |
| 598 | Ga0496107_0095771 | 3300048910 | Bacteria | 2172 |
| 599 | Ga0496107_0617356 | 3300048910 | Bacteria | 801 |
| 600 | Ga0496108_0106953 | 3300048911 | Bacteria | 2389 |
| 601 | Ga0496108_0259668 | 3300048911 | Bacteria | 1512 |
| 602 | Ga0496109_0109600 | 3300048912 | Bacteria | 2567 |
| 603 | Ga0496109_0375569 | 3300048912 | Bacteria | 1343 |
| 604 | Ga0496109_0592422 | 3300048912 | Bacteria | 1045 |
| 605 | Ga0496110_0395208 | 3300048913 | Bacteria | 1260 |
| 606 | Ga0496110_0621744 | 3300048913 | Bacteria | 979 |
| 607 | Ga0496110_0638454 | 3300048913 | Bacteria | 964 |
| 608 | Ga0496110_1517974 | 3300048913 | Bacteria | 580 |
| 609 | Ga0496112_0231140 | 3300048915 | Bacteria | 1804 |
| 610 | Ga0496112_0356470 | 3300048915 | Bacteria | 1405 |
| 611 | Ga0496112_1385053 | 3300048915 | Bacteria | 618 |
| 612 | Ga0496112_1872157 | 3300048915 | Bacteria | 511 |
| 613 | Ga0496113_0148934 | 3300048916 | Bacteria | 1845 |
| 614 | Ga0496113_0319178 | 3300048916 | Bacteria | 1245 |
| 615 | Ga0496114_0044139 | 3300048917 | Bacteria | 3698 |
| 616 | Ga0496114_0830785 | 3300048917 | Bacteria | 803 |
| 617 | Ga0496114_1328837 | 3300048917 | Bacteria | 606 |
| 618 | Ga0496114_1583171 | 3300048917 | Bacteria | 543 |
| 619 | Ga0496115_0010124 | 3300048918 | Bacteria | 7034 |
| 620 | Ga0496115_0042092 | 3300048918 | Bacteria | 3638 |
| 621 | Ga0496115_0164982 | 3300048918 | Bacteria | 1832 |
| 622 | Ga0496116_0023936 | 3300048919 | Bacteria | 4531 |
| 623 | Ga0496117_0102747 | 3300048920 | Bacteria | 1803 |
| 624 | Ga0496118_0136476 | 3300048921 | Bacteria | 1564 |
| 625 | Ga0496119_0057075 | 3300048922 | Bacteria | 2362 |
| 626 | Ga0496120_0066692 | 3300048923 | Bacteria | 1990 |
| 627 | Ga0496121_0001090 | 3300048924 | Bacteria | 47969 |
| 628 | Ga0496121_0026263 | 3300048924 | Bacteria | 5493 |
| 629 | Ga0496121_0150509 | 3300048924 | Bacteria | 1713 |
| 630 | Ga0496122_0007688 | 3300048925 | Bacteria | 11882 |
| 631 | Ga0496122_0543093 | 3300048925 | Bacteria | 555 |
| 632 | Ga0496123_0186955 | 3300048926 | Bacteria | 1075 |
| 633 | Ga0496123_0276748 | 3300048926 | Bacteria | 813 |
| 634 | Ga0496124_0335945 | 3300048927 | Bacteria | 1075 |
| 635 | Ga0496124_0639814 | 3300048927 | Bacteria | 685 |
| 636 | Ga0496124_0893368 | 3300048927 | Bacteria | 540 |
| 637 | Ga0496125_0000252 | 3300048928 | Bacteria | 109988 |
| 638 | Ga0496125_0000566 | 3300048928 | Bacteria | 63595 |
| 639 | Ga0496125_0001454 | 3300048928 | Bacteria | 34388 |
| 640 | Ga0496125_0143619 | 3300048928 | Bacteria | 1654 |
| 641 | Ga0496126_0072197 | 3300048929 | Bacteria | 3070 |
| 642 | Ga0496126_0074628 | 3300048929 | Bacteria | 3011 |
| 643 | Ga0496126_0293370 | 3300048929 | Bacteria | 1344 |
| 644 | Ga0495678_050712 | 3300049459 | Bacteria | 1607 |
| 645 | Ga0501031_0213233 | 3300049568 | Bacteria | 1258 |
| 646 | Ga0501031_0350544 | 3300049568 | Bacteria | 956 |
| 647 | Ga0501032_0022475 | 3300049569 | Bacteria | 4370 |
| 648 | Ga0501032_0362429 | 3300049569 | Bacteria | 933 |
| 649 | Ga0501032_0971569 | 3300049569 | Bacteria | 534 |
| 650 | Ga0501033_0034246 | 3300049570 | Bacteria | 3811 |
| 651 | Ga0501033_0051505 | 3300049570 | Bacteria | 3051 |
| 652 | Ga0501033_0229197 | 3300049570 | Bacteria | 1320 |
| 653 | Ga0501033_0266530 | 3300049570 | Bacteria | 1211 |
| 654 | Ga0501033_0766753 | 3300049570 | Unclassified | 654 |
| 655 | Ga0501034_0091478 | 3300049571 | Bacteria | 3040 |
| 656 | Ga0501034_0187416 | 3300049571 | Bacteria | 2032 |
| 657 | Ga0501034_0189550 | 3300049571 | Bacteria | 2019 |
| 658 | Ga0501034_0219409 | 3300049571 | Bacteria | 1854 |
| 659 | Ga0501034_0229221 | 3300049571 | Bacteria | 1807 |
| 660 | Ga0501034_0679670 | 3300049571 | Bacteria | 929 |
| 661 | Ga0501034_1259757 | 3300049571 | Bacteria | 617 |
| 662 | Ga0501036_0072422 | 3300049572 | Bacteria | 2912 |
| 663 | Ga0501036_0203548 | 3300049572 | Bacteria | 1665 |
| 664 | Ga0501036_0420616 | 3300049572 | Bacteria | 1114 |
| 665 | Ga0501036_0449920 | 3300049572 | Bacteria | 1073 |
| 666 | Ga0501036_1341745 | 3300049572 | Bacteria | 581 |
| 667 | Ga0501036_1364045 | 3300049572 | Bacteria | 575 |
| 668 | Ga0501036_1644588 | 3300049572 | Bacteria | 518 |
| 669 | Ga0501037_0003013 | 3300049573 | Bacteria | 12234 |
| 670 | Ga0501037_0298615 | 3300049573 | Bacteria | 1119 |
| 671 | Ga0501037_0490042 | 3300049573 | Bacteria | 835 |
| 672 | Ga0501038_0040986 | 3300049574 | Bacteria | 4040 |
| 673 | Ga0501038_0123626 | 3300049574 | Bacteria | 2131 |
| 674 | Ga0501038_0530526 | 3300049574 | Bacteria | 897 |
| 675 | Ga0501038_1235850 | 3300049574 | Unclassified | 541 |
| 676 | Ga0501038_1262943 | 3300049574 | Bacteria | 534 |
| 677 | Ga0501039_0012604 | 3300049575 | Bacteria | 6461 |
| 678 | Ga0501039_0093853 | 3300049575 | Bacteria | 2339 |
| 679 | Ga0501039_0165302 | 3300049575 | Bacteria | 1740 |
| 680 | Ga0501040_0411503 | 3300049576 | Bacteria | 972 |
| 681 | Ga0501040_1164593 | 3300049576 | Bacteria | 559 |
| 682 | Ga0501041_0401512 | 3300049577 | Bacteria | 868 |
| 683 | Ga0501041_0638323 | 3300049577 | Bacteria | 680 |
| 684 | Ga0501042_0045932 | 3300049578 | Bacteria | 3113 |
| 685 | Ga0501042_0167681 | 3300049578 | Bacteria | 1584 |
| 686 | Ga0501043_0132534 | 3300049579 | Bacteria | 1953 |
| 687 | Ga0501043_0190807 | 3300049579 | Bacteria | 1593 |
| 688 | Ga0501043_0255513 | 3300049579 | Bacteria | 1349 |
| 689 | Ga0501043_0621027 | 3300049579 | Bacteria | 796 |
| 690 | Ga0501046_0035916 | 3300049580 | Bacteria | 3991 |
| 691 | Ga0501046_0073172 | 3300049580 | Bacteria | 2660 |
| 692 | Ga0501046_0096383 | 3300049580 | Bacteria | 2272 |
| 693 | Ga0501046_0998962 | 3300049580 | Unclassified | 581 |
| 694 | Ga0501047_0136974 | 3300049581 | Bacteria | 2328 |
| 695 | Ga0501047_0162134 | 3300049581 | Bacteria | 2107 |
| 696 | Ga0501047_0353517 | 3300049581 | Bacteria | 1306 |
| 697 | Ga0501047_0394931 | 3300049581 | Bacteria | 1216 |
| 698 | Ga0501047_1132811 | 3300049581 | Bacteria | 596 |
| 699 | Ga0501048_0020394 | 3300049582 | Bacteria | 4857 |
| 700 | Ga0501048_0146814 | 3300049582 | Bacteria | 1668 |
| 701 | Ga0501048_0592618 | 3300049582 | Bacteria | 796 |
| 702 | Ga0501067_0036698 | 3300049583 | Bacteria | 2721 |
| 703 | Ga0501067_0056276 | 3300049583 | Bacteria | 2179 |
| 704 | Ga0501067_0111752 | 3300049583 | Bacteria | 1519 |
| 705 | Ga0501068_0151513 | 3300049584 | Bacteria | 1457 |
| 706 | Ga0501069_0112454 | 3300049585 | Bacteria | 1551 |
| 707 | Ga0501070_0009260 | 3300049586 | Bacteria | 8330 |
| 708 | Ga0501070_0172082 | 3300049586 | Bacteria | 1783 |
| 709 | Ga0501070_0793749 | 3300049586 | Bacteria | 744 |
| 710 | Ga0501071_0078678 | 3300049587 | Bacteria | 2410 |
| 711 | Ga0501071_0116039 | 3300049587 | Bacteria | 1982 |
| 712 | Ga0501071_0188311 | 3300049587 | Bacteria | 1547 |
| 713 | Ga0501071_0627853 | 3300049587 | Bacteria | 826 |
| 714 | Ga0501071_1125318 | 3300049587 | Bacteria | 607 |
| 715 | Ga0501072_0005240 | 3300049588 | Bacteria | 9870 |
| 716 | Ga0501072_0192649 | 3300049588 | Bacteria | 1626 |
| 717 | Ga0501072_0514449 | 3300049588 | Bacteria | 946 |
| 718 | Ga0501073_0029808 | 3300049589 | Bacteria | 3898 |
| 719 | Ga0501073_0282529 | 3300049589 | Bacteria | 1145 |
| 720 | Ga0501073_0591350 | 3300049589 | Bacteria | 767 |
| 721 | Ga0501074_0155885 | 3300049590 | Bacteria | 1631 |
| 722 | Ga0501074_0678135 | 3300049590 | Bacteria | 728 |
| 723 | Ga0501075_0165221 | 3300049591 | Bacteria | 1689 |
| 724 | Ga0501075_0417884 | 3300049591 | Bacteria | 1022 |
| 725 | Ga0501075_0536198 | 3300049591 | Bacteria | 893 |
| 726 | Ga0501075_0909463 | 3300049591 | Bacteria | 669 |
| 727 | Ga0501076_0157801 | 3300049592 | Bacteria | 1847 |
| 728 | Ga0501076_0222639 | 3300049592 | Bacteria | 1542 |
| 729 | Ga0501076_0226131 | 3300049592 | Bacteria | 1529 |
| 730 | Ga0501076_1355418 | 3300049592 | Bacteria | 585 |
| 731 | Ga0501077_0092185 | 3300049593 | Bacteria | 1920 |
| 732 | Ga0501077_0654797 | 3300049593 | Bacteria | 675 |
| 733 | Ga0501077_0678480 | 3300049593 | Bacteria | 662 |
| 734 | Ga0501077_1005037 | 3300049593 | Bacteria | 537 |
| 735 | Ga0501077_1120002 | 3300049593 | Bacteria | 507 |
| 736 | Ga0501079_0052864 | 3300049741 | Bacteria | 3134 |
| 737 | Ga0501079_0208242 | 3300049741 | Bacteria | 1527 |
| 738 | Ga0501079_0510527 | 3300049741 | Bacteria | 945 |
| 739 | Ga0501079_0665487 | 3300049741 | Bacteria | 820 |
| 740 | Ga0501080_0020013 | 3300049742 | Bacteria | 6195 |
| 741 | Ga0501080_0073111 | 3300049742 | Bacteria | 3190 |
| 742 | Ga0501080_0108802 | 3300049742 | Bacteria | 2569 |
| 743 | Ga0501080_0230623 | 3300049742 | Bacteria | 1692 |
| 744 | Ga0501080_0479701 | 3300049742 | Bacteria | 1113 |
| 745 | Ga0501080_0815371 | 3300049742 | Bacteria | 818 |
| 746 | Ga0501080_1644127 | 3300049742 | Bacteria | 543 |
| 747 | Ga0501081_0140554 | 3300049743 | Bacteria | 1730 |
| 748 | Ga0501081_0264421 | 3300049743 | Bacteria | 1257 |
| 749 | Ga0501081_0314230 | 3300049743 | Bacteria | 1151 |
| 750 | Ga0501081_0704708 | 3300049743 | Bacteria | 758 |
| 751 | Ga0501081_1121583 | 3300049743 | Bacteria | 595 |
| 752 | Ga0501081_1520025 | 3300049743 | Bacteria | 509 |
| 753 | Ga0501083_0017239 | 3300049744 | Bacteria | 5035 |
| 754 | Ga0501083_0098118 | 3300049744 | Bacteria | 1933 |
| 755 | Ga0501035_0019125 | 3300049822 | Bacteria | 6305 |
| 756 | Ga0501035_0280386 | 3300049822 | Bacteria | 1408 |
| 757 | Ga0501035_0507264 | 3300049822 | Bacteria | 992 |
| 758 | Ga0501035_0809646 | 3300049822 | Bacteria | 748 |
| 759 | Ga0501044_0000140 | 3300049823 | Bacteria | 88672 |
| 760 | Ga0501044_0075920 | 3300049823 | Bacteria | 3412 |
| 761 | Ga0501044_0140214 | 3300049823 | Bacteria | 2406 |
| 762 | Ga0501044_0497508 | 3300049823 | Bacteria | 1121 |
| 763 | Ga0501044_0644155 | 3300049823 | Bacteria | 949 |
| 764 | Ga0501044_0846933 | 3300049823 | Bacteria | 791 |
| 765 | Ga0501044_1344427 | 3300049823 | Bacteria | 580 |
| 766 | Ga0501045_0022475 | 3300049824 | Bacteria | 4517 |
| 767 | Ga0501045_0371757 | 3300049824 | Bacteria | 1064 |
| 768 | Ga0501045_0528106 | 3300049824 | Bacteria | 876 |
| 769 | nmdc:mga03683_100192_c1 | 3300050489 | Bacteria | 820 |
| 770 | nmdc:mga03683_220442_c1 | 3300050489 | Bacteria | 875 |
| 771 | nmdc:mga03683_589135_c1 | 3300050489 | Bacteria | 544 |
| 772 | nmdc:mga03683_82153_c1 | 3300050489 | Bacteria | 1048 |
| 773 | nmdc:mga03n38_140041_c1 | 3300050490 | Bacteria | 1207 |
| 774 | nmdc:mga03n38_202881_c1 | 3300050490 | Bacteria | 1027 |
| 775 | nmdc:mga03n38_36002_c1 | 3300050490 | Bacteria | 2125 |
| 776 | nmdc:mga03n38_525051_c1 | 3300050490 | Bacteria | 667 |
| 777 | nmdc:mga03n38_571265_c1 | 3300050490 | Bacteria | 641 |
| 778 | nmdc:mga00v17_19035_c1 | 3300050491 | Bacteria | 3912 |
| 779 | nmdc:mga00v17_206029_c1 | 3300050491 | Bacteria | 1272 |
| 780 | nmdc:mga0yw44_10125_c1 | 3300050492 | Bacteria | 4803 |
| 781 | nmdc:mga0yw44_475714_c1 | 3300050492 | Bacteria | 847 |
| 782 | nmdc:mga0yw44_504944_c1 | 3300050492 | Bacteria | 821 |
| 783 | nmdc:mga0yw44_524966_c1 | 3300050492 | Bacteria | 804 |
| 784 | nmdc:mga0k408_244099_c1 | 3300050493 | Bacteria | 1072 |
| 785 | nmdc:mga0k408_275244_c1 | 3300050493 | Bacteria | 1005 |
| 786 | nmdc:mga0k408_279892_c1 | 3300050493 | Bacteria | 996 |
| 787 | nmdc:mga0k408_323835_c1 | 3300050493 | Bacteria | 920 |
| 788 | nmdc:mga0k408_378226_c1 | 3300050493 | Unclassified | 504 |
| 789 | nmdc:mga0k408_408468_c1 | 3300050493 | Bacteria | 808 |
| 790 | nmdc:mga0k408_49335_c1 | 3300050493 | Bacteria | 2436 |
| 791 | nmdc:mga0k408_578242_c1 | 3300050493 | Bacteria | 663 |
| 792 | nmdc:mga06z11_138845_c1 | 3300050494 | Bacteria | 1372 |
| 793 | nmdc:mga06z11_25779_c1 | 3300050494 | Bacteria | 2790 |
| 794 | nmdc:mga06z11_2909_c1 | 3300050494 | Bacteria | 6586 |
| 795 | nmdc:mga06z11_297300_c1 | 3300050494 | Bacteria | 959 |
| 796 | nmdc:mga06z11_31578_c1 | 3300050494 | Bacteria | 2575 |
| 797 | nmdc:mga06z11_39657_c1 | 3300050494 | Bacteria | 2345 |
| 798 | nmdc:mga06z11_864954_c1 | 3300050494 | Bacteria | 551 |
| 799 | nmdc:mga07m45_33970_c1 | 3300050496 | Bacteria | 1911 |
| 800 | nmdc:mga07m45_404620_c1 | 3300050496 | Bacteria | 792 |
| 801 | nmdc:mga07m45_735512_c1 | 3300050496 | Bacteria | 567 |
| 802 | nmdc:mga05p37_457236_c1 | 3300050507 | Bacteria | 1476 |
| 803 | nmdc:mga05p37_487479_c1 | 3300050507 | Bacteria | 1418 |
| 804 | nmdc:mga05p37_609342_c1 | 3300050507 | Bacteria | 1231 |
| 805 | nmdc:mga05p37_842213_c1 | 3300050507 | Bacteria | 997 |
| 806 | nmdc:mga09592_1015526_c1 | 3300050508 | Bacteria | 693 |
| 807 | nmdc:mga09592_1416295_c1 | 3300050508 | Unclassified | 568 |
| 808 | nmdc:mga09592_1441015_c1 | 3300050508 | Bacteria | 562 |
| 809 | nmdc:mga09592_382835_c1 | 3300050508 | Bacteria | 1216 |
| 810 | nmdc:mga0qj67_291231_c1 | 3300050509 | Bacteria | 1323 |
| 811 | nmdc:mga0qj67_688613_c1 | 3300050509 | Bacteria | 814 |
| 812 | nmdc:mga0qj67_845669_c1 | 3300050509 | Bacteria | 723 |
| 813 | nmdc:mga0qj67_877448_c1 | 3300050509 | Bacteria | 708 |
| 814 | nmdc:mga06r32_300842_c1 | 3300050510 | Bacteria | 1590 |
| 815 | nmdc:mga06r32_43346_c1 | 3300050510 | Bacteria | 4281 |
| 816 | nmdc:mga06r32_537571_c1 | 3300050510 | Bacteria | 1144 |
| 817 | nmdc:mga08y16_1308470_c1 | 3300050511 | Bacteria | 691 |
| 818 | nmdc:mga08y16_161308_c1 | 3300050511 | Bacteria | 2330 |
| 819 | nmdc:mga08y16_597145_c1 | 3300050511 | Bacteria | 1113 |
| 820 | nmdc:mga08y16_63829_c1 | 3300050511 | Bacteria | 3847 |
| 821 | nmdc:mga08y16_700921_c1 | 3300050511 | Bacteria | 1012 |
| 822 | nmdc:mga0n895_1633_c1 | 3300050512 | Bacteria | 16940 |
| 823 | nmdc:mga0a205_155568_c2 | 3300050515 | Bacteria | 1651 |
| 824 | nmdc:mga0sz30_15111_c1 | 3300050516 | Bacteria | 3049 |
| 825 | nmdc:mga0sz30_336856_c1 | 3300050516 | Bacteria | 674 |
| 826 | nmdc:mga0sz30_51680_c1 | 3300050516 | Bacteria | 1744 |
| 827 | Ga0500610_0280170 | 3300053079 | Bacteria | 748 |
| 828 | Ga0500578_0160559 | 3300053086 | Bacteria | 1395 |
| 829 | Ga0500643_027127 | 3300053087 | Bacteria | 1784 |
| 830 | Ga0500644_0048130 | 3300053088 | Bacteria | 1449 |
| 831 | Ga0500646_0016648 | 3300053090 | Bacteria | 1921 |
| 832 | Ga0500651_0021060 | 3300053093 | Bacteria | 4063 |
| 833 | Ga0500651_0026933 | 3300053093 | Bacteria | 3614 |
| 834 | Ga0500566_0004029 | 3300053094 | Bacteria | 8763 |
| 835 | Ga0500641_0002417 | 3300053096 | Bacteria | 6629 |
| 836 | Ga0500641_0026924 | 3300053096 | Bacteria | 2236 |
| 837 | Ga0500641_0293434 | 3300053096 | Bacteria | 670 |
| 838 | Ga0500650_0000130 | 3300053098 | Bacteria | 19817 |
| 839 | Ga0500650_0182263 | 3300053098 | Bacteria | 962 |
| 840 | Ga0500556_0000066 | 3300053104 | Bacteria | 105850 |
| 841 | Ga0500562_037640 | 3300053108 | Bacteria | 1284 |
| 842 | Ga0500562_044858 | 3300053108 | Bacteria | 1178 |
| 843 | Ga0500592_002474 | 3300053116 | Bacteria | 2977 |
| 844 | Ga0500593_014188 | 3300053117 | Bacteria | 3413 |
| 845 | Ga0500595_001089 | 3300053119 | Bacteria | 15076 |
| 846 | Ga0500595_003717 | 3300053119 | Bacteria | 7039 |
| 847 | Ga0500595_013828 | 3300053119 | Bacteria | 3081 |
| 848 | Ga0500595_043501 | 3300053119 | Bacteria | 1429 |
| 849 | Ga0500607_071651 | 3300053121 | Bacteria | 1788 |
| 850 | Ga0500608_131224 | 3300053122 | Bacteria | 1123 |
| 851 | Ga0500608_237218 | 3300053122 | Bacteria | 722 |
| 852 | Ga0500608_277028 | 3300053122 | Bacteria | 637 |
| 853 | Ga0500618_048912 | 3300053125 | Bacteria | 960 |
| 854 | Ga0500642_0000072 | 3300053130 | Bacteria | 55645 |
| 855 | Ga0500642_0107110 | 3300053130 | Bacteria | 1303 |
| 856 | Ga0500642_0169441 | 3300053130 | Bacteria | 1022 |
| 857 | Ga0500652_001780 | 3300053131 | Bacteria | 6527 |
| 858 | Ga0500652_144336 | 3300053131 | Bacteria | 990 |
| 859 | Ga0500559_0000413 | 3300053136 | Bacteria | 30711 |
| 860 | Ga0500568_0000453 | 3300053139 | Bacteria | 30769 |
| 861 | Ga0500568_0049035 | 3300053139 | Bacteria | 1667 |
| 862 | Ga0500568_0174483 | 3300053139 | Bacteria | 791 |
| 863 | Ga0500577_0521560 | 3300053142 | Bacteria | 519 |
| 864 | Ga0500586_003954 | 3300053145 | Bacteria | 3566 |
| 865 | Ga0500588_0301048 | 3300053146 | Bacteria | 607 |
| 866 | Ga0500604_0027191 | 3300053151 | Bacteria | 1653 |
| 867 | Ga0500604_0069710 | 3300053151 | Bacteria | 1119 |
| 868 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 869 | Ga0500616_0000177 | 3300053153 | Bacteria | 106498 |
| 870 | Ga0500616_0068500 | 3300053153 | Bacteria | 1817 |
| 871 | Ga0500616_0073614 | 3300053153 | Bacteria | 1734 |
| 872 | Ga0500616_0129623 | 3300053153 | Bacteria | 1193 |
| 873 | Ga0500622_0000223 | 3300053156 | Bacteria | 59337 |
| 874 | Ga0500622_0061020 | 3300053156 | Bacteria | 1923 |
| 875 | Ga0500627_0081998 | 3300053158 | Bacteria | 1439 |
| 876 | Ga0500627_0197702 | 3300053158 | Bacteria | 901 |
| 877 | Ga0500627_0249491 | 3300053158 | Bacteria | 786 |
| 878 | Ga0500627_0509135 | 3300053158 | Bacteria | 500 |
| 879 | Ga0500633_0041592 | 3300053160 | Bacteria | 1547 |
| 880 | Ga0500636_0003274 | 3300053177 | Bacteria | 9079 |
| 881 | Ga0500636_0021225 | 3300053177 | Bacteria | 3845 |
| 882 | Ga0500637_0459932 | 3300053178 | Bacteria | 643 |
| 883 | Ga0500609_024560 | 3300053731 | Bacteria | 826 |
| 884 | Ga0500596_065139 | 3300053735 | Bacteria | 615 |
| 885 | Ga0501084_0066185 | 3300054114 | Bacteria | 3023 |
| 886 | Ga0501084_0172032 | 3300054114 | Bacteria | 1828 |
| 887 | Ga0501084_0223698 | 3300054114 | Bacteria | 1588 |
| 888 | Ga0501084_0467581 | 3300054114 | Bacteria | 1066 |
| 889 | Ga0501084_0480142 | 3300054114 | Bacteria | 1051 |
| 890 | Ga0501084_1145262 | 3300054114 | Bacteria | 653 |
| 891 | Ga0501082_0000025 | 3300060353 | Bacteria | 103262 |
| 892 | Ga0501082_0098054 | 3300060353 | Bacteria | 2534 |
| 893 | Ga0501082_0102805 | 3300060353 | Bacteria | 2472 |
| 894 | Ga0501082_0111040 | 3300060353 | Bacteria | 2373 |
| 895 | Ga0501082_0357520 | 3300060353 | Bacteria | 1274 |
| 896 | Ga0501082_0416113 | 3300060353 | Bacteria | 1174 |
| 897 | Ga0501082_1068369 | 3300060353 | Bacteria | 706 |
| 898 | Ga0501082_1833241 | 3300060353 | Bacteria | 529 |
| 899 | Ga0530510_0102300 | 3300061734 | Bacteria | 2095 |
| 900 | Ga0530510_0155140 | 3300061734 | Bacteria | 1692 |
| 901 | Ga0530510_0393853 | 3300061734 | Bacteria | 1043 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053735 | Ga0500596_065139 | Ga0500596_065139_206_505 | 96 |
| 2 | 3300009101 | Ga0105247_10637354 | Ga0105247_106373542 | 99 |
| 3 | 3300009551 | Ga0105238_12816528 | Ga0105238_128165281 | 99 |
| 4 | 3300009553 | Ga0105249_10325553 | Ga0105249_103255532 | 99 |
| 5 | 3300011119 | Ga0105246_10503784 | Ga0105246_105037842 | 99 |
| 6 | 3300013306 | Ga0163162_11388182 | Ga0163162_113881821 | 99 |
| 7 | 3300014968 | Ga0157379_10257636 | Ga0157379_102576362 | 99 |
| 8 | 3300048912 | Ga0496109_0592422 | Ga0496109_0592422_142_441 | 99 |
| 9 | 3300048913 | Ga0496110_0621744 | Ga0496110_0621744_186_485 | 99 |
| 10 | 3300048915 | Ga0496112_1385053 | Ga0496112_1385053_275_574 | 99 |
| 11 | 3300048917 | Ga0496114_1328837 | Ga0496114_1328837_245_544 | 99 |
| 12 | 3300049583 | Ga0501067_0036698 | Ga0501067_0036698_976_1275 | 99 |
| 13 | 3300025904 | Ga0207647_10499691 | Ga0207647_104996912 | 103 |
| 14 | iso_pu_bacteria | 2508501042 | 2508697539 | 103 |
| 15 | iso_pu_bacteria | 2513237139 | 2513878874 | 103 |
| 16 | iso_pu_bacteria | 2513237161 | 2514009841 | 103 |
| 17 | iso_pu_bacteria | 2791355196 | 2793060624 | 103 |
| 18 | iso_pu_bacteria | 2802429603 | 2805918268 | 103 |
| 19 | iso_pu_bacteria | 2824671348 | 2824673013 | 103 |
| 20 | iso_pu_bacteria | 2824687955 | 2824693792 | 103 |
| 21 | iso_pu_bacteria | 2824696289 | 2824702645 | 103 |
| 22 | iso_pu_bacteria | 2824773399 | 2824780907 | 103 |
| 23 | iso_pu_bacteria | 2838122688 | 2838123077 | 103 |
| 24 | iso_pu_bacteria | 2841941048 | 2841948142 | 103 |
| 25 | iso_pu_bacteria | 2841949485 | 2841954405 | 103 |
| 26 | iso_pu_bacteria | 2841966195 | 2841969793 | 103 |
| 27 | iso_pu_bacteria | 2841974524 | 2841978775 | 103 |
| 28 | iso_pu_bacteria | 2841983080 | 2841984098 | 103 |
| 29 | iso_pu_bacteria | 2842038055 | 2842038121 | 103 |
| 30 | iso_pu_bacteria | 2842045827 | 2842048933 | 103 |
| 31 | iso_pu_bacteria | 2847939898 | 2847947302 | 103 |
| 32 | iso_pu_bacteria | 2874620515 | 2874623081 | 103 |
| 33 | iso_pu_bacteria | 2904666416 | 2904669901 | 103 |
| 34 | iso_pu_bacteria | 2908739725 | 2908741299 | 103 |
| 35 | iso_pu_bacteria | 2935984226 | 2935988830 | 103 |
| 36 | iso_pu_bacteria | 2524023205 | 2524440266 | 104 |
| 37 | iso_pu_bacteria | 2602042107 | 2603856983 | 104 |
| 38 | iso_pu_bacteria | 2643221651 | 2644291143 | 104 |
| 39 | iso_pu_bacteria | 2643221736 | 2644745783 | 104 |
| 40 | iso_pu_bacteria | 2744054633 | 2745075417 | 104 |
| 41 | iso_pu_bacteria | 2828305725 | 2828307058 | 104 |
| 42 | iso_pu_bacteria | 2841760612 | 2841765849 | 104 |
| 43 | iso_pu_bacteria | 2844104063 | 2844107459 | 104 |
| 44 | iso_pu_bacteria | 2851182111 | 2851187752 | 104 |
| 45 | iso_pu_bacteria | 2851246043 | 2851249499 | 104 |
| 46 | iso_pu_bacteria | 2857524615 | 2857528659 | 104 |
| 47 | iso_pu_bacteria | 2893066018 | 2893066181 | 104 |
| 48 | iso_pu_bacteria | 2906610324 | 2906615709 | 104 |
| 49 | iso_pu_bacteria | 2919073203 | 2919076029 | 104 |
| 50 | iso_pu_bacteria | 8057529695 | 8057531922 | 104 |
| 51 | 3300003659 | JGI25404J52841_10030164 | JGI25404J52841_100301642 | 105 |
| 52 | 3300005338 | Ga0068868_100436736 | Ga0068868_1004367361 | 105 |
| 53 | 3300005340 | Ga0070689_101641183 | Ga0070689_1016411832 | 105 |
| 54 | 3300005341 | Ga0070691_10038192 | Ga0070691_100381922 | 105 |
| 55 | 3300005341 | Ga0070691_10278604 | Ga0070691_102786041 | 105 |
| 56 | 3300005347 | Ga0070668_100750281 | Ga0070668_1007502812 | 105 |
| 57 | 3300005353 | Ga0070669_101234906 | Ga0070669_1012349062 | 105 |
| 58 | 3300005440 | Ga0070705_100242665 | Ga0070705_1002426652 | 105 |
| 59 | 3300005441 | Ga0070700_100892536 | Ga0070700_1008925362 | 105 |
| 60 | 3300005441 | Ga0070700_101245636 | Ga0070700_1012456361 | 105 |
| 61 | 3300005617 | Ga0068859_100244509 | Ga0068859_1002445092 | 105 |
| 62 | 3300005719 | Ga0068861_100306416 | Ga0068861_1003064162 | 105 |
| 63 | 3300005842 | Ga0068858_100110809 | Ga0068858_1001108094 | 105 |
| 64 | 3300005844 | Ga0068862_100019045 | Ga0068862_1000190456 | 105 |
| 65 | 3300005937 | Ga0081455_10000196 | Ga0081455_1000019647 | 105 |
| 66 | 3300006042 | Ga0075368_10002447 | Ga0075368_100024474 | 105 |
| 67 | 3300006178 | Ga0075367_10037371 | Ga0075367_100373714 | 105 |
| 68 | 3300006844 | Ga0075428_100118754 | Ga0075428_1001187542 | 105 |
| 69 | 3300006844 | Ga0075428_100179086 | Ga0075428_1001790863 | 105 |
| 70 | 3300006844 | Ga0075428_100182655 | Ga0075428_1001826553 | 105 |
| 71 | 3300006844 | Ga0075428_100302389 | Ga0075428_1003023894 | 105 |
| 72 | 3300006844 | Ga0075428_100464305 | Ga0075428_1004643052 | 105 |
| 73 | 3300006844 | Ga0075428_100595785 | Ga0075428_1005957852 | 105 |
| 74 | 3300006844 | Ga0075428_101878361 | Ga0075428_1018783612 | 105 |
| 75 | 3300006847 | Ga0075431_100259704 | Ga0075431_1002597042 | 105 |
| 76 | 3300006852 | Ga0075433_10000349 | Ga0075433_1000034917 | 105 |
| 77 | 3300006852 | Ga0075433_10237570 | Ga0075433_102375703 | 105 |
| 78 | 3300006871 | Ga0075434_100002239 | Ga0075434_10000223913 | 105 |
| 79 | 3300006880 | Ga0075429_100367620 | Ga0075429_1003676202 | 105 |
| 80 | 3300006931 | Ga0097620_100244532 | Ga0097620_1002445322 | 105 |
| 81 | 3300009094 | Ga0111539_10012734 | Ga0111539_100127349 | 105 |
| 82 | 3300009094 | Ga0111539_10021737 | Ga0111539_100217379 | 105 |
| 83 | 3300009094 | Ga0111539_10905049 | Ga0111539_109050491 | 105 |
| 84 | 3300009101 | Ga0105247_11092863 | Ga0105247_110928631 | 105 |
| 85 | 3300009147 | Ga0114129_10050036 | Ga0114129_100500365 | 105 |
| 86 | 3300009147 | Ga0114129_10176057 | Ga0114129_101760573 | 105 |
| 87 | 3300009147 | Ga0114129_10348670 | Ga0114129_103486703 | 105 |
| 88 | 3300009147 | Ga0114129_10739919 | Ga0114129_107399193 | 105 |
| 89 | 3300009147 | Ga0114129_11952726 | Ga0114129_119527262 | 105 |
| 90 | 3300009177 | Ga0105248_12284510 | Ga0105248_122845101 | 105 |
| 91 | 3300009553 | Ga0105249_10427743 | Ga0105249_104277431 | 105 |
| 92 | 3300009553 | Ga0105249_12963999 | Ga0105249_129639991 | 105 |
| 93 | 3300025936 | Ga0207670_10758267 | Ga0207670_107582672 | 105 |
| 94 | 3300025961 | Ga0207712_10579609 | Ga0207712_105796091 | 105 |
| 95 | 3300025972 | Ga0207668_10177886 | Ga0207668_101778863 | 105 |
| 96 | 3300026035 | Ga0207703_10470694 | Ga0207703_104706943 | 105 |
| 97 | 3300026035 | Ga0207703_10472201 | Ga0207703_104722012 | 105 |
| 98 | 3300026075 | Ga0207708_10531335 | Ga0207708_105313352 | 105 |
| 99 | 3300027907 | Ga0207428_10017950 | Ga0207428_100179503 | 105 |
| 100 | 3300027907 | Ga0207428_10040717 | Ga0207428_100407173 | 105 |
| 101 | 3300028380 | Ga0268265_10401654 | Ga0268265_104016542 | 105 |
| 102 | 3300028381 | Ga0268264_10227117 | Ga0268264_102271172 | 105 |
| 103 | 3300034818 | Ga0373950_0028275 | Ga0373950_0028275_359_679 | 105 |
| 104 | 3300034819 | Ga0373958_0094967 | Ga0373958_0094967_248_568 | 105 |
| 105 | 3300035084 | Ga0373928_0012494 | Ga0373928_0012494_793_1113 | 105 |
| 106 | 3300035084 | Ga0373928_0242371 | Ga0373928_0242371_41_361 | 105 |
| 107 | 3300035088 | Ga0373940_0002719 | Ga0373940_0002719_2175_2495 | 105 |
| 108 | 3300035090 | Ga0373949_0024472 | Ga0373949_0024472_668_988 | 105 |
| 109 | 3300035207 | Ga0373942_0067068 | Ga0373942_0067068_88_408 | 105 |
| 110 | 3300048904 | Ga0496101_0702501 | Ga0496101_0702501_64_384 | 105 |
| 111 | 3300049568 | Ga0501031_0213233 | Ga0501031_0213233_687_1007 | 105 |
| 112 | 3300049570 | Ga0501033_0766753 | Ga0501033_0766753_241_561 | 105 |
| 113 | 3300049571 | Ga0501034_0091478 | Ga0501034_0091478_1804_2130 | 105 |
| 114 | 3300049572 | Ga0501036_0449920 | Ga0501036_0449920_226_552 | 105 |
| 115 | 3300049572 | Ga0501036_1644588 | Ga0501036_1644588_109_435 | 105 |
| 116 | 3300049583 | Ga0501067_0111752 | Ga0501067_0111752_128_448 | 105 |
| 117 | 3300049586 | Ga0501070_0793749 | Ga0501070_0793749_331_651 | 105 |
| 118 | 3300049587 | Ga0501071_0627853 | Ga0501071_0627853_302_628 | 105 |
| 119 | 3300049741 | Ga0501079_0665487 | Ga0501079_0665487_163_483 | 105 |
| 120 | 3300049743 | Ga0501081_0314230 | Ga0501081_0314230_706_1026 | 105 |
| 121 | 3300049823 | Ga0501044_0075920 | Ga0501044_0075920_1921_2247 | 105 |
| 122 | 3300050494 | nmdc:mga06z11_2909_c1 | nmdc:mga06z11_2909_c1_633_956 | 105 |
| 123 | 3300050507 | nmdc:mga05p37_487479_c1 | nmdc:mga05p37_487479_c1_836_1159 | 105 |
| 124 | 3300050507 | nmdc:mga05p37_609342_c1 | nmdc:mga05p37_609342_c1_892_1212 | 105 |
| 125 | 3300050507 | nmdc:mga05p37_842213_c1 | nmdc:mga05p37_842213_c1_663_983 | 105 |
| 126 | 3300050508 | nmdc:mga09592_1015526_c1 | nmdc:mga09592_1015526_c1_355_675 | 105 |
| 127 | 3300050508 | nmdc:mga09592_1416295_c1 | nmdc:mga09592_1416295_c1_33_353 | 105 |
| 128 | 3300050508 | nmdc:mga09592_1441015_c1 | nmdc:mga09592_1441015_c1_201_521 | 105 |
| 129 | 3300050508 | nmdc:mga09592_382835_c1 | nmdc:mga09592_382835_c1_560_883 | 105 |
| 130 | 3300050509 | nmdc:mga0qj67_877448_c1 | nmdc:mga0qj67_877448_c1_372_695 | 105 |
| 131 | 3300050510 | nmdc:mga06r32_300842_c1 | nmdc:mga06r32_300842_c1_156_479 | 105 |
| 132 | 3300050510 | nmdc:mga06r32_537571_c1 | nmdc:mga06r32_537571_c1_140_460 | 105 |
| 133 | 3300050511 | nmdc:mga08y16_1308470_c1 | nmdc:mga08y16_1308470_c1_22_342 | 105 |
| 134 | 3300050511 | nmdc:mga08y16_161308_c1 | nmdc:mga08y16_161308_c1_71_391 | 105 |
| 135 | 3300050511 | nmdc:mga08y16_63829_c1 | nmdc:mga08y16_63829_c1_507_827 | 105 |
| 136 | 3300050512 | nmdc:mga0n895_1633_c1 | nmdc:mga0n895_1633_c1_13712_14032 | 105 |
| 137 | 3300050515 | nmdc:mga0a205_155568_c2 | nmdc:mga0a205_155568_c2_1274_1594 | 105 |
| 138 | 3300003203 | JGI25406J46586_10155184 | JGI25406J46586_101551841 | 106 |
| 139 | 3300005262 | Ga0065165_1000209 | Ga0065165_100020919 | 106 |
| 140 | 3300005335 | Ga0070666_10457265 | Ga0070666_104572652 | 106 |
| 141 | 3300005338 | Ga0068868_101075155 | Ga0068868_1010751551 | 106 |
| 142 | 3300005345 | Ga0070692_10877072 | Ga0070692_108770721 | 106 |
| 143 | 3300005353 | Ga0070669_101311396 | Ga0070669_1013113961 | 106 |
| 144 | 3300005356 | Ga0070674_100118576 | Ga0070674_1001185763 | 106 |
| 145 | 3300005356 | Ga0070674_100972696 | Ga0070674_1009726962 | 106 |
| 146 | 3300005364 | Ga0070673_100207545 | Ga0070673_1002075452 | 106 |
| 147 | 3300005365 | Ga0070688_100766106 | Ga0070688_1007661062 | 106 |
| 148 | 3300005367 | Ga0070667_101423708 | Ga0070667_1014237081 | 106 |
| 149 | 3300005435 | Ga0070714_100424389 | Ga0070714_1004243892 | 106 |
| 150 | 3300005440 | Ga0070705_101889051 | Ga0070705_1018890511 | 106 |
| 151 | 3300005455 | Ga0070663_100036370 | Ga0070663_1000363705 | 106 |
| 152 | 3300005456 | Ga0070678_100151387 | Ga0070678_1001513873 | 106 |
| 153 | 3300005459 | Ga0068867_101603280 | Ga0068867_1016032802 | 106 |
| 154 | 3300005543 | Ga0070672_100968129 | Ga0070672_1009681292 | 106 |
| 155 | 3300005578 | Ga0068854_102071140 | Ga0068854_1020711401 | 106 |
| 156 | 3300005840 | Ga0068870_10264555 | Ga0068870_102645552 | 106 |
| 157 | 3300005840 | Ga0068870_10644837 | Ga0068870_106448372 | 106 |
| 158 | 3300005843 | Ga0068860_102644452 | Ga0068860_1026444521 | 106 |
| 159 | 3300005844 | Ga0068862_101791972 | Ga0068862_1017919722 | 106 |
| 160 | 3300005937 | Ga0081455_10467233 | Ga0081455_104672332 | 106 |
| 161 | 3300005981 | Ga0081538_10026508 | Ga0081538_100265082 | 106 |
| 162 | 3300005983 | Ga0081540_1000293 | Ga0081540_100029322 | 106 |
| 163 | 3300005983 | Ga0081540_1005974 | Ga0081540_10059743 | 106 |
| 164 | 3300005983 | Ga0081540_1041402 | Ga0081540_10414023 | 106 |
| 165 | 3300005985 | Ga0081539_10002257 | Ga0081539_1000225729 | 106 |
| 166 | 3300005985 | Ga0081539_10015916 | Ga0081539_100159163 | 106 |
| 167 | 3300006038 | Ga0075365_10004179 | Ga0075365_100041798 | 106 |
| 168 | 3300006038 | Ga0075365_10225049 | Ga0075365_102250492 | 106 |
| 169 | 3300006038 | Ga0075365_11144497 | Ga0075365_111444971 | 106 |
| 170 | 3300006042 | Ga0075368_10044175 | Ga0075368_100441752 | 106 |
| 171 | 3300006048 | Ga0075363_100101691 | Ga0075363_1001016913 | 106 |
| 172 | 3300006048 | Ga0075363_100251267 | Ga0075363_1002512672 | 106 |
| 173 | 3300006051 | Ga0075364_10021661 | Ga0075364_100216615 | 106 |
| 174 | 3300006051 | Ga0075364_10155242 | Ga0075364_101552422 | 106 |
| 175 | 3300006051 | Ga0075364_10486711 | Ga0075364_104867112 | 106 |
| 176 | 3300006051 | Ga0075364_10954163 | Ga0075364_109541632 | 106 |
| 177 | 3300006163 | Ga0070715_10573342 | Ga0070715_105733422 | 106 |
| 178 | 3300006177 | Ga0075362_10103278 | Ga0075362_101032782 | 106 |
| 179 | 3300006178 | Ga0075367_10097412 | Ga0075367_100974123 | 106 |
| 180 | 3300006178 | Ga0075367_10104264 | Ga0075367_101042643 | 106 |
| 181 | 3300006186 | Ga0075369_10022004 | Ga0075369_100220045 | 106 |
| 182 | 3300006195 | Ga0075366_10802218 | Ga0075366_108022181 | 106 |
| 183 | 3300006237 | Ga0097621_100760050 | Ga0097621_1007600502 | 106 |
| 184 | 3300006353 | Ga0075370_10227312 | Ga0075370_102273122 | 106 |
| 185 | 3300006846 | Ga0075430_100733528 | Ga0075430_1007335282 | 106 |
| 186 | 3300010375 | Ga0105239_11371255 | Ga0105239_113712552 | 106 |
| 187 | 3300013250 | Ga0171462_1019 | Ga0171462_101956 | 106 |
| 188 | 3300014325 | Ga0163163_12943638 | Ga0163163_129436382 | 106 |
| 189 | 3300014326 | Ga0157380_11121781 | Ga0157380_111217812 | 106 |
| 190 | 3300014745 | Ga0157377_10568648 | Ga0157377_105686482 | 106 |
| 191 | 3300017792 | Ga0163161_11363935 | Ga0163161_113639352 | 106 |
| 192 | 3300025230 | Ga0209563_111903 | Ga0209563_1119032 | 106 |
| 193 | 3300025284 | Ga0209130_1000902 | Ga0209130_10009022 | 106 |
| 194 | 3300025294 | Ga0209025_1002026 | Ga0209025_100202621 | 106 |
| 195 | 3300025295 | Ga0209564_1018758 | Ga0209564_10187583 | 106 |
| 196 | 3300025297 | Ga0209758_1011197 | Ga0209758_10111973 | 106 |
| 197 | 3300025297 | Ga0209758_1056197 | Ga0209758_10561972 | 106 |
| 198 | 3300025302 | Ga0207426_1011624 | Ga0207426_10116242 | 106 |
| 199 | 3300025903 | Ga0207680_10747833 | Ga0207680_107478331 | 106 |
| 200 | 3300025905 | Ga0207685_10036835 | Ga0207685_100368352 | 106 |
| 201 | 3300025908 | Ga0207643_10031625 | Ga0207643_100316252 | 106 |
| 202 | 3300025909 | Ga0207705_10197107 | Ga0207705_101971073 | 106 |
| 203 | 3300025917 | Ga0207660_10526299 | Ga0207660_105262991 | 106 |
| 204 | 3300025926 | Ga0207659_10194783 | Ga0207659_101947832 | 106 |
| 205 | 3300025929 | Ga0207664_10660810 | Ga0207664_106608102 | 106 |
| 206 | 3300025929 | Ga0207664_11041069 | Ga0207664_110410692 | 106 |
| 207 | 3300025937 | Ga0207669_10089327 | Ga0207669_100893274 | 106 |
| 208 | 3300025940 | Ga0207691_10211291 | Ga0207691_102112912 | 106 |
| 209 | 3300025940 | Ga0207691_11454699 | Ga0207691_114546991 | 106 |
| 210 | 3300025960 | Ga0207651_10276221 | Ga0207651_102762212 | 106 |
| 211 | 3300025972 | Ga0207668_10918208 | Ga0207668_109182081 | 106 |
| 212 | 3300026023 | Ga0207677_11141255 | Ga0207677_111412551 | 106 |
| 213 | 3300026067 | Ga0207678_10093158 | Ga0207678_100931582 | 106 |
| 214 | 3300026078 | Ga0207702_11029361 | Ga0207702_110293612 | 106 |
| 215 | 3300026118 | Ga0207675_100204833 | Ga0207675_1002048332 | 106 |
| 216 | 3300026121 | Ga0207683_10247194 | Ga0207683_102471942 | 106 |
| 217 | 3300026142 | Ga0207698_10881938 | Ga0207698_108819381 | 106 |
| 218 | 3300026142 | Ga0207698_12478612 | Ga0207698_124786122 | 106 |
| 219 | 3300027866 | Ga0209813_10161979 | Ga0209813_101619792 | 106 |
| 220 | 3300028379 | Ga0268266_10969032 | Ga0268266_109690322 | 106 |
| 221 | 3300028379 | Ga0268266_11661538 | Ga0268266_116615381 | 106 |
| 222 | 3300028794 | Ga0307515_10091522 | Ga0307515_100915223 | 106 |
| 223 | 3300031456 | Ga0307513_10021442 | Ga0307513_100214427 | 106 |
| 224 | 3300031456 | Ga0307513_10369951 | Ga0307513_103699512 | 106 |
| 225 | 3300031731 | Ga0307405_11152041 | Ga0307405_111520412 | 106 |
| 226 | 3300031731 | Ga0307405_11411564 | Ga0307405_114115641 | 106 |
| 227 | 3300031901 | Ga0307406_10154832 | Ga0307406_101548323 | 106 |
| 228 | 3300031911 | Ga0307412_11688076 | Ga0307412_116880761 | 106 |
| 229 | 3300031911 | Ga0307412_11793923 | Ga0307412_117939232 | 106 |
| 230 | 3300031995 | Ga0307409_100454418 | Ga0307409_1004544182 | 106 |
| 231 | 3300031995 | Ga0307409_101353277 | Ga0307409_1013532772 | 106 |
| 232 | 3300032002 | Ga0307416_100733300 | Ga0307416_1007333002 | 106 |
| 233 | 3300032126 | Ga0307415_100052547 | Ga0307415_1000525474 | 106 |
| 234 | 3300039145 | Ga0237816_08265 | Ga0237816_08265_245_574 | 106 |
| 235 | 3300039437 | Ga0436365_1027753 | Ga0436365_1027753_51_377 | 106 |
| 236 | 3300041443 | Ga0451789_0411068 | Ga0451789_0411068_690_1019 | 106 |
| 237 | 3300041453 | Ga0451797_0687038 | Ga0451797_0687038_56_385 | 106 |
| 238 | 3300041496 | Ga0451839_1270928 | Ga0451839_1270928_74_403 | 106 |
| 239 | 3300041512 | Ga0451853_3383827 | Ga0451853_3383827_29_358 | 106 |
| 240 | 3300046460 | Ga0495638_0001856 | Ga0495638_0001856_11628_11957 | 106 |
| 241 | 3300046460 | Ga0495638_0017590 | Ga0495638_0017590_296_625 | 106 |
| 242 | 3300046477 | Ga0495664_0345171 | Ga0495664_0345171_506_835 | 106 |
| 243 | 3300046491 | Ga0495584_0489114 | Ga0495584_0489114_144_473 | 106 |
| 244 | 3300046501 | Ga0495607_0031262 | Ga0495607_0031262_466_795 | 106 |
| 245 | 3300046507 | Ga0495606_0063802 | Ga0495606_0063802_1752_2081 | 106 |
| 246 | 3300046511 | Ga0495608_0213092 | Ga0495608_0213092_596_925 | 106 |
| 247 | 3300046513 | Ga0495616_0040932 | Ga0495616_0040932_1225_1554 | 106 |
| 248 | 3300046514 | Ga0495618_0764146 | Ga0495618_0764146_81_410 | 106 |
| 249 | 3300046515 | Ga0495620_0129614 | Ga0495620_0129614_247_576 | 106 |
| 250 | 3300046518 | Ga0495631_0286363 | Ga0495631_0286363_143_472 | 106 |
| 251 | 3300046519 | Ga0495632_0500947 | Ga0495632_0500947_143_472 | 106 |
| 252 | 3300046520 | Ga0495637_0180815 | Ga0495637_0180815_215_544 | 106 |
| 253 | 3300046522 | Ga0495643_0088042 | Ga0495643_0088042_1165_1494 | 106 |
| 254 | 3300046524 | Ga0495648_0000859 | Ga0495648_0000859_20507_20836 | 106 |
| 255 | 3300046530 | Ga0495654_0456257 | Ga0495654_0456257_144_473 | 106 |
| 256 | 3300046542 | Ga0495597_0075048 | Ga0495597_0075048_551_880 | 106 |
| 257 | 3300046557 | Ga0495622_0021150 | Ga0495622_0021150_1713_2042 | 106 |
| 258 | 3300046559 | Ga0495667_0059393 | Ga0495667_0059393_116_445 | 106 |
| 259 | 3300046616 | Ga0495668_0521141 | Ga0495668_0521141_266_595 | 106 |
| 260 | 3300046616 | Ga0495668_0834524 | Ga0495668_0834524_146_475 | 106 |
| 261 | 3300046648 | Ga0495611_0220783 | Ga0495611_0220783_394_723 | 106 |
| 262 | 3300046660 | Ga0495625_0199459 | Ga0495625_0199459_873_1202 | 106 |
| 263 | 3300046660 | Ga0495625_0794855 | Ga0495625_0794855_191_520 | 106 |
| 264 | 3300046665 | Ga0495661_0037786 | Ga0495661_0037786_2054_2383 | 106 |
| 265 | 3300046691 | Ga0495670_0117268 | Ga0495670_0117268_205_534 | 106 |
| 266 | 3300046692 | Ga0495671_0033442 | Ga0495671_0033442_1226_1555 | 106 |
| 267 | 3300046810 | Ga0495660_0027480 | Ga0495660_0027480_1258_1587 | 106 |
| 268 | 3300047320 | Ga0495672_0075809 | Ga0495672_0075809_146_475 | 106 |
| 269 | 3300047469 | Ga0495673_0215055 | Ga0495673_0215055_58_387 | 106 |
| 270 | 3300047472 | Ga0495686_0144734 | Ga0495686_0144734_588_917 | 106 |
| 271 | 3300048091 | Ga0495626_0022268 | Ga0495626_0022268_43_372 | 106 |
| 272 | 3300048903 | Ga0496100_0212125 | Ga0496100_0212125_337_666 | 106 |
| 273 | 3300048903 | Ga0496100_1478921 | Ga0496100_1478921_119_448 | 106 |
| 274 | 3300048910 | Ga0496107_0617356 | Ga0496107_0617356_398_727 | 106 |
| 275 | 3300048917 | Ga0496114_0044139 | Ga0496114_0044139_3210_3539 | 106 |
| 276 | 3300048919 | Ga0496116_0023936 | Ga0496116_0023936_130_459 | 106 |
| 277 | 3300048920 | Ga0496117_0102747 | Ga0496117_0102747_1358_1687 | 106 |
| 278 | 3300048921 | Ga0496118_0136476 | Ga0496118_0136476_753_1082 | 106 |
| 279 | 3300048922 | Ga0496119_0057075 | Ga0496119_0057075_366_695 | 106 |
| 280 | 3300048923 | Ga0496120_0066692 | Ga0496120_0066692_1642_1971 | 106 |
| 281 | 3300048924 | Ga0496121_0001090 | Ga0496121_0001090_14712_15041 | 106 |
| 282 | 3300048924 | Ga0496121_0026263 | Ga0496121_0026263_1694_2023 | 106 |
| 283 | 3300048924 | Ga0496121_0150509 | Ga0496121_0150509_1202_1531 | 106 |
| 284 | 3300048925 | Ga0496122_0007688 | Ga0496122_0007688_4410_4739 | 106 |
| 285 | 3300048925 | Ga0496122_0543093 | Ga0496122_0543093_19_348 | 106 |
| 286 | 3300048926 | Ga0496123_0186955 | Ga0496123_0186955_683_1012 | 106 |
| 287 | 3300048926 | Ga0496123_0276748 | Ga0496123_0276748_203_532 | 106 |
| 288 | 3300048927 | Ga0496124_0335945 | Ga0496124_0335945_664_993 | 106 |
| 289 | 3300048927 | Ga0496124_0639814 | Ga0496124_0639814_308_637 | 106 |
| 290 | 3300048927 | Ga0496124_0893368 | Ga0496124_0893368_27_356 | 106 |
| 291 | 3300048928 | Ga0496125_0000252 | Ga0496125_0000252_46857_47189 | 106 |
| 292 | 3300048928 | Ga0496125_0000566 | Ga0496125_0000566_49468_49797 | 106 |
| 293 | 3300048928 | Ga0496125_0001454 | Ga0496125_0001454_33490_33822 | 106 |
| 294 | 3300048928 | Ga0496125_0143619 | Ga0496125_0143619_1187_1516 | 106 |
| 295 | 3300048929 | Ga0496126_0072197 | Ga0496126_0072197_908_1240 | 106 |
| 296 | 3300048929 | Ga0496126_0074628 | Ga0496126_0074628_2089_2418 | 106 |
| 297 | 3300048929 | Ga0496126_0293370 | Ga0496126_0293370_938_1267 | 106 |
| 298 | 3300049459 | Ga0495678_050712 | Ga0495678_050712_252_581 | 106 |
| 299 | 3300049569 | Ga0501032_0362429 | Ga0501032_0362429_84_413 | 106 |
| 300 | 3300049569 | Ga0501032_0971569 | Ga0501032_0971569_24_353 | 106 |
| 301 | 3300049570 | Ga0501033_0229197 | Ga0501033_0229197_407_736 | 106 |
| 302 | 3300049571 | Ga0501034_0229221 | Ga0501034_0229221_652_981 | 106 |
| 303 | 3300049572 | Ga0501036_0203548 | Ga0501036_0203548_571_900 | 106 |
| 304 | 3300049572 | Ga0501036_1341745 | Ga0501036_1341745_84_410 | 106 |
| 305 | 3300049573 | Ga0501037_0490042 | Ga0501037_0490042_424_753 | 106 |
| 306 | 3300049574 | Ga0501038_0530526 | Ga0501038_0530526_452_781 | 106 |
| 307 | 3300049574 | Ga0501038_1235850 | Ga0501038_1235850_112_438 | 106 |
| 308 | 3300049577 | Ga0501041_0638323 | Ga0501041_0638323_45_368 | 106 |
| 309 | 3300049580 | Ga0501046_0073172 | Ga0501046_0073172_772_1101 | 106 |
| 310 | 3300049580 | Ga0501046_0998962 | Ga0501046_0998962_97_420 | 106 |
| 311 | 3300049581 | Ga0501047_0394931 | Ga0501047_0394931_217_546 | 106 |
| 312 | 3300049742 | Ga0501080_0815371 | Ga0501080_0815371_260_586 | 106 |
| 313 | 3300049744 | Ga0501083_0098118 | Ga0501083_0098118_59_385 | 106 |
| 314 | 3300049822 | Ga0501035_0507264 | Ga0501035_0507264_112_441 | 106 |
| 315 | 3300049823 | Ga0501044_0846933 | Ga0501044_0846933_346_675 | 106 |
| 316 | 3300049824 | Ga0501045_0371757 | Ga0501045_0371757_40_363 | 106 |
| 317 | 3300050489 | nmdc:mga03683_220442_c1 | nmdc:mga03683_220442_c1_61_390 | 106 |
| 318 | 3300050490 | nmdc:mga03n38_140041_c1 | nmdc:mga03n38_140041_c1_392_733 | 106 |
| 319 | 3300050490 | nmdc:mga03n38_525051_c1 | nmdc:mga03n38_525051_c1_48_377 | 106 |
| 320 | 3300050491 | nmdc:mga00v17_19035_c1 | nmdc:mga00v17_19035_c1_2234_2563 | 106 |
| 321 | 3300050491 | nmdc:mga00v17_206029_c1 | nmdc:mga00v17_206029_c1_328_669 | 106 |
| 322 | 3300050492 | nmdc:mga0yw44_10125_c1 | nmdc:mga0yw44_10125_c1_1660_1989 | 106 |
| 323 | 3300050492 | nmdc:mga0yw44_475714_c1 | nmdc:mga0yw44_475714_c1_450_782 | 106 |
| 324 | 3300050492 | nmdc:mga0yw44_504944_c1 | nmdc:mga0yw44_504944_c1_60_389 | 106 |
| 325 | 3300050493 | nmdc:mga0k408_378226_c1 | nmdc:mga0k408_378226_c1_66_407 | 106 |
| 326 | 3300050494 | nmdc:mga06z11_25779_c1 | nmdc:mga06z11_25779_c1_1561_1890 | 106 |
| 327 | 3300050494 | nmdc:mga06z11_39657_c1 | nmdc:mga06z11_39657_c1_1137_1466 | 106 |
| 328 | 3300050496 | nmdc:mga07m45_735512_c1 | nmdc:mga07m45_735512_c1_14_343 | 106 |
| 329 | 3300050509 | nmdc:mga0qj67_688613_c1 | nmdc:mga0qj67_688613_c1_334_675 | 106 |
| 330 | 3300050509 | nmdc:mga0qj67_845669_c1 | nmdc:mga0qj67_845669_c1_207_536 | 106 |
| 331 | 3300050516 | nmdc:mga0sz30_15111_c1 | nmdc:mga0sz30_15111_c1_130_459 | 106 |
| 332 | 3300053087 | Ga0500643_027127 | Ga0500643_027127_1190_1519 | 106 |
| 333 | 3300053088 | Ga0500644_0048130 | Ga0500644_0048130_696_1025 | 106 |
| 334 | 3300053090 | Ga0500646_0016648 | Ga0500646_0016648_725_1054 | 106 |
| 335 | 3300053093 | Ga0500651_0021060 | Ga0500651_0021060_1269_1598 | 106 |
| 336 | 3300053093 | Ga0500651_0026933 | Ga0500651_0026933_1508_1837 | 106 |
| 337 | 3300053094 | Ga0500566_0004029 | Ga0500566_0004029_978_1307 | 106 |
| 338 | 3300053096 | Ga0500641_0002417 | Ga0500641_0002417_2866_3195 | 106 |
| 339 | 3300053098 | Ga0500650_0000130 | Ga0500650_0000130_9570_9899 | 106 |
| 340 | 3300053104 | Ga0500556_0000066 | Ga0500556_0000066_89022_89351 | 106 |
| 341 | 3300053108 | Ga0500562_037640 | Ga0500562_037640_600_929 | 106 |
| 342 | 3300053116 | Ga0500592_002474 | Ga0500592_002474_1235_1564 | 106 |
| 343 | 3300053119 | Ga0500595_001089 | Ga0500595_001089_7117_7446 | 106 |
| 344 | 3300053119 | Ga0500595_003717 | Ga0500595_003717_4760_5089 | 106 |
| 345 | 3300053119 | Ga0500595_013828 | Ga0500595_013828_1983_2312 | 106 |
| 346 | 3300053121 | Ga0500607_071651 | Ga0500607_071651_666_995 | 106 |
| 347 | 3300053122 | Ga0500608_131224 | Ga0500608_131224_740_1069 | 106 |
| 348 | 3300053122 | Ga0500608_237218 | Ga0500608_237218_169_498 | 106 |
| 349 | 3300053122 | Ga0500608_277028 | Ga0500608_277028_18_347 | 106 |
| 350 | 3300053125 | Ga0500618_048912 | Ga0500618_048912_382_711 | 106 |
| 351 | 3300053130 | Ga0500642_0000072 | Ga0500642_0000072_38529_38858 | 106 |
| 352 | 3300053130 | Ga0500642_0107110 | Ga0500642_0107110_589_918 | 106 |
| 353 | 3300053131 | Ga0500652_001780 | Ga0500652_001780_3512_3841 | 106 |
| 354 | 3300053136 | Ga0500559_0000413 | Ga0500559_0000413_20773_21102 | 106 |
| 355 | 3300053139 | Ga0500568_0000453 | Ga0500568_0000453_20265_20594 | 106 |
| 356 | 3300053145 | Ga0500586_003954 | Ga0500586_003954_2721_3050 | 106 |
| 357 | 3300053146 | Ga0500588_0301048 | Ga0500588_0301048_100_429 | 106 |
| 358 | 3300053151 | Ga0500604_0027191 | Ga0500604_0027191_168_497 | 106 |
| 359 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_18756_19085 | 106 |
| 360 | 3300053153 | Ga0500616_0000177 | Ga0500616_0000177_15800_16129 | 106 |
| 361 | 3300053156 | Ga0500622_0000223 | Ga0500622_0000223_13812_14141 | 106 |
| 362 | 3300053156 | Ga0500622_0061020 | Ga0500622_0061020_1215_1544 | 106 |
| 363 | 3300053158 | Ga0500627_0249491 | Ga0500627_0249491_128_457 | 106 |
| 364 | 3300053158 | Ga0500627_0509135 | Ga0500627_0509135_83_409 | 106 |
| 365 | 3300053160 | Ga0500633_0041592 | Ga0500633_0041592_1159_1488 | 106 |
| 366 | 3300053177 | Ga0500636_0003274 | Ga0500636_0003274_6802_7131 | 106 |
| 367 | 3300053177 | Ga0500636_0021225 | Ga0500636_0021225_1159_1488 | 106 |
| 368 | 3300053731 | Ga0500609_024560 | Ga0500609_024560_401_730 | 106 |
| 369 | 3300005347 | Ga0070668_100453176 | Ga0070668_1004531762 | 107 |
| 370 | 3300005354 | Ga0070675_100912966 | Ga0070675_1009129662 | 107 |
| 371 | 3300005365 | Ga0070688_101651374 | Ga0070688_1016513742 | 107 |
| 372 | 3300005457 | Ga0070662_101024112 | Ga0070662_1010241121 | 107 |
| 373 | 3300005459 | Ga0068867_100980316 | Ga0068867_1009803161 | 107 |
| 374 | 3300005535 | Ga0070684_101917378 | Ga0070684_1019173781 | 107 |
| 375 | 3300005545 | Ga0070695_101224100 | Ga0070695_1012241001 | 107 |
| 376 | 3300005614 | Ga0068856_100813319 | Ga0068856_1008133192 | 107 |
| 377 | 3300005719 | Ga0068861_100975804 | Ga0068861_1009758042 | 107 |
| 378 | 3300005937 | Ga0081455_10770091 | Ga0081455_107700912 | 107 |
| 379 | 3300009094 | Ga0111539_11106387 | Ga0111539_111063872 | 107 |
| 380 | 3300009553 | Ga0105249_11156726 | Ga0105249_111567262 | 107 |
| 381 | 3300014326 | Ga0157380_10182965 | Ga0157380_101829653 | 107 |
| 382 | 3300017792 | Ga0163161_10787817 | Ga0163161_107878172 | 107 |
| 383 | 3300021384 | Ga0213876_10016344 | Ga0213876_100163445 | 107 |
| 384 | 3300025915 | Ga0207693_10479360 | Ga0207693_104793602 | 107 |
| 385 | 3300026075 | Ga0207708_10568734 | Ga0207708_105687342 | 107 |
| 386 | 3300026118 | Ga0207675_100423784 | Ga0207675_1004237841 | 107 |
| 387 | 3300026118 | Ga0207675_102506247 | Ga0207675_1025062471 | 107 |
| 388 | 3300028380 | Ga0268265_12668205 | Ga0268265_126682052 | 107 |
| 389 | 3300031995 | Ga0307409_100628485 | Ga0307409_1006284852 | 107 |
| 390 | 3300035691 | Ga0373931_0612353 | Ga0373931_0612353_98_430 | 107 |
| 391 | 3300037466 | Ga0395898_1138396 | Ga0395898_1138396_101_427 | 107 |
| 392 | 3300039437 | Ga0436365_1890676 | Ga0436365_1890676_5455_5784 | 107 |
| 393 | 3300039438 | Ga0436360_1181788 | Ga0436360_1181788_54_380 | 107 |
| 394 | 3300041498 | Ga0451841_0805672 | Ga0451841_0805672_81_407 | 107 |
| 395 | 3300041509 | Ga0451843_0255968 | Ga0451843_0255968_90_425 | 107 |
| 396 | 3300046515 | Ga0495620_0187261 | Ga0495620_0187261_92_421 | 107 |
| 397 | 3300049570 | Ga0501033_0266530 | Ga0501033_0266530_669_1001 | 107 |
| 398 | 3300049579 | Ga0501043_0255513 | Ga0501043_0255513_404_736 | 107 |
| 399 | 3300049589 | Ga0501073_0591350 | Ga0501073_0591350_371_700 | 107 |
| 400 | 3300049742 | Ga0501080_0479701 | Ga0501080_0479701_437_769 | 107 |
| 401 | 3300049823 | Ga0501044_0644155 | Ga0501044_0644155_542_874 | 107 |
| 402 | 3300050511 | nmdc:mga08y16_597145_c1 | nmdc:mga08y16_597145_c1_209_538 | 107 |
| 403 | 3300053139 | Ga0500568_0049035 | Ga0500568_0049035_38_367 | 107 |
| 404 | 3300061734 | Ga0530510_0155140 | Ga0530510_0155140_848_1177 | 107 |
| 405 | 2209111006 | 2214578602 | 2213620747 | 108 |
| 406 | 3300003373 | JGI25407J50210_10152214 | JGI25407J50210_101522141 | 108 |
| 407 | 3300003659 | JGI25404J52841_10016298 | JGI25404J52841_100162981 | 108 |
| 408 | 3300005290 | Ga0065712_10041572 | Ga0065712_100415721 | 108 |
| 409 | 3300005290 | Ga0065712_10109852 | Ga0065712_101098522 | 108 |
| 410 | 3300005293 | Ga0065715_10149271 | Ga0065715_101492712 | 108 |
| 411 | 3300005293 | Ga0065715_10473769 | Ga0065715_104737691 | 108 |
| 412 | 3300005293 | Ga0065715_11108973 | Ga0065715_111089732 | 108 |
| 413 | 3300005295 | Ga0065707_10353061 | Ga0065707_103530612 | 108 |
| 414 | 3300005295 | Ga0065707_10915669 | Ga0065707_109156692 | 108 |
| 415 | 3300005327 | Ga0070658_10051167 | Ga0070658_100511676 | 108 |
| 416 | 3300005328 | Ga0070676_10082647 | Ga0070676_100826471 | 108 |
| 417 | 3300005328 | Ga0070676_10588801 | Ga0070676_105888012 | 108 |
| 418 | 3300005331 | Ga0070670_100691710 | Ga0070670_1006917101 | 108 |
| 419 | 3300005333 | Ga0070677_10005339 | Ga0070677_100053393 | 108 |
| 420 | 3300005334 | Ga0068869_100418842 | Ga0068869_1004188422 | 108 |
| 421 | 3300005335 | Ga0070666_10516274 | Ga0070666_105162742 | 108 |
| 422 | 3300005336 | Ga0070680_100013998 | Ga0070680_1000139988 | 108 |
| 423 | 3300005336 | Ga0070680_100776942 | Ga0070680_1007769422 | 108 |
| 424 | 3300005337 | Ga0070682_101010531 | Ga0070682_1010105311 | 108 |
| 425 | 3300005337 | Ga0070682_101980250 | Ga0070682_1019802501 | 108 |
| 426 | 3300005338 | Ga0068868_100536470 | Ga0068868_1005364701 | 108 |
| 427 | 3300005338 | Ga0068868_101098853 | Ga0068868_1010988532 | 108 |
| 428 | 3300005339 | Ga0070660_100068441 | Ga0070660_1000684413 | 108 |
| 429 | 3300005340 | Ga0070689_101600186 | Ga0070689_1016001862 | 108 |
| 430 | 3300005343 | Ga0070687_100192906 | Ga0070687_1001929062 | 108 |
| 431 | 3300005343 | Ga0070687_100241285 | Ga0070687_1002412852 | 108 |
| 432 | 3300005344 | Ga0070661_100132513 | Ga0070661_1001325132 | 108 |
| 433 | 3300005345 | Ga0070692_10927052 | Ga0070692_109270522 | 108 |
| 434 | 3300005347 | Ga0070668_100046891 | Ga0070668_1000468913 | 108 |
| 435 | 3300005347 | Ga0070668_100156589 | Ga0070668_1001565892 | 108 |
| 436 | 3300005347 | Ga0070668_101945558 | Ga0070668_1019455581 | 108 |
| 437 | 3300005353 | Ga0070669_100154343 | Ga0070669_1001543432 | 108 |
| 438 | 3300005354 | Ga0070675_100053020 | Ga0070675_1000530202 | 108 |
| 439 | 3300005354 | Ga0070675_100399015 | Ga0070675_1003990152 | 108 |
| 440 | 3300005354 | Ga0070675_101484049 | Ga0070675_1014840492 | 108 |
| 441 | 3300005355 | Ga0070671_100042683 | Ga0070671_1000426833 | 108 |
| 442 | 3300005355 | Ga0070671_100364071 | Ga0070671_1003640712 | 108 |
| 443 | 3300005355 | Ga0070671_100920699 | Ga0070671_1009206991 | 108 |
| 444 | 3300005355 | Ga0070671_100932751 | Ga0070671_1009327512 | 108 |
| 445 | 3300005356 | Ga0070674_100049857 | Ga0070674_1000498572 | 108 |
| 446 | 3300005356 | Ga0070674_101199435 | Ga0070674_1011994351 | 108 |
| 447 | 3300005364 | Ga0070673_100071920 | Ga0070673_1000719202 | 108 |
| 448 | 3300005364 | Ga0070673_100368452 | Ga0070673_1003684522 | 108 |
| 449 | 3300005365 | Ga0070688_101800320 | Ga0070688_1018003201 | 108 |
| 450 | 3300005366 | Ga0070659_100892224 | Ga0070659_1008922242 | 108 |
| 451 | 3300005366 | Ga0070659_101368238 | Ga0070659_1013682381 | 108 |
| 452 | 3300005367 | Ga0070667_100271139 | Ga0070667_1002711392 | 108 |
| 453 | 3300005367 | Ga0070667_100985939 | Ga0070667_1009859392 | 108 |
| 454 | 3300005434 | Ga0070709_11087828 | Ga0070709_110878282 | 108 |
| 455 | 3300005436 | Ga0070713_100865579 | Ga0070713_1008655792 | 108 |
| 456 | 3300005438 | Ga0070701_11249118 | Ga0070701_112491181 | 108 |
| 457 | 3300005441 | Ga0070700_100258480 | Ga0070700_1002584802 | 108 |
| 458 | 3300005441 | Ga0070700_100855913 | Ga0070700_1008559131 | 108 |
| 459 | 3300005456 | Ga0070678_100317943 | Ga0070678_1003179432 | 108 |
| 460 | 3300005456 | Ga0070678_100494993 | Ga0070678_1004949932 | 108 |
| 461 | 3300005457 | Ga0070662_100024505 | Ga0070662_1000245052 | 108 |
| 462 | 3300005457 | Ga0070662_101458471 | Ga0070662_1014584711 | 108 |
| 463 | 3300005458 | Ga0070681_10411752 | Ga0070681_104117521 | 108 |
| 464 | 3300005458 | Ga0070681_11137461 | Ga0070681_111374611 | 108 |
| 465 | 3300005459 | Ga0068867_100180068 | Ga0068867_1001800683 | 108 |
| 466 | 3300005466 | Ga0070685_10099508 | Ga0070685_100995082 | 108 |
| 467 | 3300005471 | Ga0070698_101769061 | Ga0070698_1017690612 | 108 |
| 468 | 3300005530 | Ga0070679_100039578 | Ga0070679_1000395782 | 108 |
| 469 | 3300005530 | Ga0070679_100439501 | Ga0070679_1004395011 | 108 |
| 470 | 3300005539 | Ga0068853_100238749 | Ga0068853_1002387493 | 108 |
| 471 | 3300005539 | Ga0068853_100924617 | Ga0068853_1009246171 | 108 |
| 472 | 3300005539 | Ga0068853_102303650 | Ga0068853_1023036501 | 108 |
| 473 | 3300005543 | Ga0070672_100575537 | Ga0070672_1005755372 | 108 |
| 474 | 3300005543 | Ga0070672_101050852 | Ga0070672_1010508522 | 108 |
| 475 | 3300005543 | Ga0070672_101122515 | Ga0070672_1011225152 | 108 |
| 476 | 3300005544 | Ga0070686_100402150 | Ga0070686_1004021502 | 108 |
| 477 | 3300005544 | Ga0070686_101134246 | Ga0070686_1011342461 | 108 |
| 478 | 3300005547 | Ga0070693_100164029 | Ga0070693_1001640292 | 108 |
| 479 | 3300005548 | Ga0070665_100542628 | Ga0070665_1005426282 | 108 |
| 480 | 3300005564 | Ga0070664_100954992 | Ga0070664_1009549922 | 108 |
| 481 | 3300005577 | Ga0068857_100276960 | Ga0068857_1002769602 | 108 |
| 482 | 3300005577 | Ga0068857_102025324 | Ga0068857_1020253242 | 108 |
| 483 | 3300005578 | Ga0068854_100609290 | Ga0068854_1006092902 | 108 |
| 484 | 3300005616 | Ga0068852_100914230 | Ga0068852_1009142302 | 108 |
| 485 | 3300005617 | Ga0068859_100207856 | Ga0068859_1002078562 | 108 |
| 486 | 3300005617 | Ga0068859_101182952 | Ga0068859_1011829521 | 108 |
| 487 | 3300005618 | Ga0068864_100080657 | Ga0068864_1000806573 | 108 |
| 488 | 3300005618 | Ga0068864_100869790 | Ga0068864_1008697901 | 108 |
| 489 | 3300005719 | Ga0068861_101336858 | Ga0068861_1013368581 | 108 |
| 490 | 3300005719 | Ga0068861_101535742 | Ga0068861_1015357422 | 108 |
| 491 | 3300005719 | Ga0068861_102016707 | Ga0068861_1020167071 | 108 |
| 492 | 3300005841 | Ga0068863_100937727 | Ga0068863_1009377271 | 108 |
| 493 | 3300005937 | Ga0081455_10030097 | Ga0081455_100300972 | 108 |
| 494 | 3300005937 | Ga0081455_10288312 | Ga0081455_102883122 | 108 |
| 495 | 3300005937 | Ga0081455_10767238 | Ga0081455_107672381 | 108 |
| 496 | 3300005981 | Ga0081538_10010509 | Ga0081538_100105096 | 108 |
| 497 | 3300005981 | Ga0081538_10066481 | Ga0081538_100664812 | 108 |
| 498 | 3300005981 | Ga0081538_10152432 | Ga0081538_101524323 | 108 |
| 499 | 3300005981 | Ga0081538_10336367 | Ga0081538_103363671 | 108 |
| 500 | 3300005983 | Ga0081540_1000045 | Ga0081540_100004562 | 108 |
| 501 | 3300005983 | Ga0081540_1259249 | Ga0081540_12592492 | 108 |
| 502 | 3300005985 | Ga0081539_10005839 | Ga0081539_100058398 | 108 |
| 503 | 3300005985 | Ga0081539_10043106 | Ga0081539_100431063 | 108 |
| 504 | 3300005985 | Ga0081539_10421400 | Ga0081539_104214001 | 108 |
| 505 | 3300006028 | Ga0070717_11889230 | Ga0070717_118892302 | 108 |
| 506 | 3300006038 | Ga0075365_10963058 | Ga0075365_109630581 | 108 |
| 507 | 3300006042 | Ga0075368_10104614 | Ga0075368_101046142 | 108 |
| 508 | 3300006042 | Ga0075368_10475193 | Ga0075368_104751931 | 108 |
| 509 | 3300006048 | Ga0075363_100047388 | Ga0075363_1000473882 | 108 |
| 510 | 3300006048 | Ga0075363_100540210 | Ga0075363_1005402102 | 108 |
| 511 | 3300006177 | Ga0075362_10190721 | Ga0075362_101907211 | 108 |
| 512 | 3300006177 | Ga0075362_10193124 | Ga0075362_101931241 | 108 |
| 513 | 3300006177 | Ga0075362_10207732 | Ga0075362_102077322 | 108 |
| 514 | 3300006177 | Ga0075362_10317903 | Ga0075362_103179032 | 108 |
| 515 | 3300006177 | Ga0075362_10323043 | Ga0075362_103230432 | 108 |
| 516 | 3300006178 | Ga0075367_10425883 | Ga0075367_104258831 | 108 |
| 517 | 3300006186 | Ga0075369_10029118 | Ga0075369_100291182 | 108 |
| 518 | 3300006186 | Ga0075369_10310598 | Ga0075369_103105982 | 108 |
| 519 | 3300006186 | Ga0075369_10495105 | Ga0075369_104951052 | 108 |
| 520 | 3300006195 | Ga0075366_10003832 | Ga0075366_100038321 | 108 |
| 521 | 3300006195 | Ga0075366_10191871 | Ga0075366_101918712 | 108 |
| 522 | 3300006195 | Ga0075366_10223416 | Ga0075366_102234162 | 108 |
| 523 | 3300006195 | Ga0075366_10702648 | Ga0075366_107026481 | 108 |
| 524 | 3300006195 | Ga0075366_10980056 | Ga0075366_109800562 | 108 |
| 525 | 3300006353 | Ga0075370_10111276 | Ga0075370_101112762 | 108 |
| 526 | 3300006353 | Ga0075370_10428665 | Ga0075370_104286652 | 108 |
| 527 | 3300006844 | Ga0075428_101349636 | Ga0075428_1013496361 | 108 |
| 528 | 3300006844 | Ga0075428_102042025 | Ga0075428_1020420252 | 108 |
| 529 | 3300006846 | Ga0075430_100315400 | Ga0075430_1003154001 | 108 |
| 530 | 3300006846 | Ga0075430_100635753 | Ga0075430_1006357532 | 108 |
| 531 | 3300006846 | Ga0075430_101796853 | Ga0075430_1017968531 | 108 |
| 532 | 3300006847 | Ga0075431_100217230 | Ga0075431_1002172302 | 108 |
| 533 | 3300006847 | Ga0075431_101929329 | Ga0075431_1019293292 | 108 |
| 534 | 3300006871 | Ga0075434_100825207 | Ga0075434_1008252071 | 108 |
| 535 | 3300006881 | Ga0068865_100068815 | Ga0068865_1000688152 | 108 |
| 536 | 3300006931 | Ga0097620_100207870 | Ga0097620_1002078702 | 108 |
| 537 | 3300006931 | Ga0097620_101183088 | Ga0097620_1011830881 | 108 |
| 538 | 3300009093 | Ga0105240_11836601 | Ga0105240_118366011 | 108 |
| 539 | 3300009094 | Ga0111539_10772926 | Ga0111539_107729262 | 108 |
| 540 | 3300009094 | Ga0111539_11179906 | Ga0111539_111799062 | 108 |
| 541 | 3300009094 | Ga0111539_11249317 | Ga0111539_112493171 | 108 |
| 542 | 3300009098 | Ga0105245_10089093 | Ga0105245_100890932 | 108 |
| 543 | 3300009098 | Ga0105245_12678660 | Ga0105245_126786601 | 108 |
| 544 | 3300009101 | Ga0105247_10106654 | Ga0105247_101066542 | 108 |
| 545 | 3300009147 | Ga0114129_10532367 | Ga0114129_105323672 | 108 |
| 546 | 3300009147 | Ga0114129_11938248 | Ga0114129_119382482 | 108 |
| 547 | 3300009148 | Ga0105243_10120148 | Ga0105243_101201482 | 108 |
| 548 | 3300009148 | Ga0105243_10538936 | Ga0105243_105389362 | 108 |
| 549 | 3300009148 | Ga0105243_11419579 | Ga0105243_114195792 | 108 |
| 550 | 3300009148 | Ga0105243_12048742 | Ga0105243_120487422 | 108 |
| 551 | 3300009148 | Ga0105243_12330739 | Ga0105243_123307391 | 108 |
| 552 | 3300009174 | Ga0105241_10773668 | Ga0105241_107736681 | 108 |
| 553 | 3300009176 | Ga0105242_10028530 | Ga0105242_100285301 | 108 |
| 554 | 3300009176 | Ga0105242_10126286 | Ga0105242_101262861 | 108 |
| 555 | 3300009176 | Ga0105242_10915164 | Ga0105242_109151642 | 108 |
| 556 | 3300009176 | Ga0105242_13081227 | Ga0105242_130812272 | 108 |
| 557 | 3300009545 | Ga0105237_11122493 | Ga0105237_111224931 | 108 |
| 558 | 3300009551 | Ga0105238_10052564 | Ga0105238_100525643 | 108 |
| 559 | 3300009551 | Ga0105238_12076525 | Ga0105238_120765252 | 108 |
| 560 | 3300009553 | Ga0105249_12103459 | Ga0105249_121034591 | 108 |
| 561 | 3300009986 | Ga0105033_127389 | Ga0105033_1273892 | 108 |
| 562 | 3300010375 | Ga0105239_11511145 | Ga0105239_115111452 | 108 |
| 563 | 3300010375 | Ga0105239_12711056 | Ga0105239_127110562 | 108 |
| 564 | 3300011119 | Ga0105246_10574124 | Ga0105246_105741242 | 108 |
| 565 | 3300011119 | Ga0105246_11068936 | Ga0105246_110689362 | 108 |
| 566 | 3300011119 | Ga0105246_11204281 | Ga0105246_112042812 | 108 |
| 567 | 3300013296 | Ga0157374_11751972 | Ga0157374_117519722 | 108 |
| 568 | 3300013297 | Ga0157378_10652755 | Ga0157378_106527552 | 108 |
| 569 | 3300013297 | Ga0157378_10719677 | Ga0157378_107196772 | 108 |
| 570 | 3300013297 | Ga0157378_11053755 | Ga0157378_110537552 | 108 |
| 571 | 3300013297 | Ga0157378_11626389 | Ga0157378_116263892 | 108 |
| 572 | 3300013297 | Ga0157378_11969916 | Ga0157378_119699161 | 108 |
| 573 | 3300013306 | Ga0163162_10264081 | Ga0163162_102640812 | 108 |
| 574 | 3300013306 | Ga0163162_11589783 | Ga0163162_115897831 | 108 |
| 575 | 3300013307 | Ga0157372_10265167 | Ga0157372_102651671 | 108 |
| 576 | 3300013308 | Ga0157375_10095534 | Ga0157375_100955344 | 108 |
| 577 | 3300013308 | Ga0157375_10613731 | Ga0157375_106137312 | 108 |
| 578 | 3300013308 | Ga0157375_11647247 | Ga0157375_116472472 | 108 |
| 579 | 3300013308 | Ga0157375_12373474 | Ga0157375_123734741 | 108 |
| 580 | 3300014325 | Ga0163163_10274635 | Ga0163163_102746352 | 108 |
| 581 | 3300014325 | Ga0163163_10376107 | Ga0163163_103761072 | 108 |
| 582 | 3300014325 | Ga0163163_11554449 | Ga0163163_115544492 | 108 |
| 583 | 3300014325 | Ga0163163_11737403 | Ga0163163_117374032 | 108 |
| 584 | 3300014326 | Ga0157380_10233581 | Ga0157380_102335812 | 108 |
| 585 | 3300014326 | Ga0157380_10238944 | Ga0157380_102389442 | 108 |
| 586 | 3300014326 | Ga0157380_10354008 | Ga0157380_103540083 | 108 |
| 587 | 3300014326 | Ga0157380_10399625 | Ga0157380_103996252 | 108 |
| 588 | 3300014326 | Ga0157380_10560860 | Ga0157380_105608601 | 108 |
| 589 | 3300014326 | Ga0157380_11350319 | Ga0157380_113503192 | 108 |
| 590 | 3300014968 | Ga0157379_10689022 | Ga0157379_106890222 | 108 |
| 591 | 3300014968 | Ga0157379_10767813 | Ga0157379_107678131 | 108 |
| 592 | 3300014968 | Ga0157379_11487286 | Ga0157379_114872862 | 108 |
| 593 | 3300014968 | Ga0157379_12214182 | Ga0157379_122141821 | 108 |
| 594 | 3300014969 | Ga0157376_10218970 | Ga0157376_102189702 | 108 |
| 595 | 3300014969 | Ga0157376_10528577 | Ga0157376_105285772 | 108 |
| 596 | 3300017792 | Ga0163161_10239411 | Ga0163161_102394112 | 108 |
| 597 | 3300017792 | Ga0163161_10556768 | Ga0163161_105567682 | 108 |
| 598 | 3300017792 | Ga0163161_11150669 | Ga0163161_111506692 | 108 |
| 599 | 3300017792 | Ga0163161_11417323 | Ga0163161_114173232 | 108 |
| 600 | 3300021358 | Ga0213873_10151259 | Ga0213873_101512592 | 108 |
| 601 | 3300025297 | Ga0209758_1000217 | Ga0209758_100021769 | 108 |
| 602 | 3300025315 | Ga0207697_10068546 | Ga0207697_100685463 | 108 |
| 603 | 3300025315 | Ga0207697_10519618 | Ga0207697_105196181 | 108 |
| 604 | 3300025893 | Ga0207682_10004236 | Ga0207682_100042365 | 108 |
| 605 | 3300025901 | Ga0207688_10108544 | Ga0207688_101085442 | 108 |
| 606 | 3300025901 | Ga0207688_10238838 | Ga0207688_102388382 | 108 |
| 607 | 3300025901 | Ga0207688_10274329 | Ga0207688_102743292 | 108 |
| 608 | 3300025901 | Ga0207688_10381604 | Ga0207688_103816042 | 108 |
| 609 | 3300025903 | Ga0207680_10763552 | Ga0207680_107635522 | 108 |
| 610 | 3300025907 | Ga0207645_10158842 | Ga0207645_101588423 | 108 |
| 611 | 3300025907 | Ga0207645_10902106 | Ga0207645_109021062 | 108 |
| 612 | 3300025908 | Ga0207643_10052375 | Ga0207643_100523754 | 108 |
| 613 | 3300025909 | Ga0207705_10446602 | Ga0207705_104466022 | 108 |
| 614 | 3300025912 | Ga0207707_11115763 | Ga0207707_111157632 | 108 |
| 615 | 3300025914 | Ga0207671_10909534 | Ga0207671_109095342 | 108 |
| 616 | 3300025917 | Ga0207660_10033192 | Ga0207660_100331922 | 108 |
| 617 | 3300025917 | Ga0207660_10159978 | Ga0207660_101599782 | 108 |
| 618 | 3300025918 | Ga0207662_10789813 | Ga0207662_107898131 | 108 |
| 619 | 3300025919 | Ga0207657_10036283 | Ga0207657_100362835 | 108 |
| 620 | 3300025920 | Ga0207649_10812100 | Ga0207649_108121002 | 108 |
| 621 | 3300025920 | Ga0207649_10879712 | Ga0207649_108797122 | 108 |
| 622 | 3300025921 | Ga0207652_10087919 | Ga0207652_100879194 | 108 |
| 623 | 3300025921 | Ga0207652_11013140 | Ga0207652_110131402 | 108 |
| 624 | 3300025923 | Ga0207681_10504468 | Ga0207681_105044682 | 108 |
| 625 | 3300025924 | Ga0207694_10034613 | Ga0207694_100346132 | 108 |
| 626 | 3300025924 | Ga0207694_10785825 | Ga0207694_107858252 | 108 |
| 627 | 3300025925 | Ga0207650_10072997 | Ga0207650_100729971 | 108 |
| 628 | 3300025925 | Ga0207650_10571018 | Ga0207650_105710182 | 108 |
| 629 | 3300025926 | Ga0207659_10248543 | Ga0207659_102485432 | 108 |
| 630 | 3300025926 | Ga0207659_10427521 | Ga0207659_104275212 | 108 |
| 631 | 3300025927 | Ga0207687_10073143 | Ga0207687_100731432 | 108 |
| 632 | 3300025927 | Ga0207687_10082073 | Ga0207687_100820732 | 108 |
| 633 | 3300025928 | Ga0207700_11057627 | Ga0207700_110576271 | 108 |
| 634 | 3300025931 | Ga0207644_10816364 | Ga0207644_108163642 | 108 |
| 635 | 3300025931 | Ga0207644_11353943 | Ga0207644_113539432 | 108 |
| 636 | 3300025932 | Ga0207690_10226205 | Ga0207690_102262051 | 108 |
| 637 | 3300025932 | Ga0207690_10701773 | Ga0207690_107017732 | 108 |
| 638 | 3300025933 | Ga0207706_10193394 | Ga0207706_101933943 | 108 |
| 639 | 3300025933 | Ga0207706_10687813 | Ga0207706_106878132 | 108 |
| 640 | 3300025934 | Ga0207686_10472432 | Ga0207686_104724321 | 108 |
| 641 | 3300025934 | Ga0207686_10507210 | Ga0207686_105072102 | 108 |
| 642 | 3300025934 | Ga0207686_10807081 | Ga0207686_108070812 | 108 |
| 643 | 3300025934 | Ga0207686_11402580 | Ga0207686_114025801 | 108 |
| 644 | 3300025935 | Ga0207709_10427329 | Ga0207709_104273292 | 108 |
| 645 | 3300025935 | Ga0207709_11354802 | Ga0207709_113548022 | 108 |
| 646 | 3300025936 | Ga0207670_10261065 | Ga0207670_102610652 | 108 |
| 647 | 3300025936 | Ga0207670_10513944 | Ga0207670_105139442 | 108 |
| 648 | 3300025936 | Ga0207670_11510678 | Ga0207670_115106781 | 108 |
| 649 | 3300025937 | Ga0207669_10131129 | Ga0207669_101311292 | 108 |
| 650 | 3300025937 | Ga0207669_10321847 | Ga0207669_103218473 | 108 |
| 651 | 3300025937 | Ga0207669_10690468 | Ga0207669_106904682 | 108 |
| 652 | 3300025937 | Ga0207669_11084327 | Ga0207669_110843271 | 108 |
| 653 | 3300025937 | Ga0207669_11085933 | Ga0207669_110859332 | 108 |
| 654 | 3300025938 | Ga0207704_10081617 | Ga0207704_100816172 | 108 |
| 655 | 3300025938 | Ga0207704_11935384 | Ga0207704_119353842 | 108 |
| 656 | 3300025939 | Ga0207665_10158317 | Ga0207665_101583173 | 108 |
| 657 | 3300025939 | Ga0207665_11000299 | Ga0207665_110002991 | 108 |
| 658 | 3300025940 | Ga0207691_10000889 | Ga0207691_100008894 | 108 |
| 659 | 3300025941 | Ga0207711_10145410 | Ga0207711_101454102 | 108 |
| 660 | 3300025942 | Ga0207689_10219148 | Ga0207689_102191483 | 108 |
| 661 | 3300025942 | Ga0207689_11515400 | Ga0207689_115154002 | 108 |
| 662 | 3300025944 | Ga0207661_12089559 | Ga0207661_120895591 | 108 |
| 663 | 3300025945 | Ga0207679_10467741 | Ga0207679_104677412 | 108 |
| 664 | 3300025945 | Ga0207679_11072224 | Ga0207679_110722242 | 108 |
| 665 | 3300025960 | Ga0207651_10088947 | Ga0207651_100889472 | 108 |
| 666 | 3300025960 | Ga0207651_10120816 | Ga0207651_101208162 | 108 |
| 667 | 3300025960 | Ga0207651_11039147 | Ga0207651_110391472 | 108 |
| 668 | 3300025961 | Ga0207712_10114548 | Ga0207712_101145482 | 108 |
| 669 | 3300025961 | Ga0207712_10505893 | Ga0207712_105058932 | 108 |
| 670 | 3300025972 | Ga0207668_10130855 | Ga0207668_101308552 | 108 |
| 671 | 3300025972 | Ga0207668_10807762 | Ga0207668_108077622 | 108 |
| 672 | 3300025986 | Ga0207658_10097946 | Ga0207658_100979462 | 108 |
| 673 | 3300026023 | Ga0207677_10360834 | Ga0207677_103608341 | 108 |
| 674 | 3300026023 | Ga0207677_10377408 | Ga0207677_103774082 | 108 |
| 675 | 3300026023 | Ga0207677_10992209 | Ga0207677_109922092 | 108 |
| 676 | 3300026035 | Ga0207703_10801611 | Ga0207703_108016111 | 108 |
| 677 | 3300026041 | Ga0207639_10486751 | Ga0207639_104867511 | 108 |
| 678 | 3300026041 | Ga0207639_11320472 | Ga0207639_113204722 | 108 |
| 679 | 3300026041 | Ga0207639_11752006 | Ga0207639_117520062 | 108 |
| 680 | 3300026067 | Ga0207678_10215433 | Ga0207678_102154332 | 108 |
| 681 | 3300026075 | Ga0207708_10267660 | Ga0207708_102676602 | 108 |
| 682 | 3300026075 | Ga0207708_10630715 | Ga0207708_106307152 | 108 |
| 683 | 3300026078 | Ga0207702_11269118 | Ga0207702_112691182 | 108 |
| 684 | 3300026088 | Ga0207641_11200030 | Ga0207641_112000301 | 108 |
| 685 | 3300026089 | Ga0207648_10018063 | Ga0207648_100180633 | 108 |
| 686 | 3300026089 | Ga0207648_11208915 | Ga0207648_112089151 | 108 |
| 687 | 3300026095 | Ga0207676_10077147 | Ga0207676_100771474 | 108 |
| 688 | 3300026095 | Ga0207676_10714352 | Ga0207676_107143522 | 108 |
| 689 | 3300026116 | Ga0207674_10030080 | Ga0207674_100300803 | 108 |
| 690 | 3300026116 | Ga0207674_10472557 | Ga0207674_104725572 | 108 |
| 691 | 3300026118 | Ga0207675_100087107 | Ga0207675_1000871072 | 108 |
| 692 | 3300026121 | Ga0207683_10010378 | Ga0207683_100103788 | 108 |
| 693 | 3300026121 | Ga0207683_10013613 | Ga0207683_100136136 | 108 |
| 694 | 3300026142 | Ga0207698_10459905 | Ga0207698_104599052 | 108 |
| 695 | 3300027866 | Ga0209813_10256961 | Ga0209813_102569611 | 108 |
| 696 | 3300027907 | Ga0207428_10110162 | Ga0207428_101101622 | 108 |
| 697 | 3300028379 | Ga0268266_10207967 | Ga0268266_102079672 | 108 |
| 698 | 3300028379 | Ga0268266_12309932 | Ga0268266_123099321 | 108 |
| 699 | 3300028380 | Ga0268265_11362447 | Ga0268265_113624472 | 108 |
| 700 | 3300028380 | Ga0268265_11911601 | Ga0268265_119116011 | 108 |
| 701 | 3300028381 | Ga0268264_10433727 | Ga0268264_104337272 | 108 |
| 702 | 3300031241 | Ga0265325_10000492 | Ga0265325_100004922 | 108 |
| 703 | 3300031247 | Ga0265340_10038117 | Ga0265340_100381172 | 108 |
| 704 | 3300031247 | Ga0265340_10076710 | Ga0265340_100767102 | 108 |
| 705 | 3300031344 | Ga0265316_10048868 | Ga0265316_100488682 | 108 |
| 706 | 3300031344 | Ga0265316_10092702 | Ga0265316_100927022 | 108 |
| 707 | 3300031456 | Ga0307513_10248609 | Ga0307513_102486092 | 108 |
| 708 | 3300031456 | Ga0307513_10618677 | Ga0307513_106186772 | 108 |
| 709 | 3300031507 | Ga0307509_10815100 | Ga0307509_108151002 | 108 |
| 710 | 3300031548 | Ga0307408_100903089 | Ga0307408_1009030892 | 108 |
| 711 | 3300031712 | Ga0265342_10057614 | Ga0265342_100576144 | 108 |
| 712 | 3300031901 | Ga0307406_10458211 | Ga0307406_104582112 | 108 |
| 713 | 3300031911 | Ga0307412_11666693 | Ga0307412_116666932 | 108 |
| 714 | 3300031911 | Ga0307412_12308429 | Ga0307412_123084292 | 108 |
| 715 | 3300032005 | Ga0307411_11355194 | Ga0307411_113551941 | 108 |
| 716 | 3300032126 | Ga0307415_102467610 | Ga0307415_1024676101 | 108 |
| 717 | 3300035090 | Ga0373949_0048777 | Ga0373949_0048777_27_353 | 108 |
| 718 | 3300035121 | Ga0373960_0335040 | Ga0373960_0335040_70_399 | 108 |
| 719 | 3300035398 | Ga0316574_0241910 | Ga0316574_0241910_154_489 | 108 |
| 720 | 3300035691 | Ga0373931_0455752 | Ga0373931_0455752_383_709 | 108 |
| 721 | 3300037471 | Ga0395905_0571708 | Ga0395905_0571708_455_781 | 108 |
| 722 | 3300039437 | Ga0436365_0755682 | Ga0436365_0755682_138_470 | 108 |
| 723 | 3300039437 | Ga0436365_1252986 | Ga0436365_1252986_466_798 | 108 |
| 724 | 3300039437 | Ga0436365_1289747 | Ga0436365_1289747_253_579 | 108 |
| 725 | 3300039437 | Ga0436365_1651064 | Ga0436365_1651064_3388_3720 | 108 |
| 726 | 3300039453 | Ga0436362_0604495 | Ga0436362_0604495_300_632 | 108 |
| 727 | 3300041406 | Ga0439439_0235279 | Ga0439439_0235279_46_375 | 108 |
| 728 | 3300041408 | Ga0439453_0016915 | Ga0439453_0016915_834_1160 | 108 |
| 729 | 3300041408 | Ga0439453_0027963 | Ga0439453_0027963_680_1009 | 108 |
| 730 | 3300041408 | Ga0439453_0039775 | Ga0439453_0039775_167_493 | 108 |
| 731 | 3300041410 | Ga0439461_0071616 | Ga0439461_0071616_337_669 | 108 |
| 732 | 3300041451 | Ga0451791_0426884 | Ga0451791_0426884_33_362 | 108 |
| 733 | 3300041509 | Ga0451843_0427283 | Ga0451843_0427283_74_400 | 108 |
| 734 | 3300042001 | Ga0439441_008039 | Ga0439441_008039_692_1024 | 108 |
| 735 | 3300042001 | Ga0439441_130143 | Ga0439441_130143_50_376 | 108 |
| 736 | 3300042003 | Ga0439443_028971 | Ga0439443_028971_523_855 | 108 |
| 737 | 3300042156 | Ga0439446_0027497 | Ga0439446_0027497_39_371 | 108 |
| 738 | 3300042435 | Ga0439434_0212964 | Ga0439434_0212964_41_373 | 108 |
| 739 | 3300042436 | Ga0439435_0019364 | Ga0439435_0019364_1015_1347 | 108 |
| 740 | 3300042437 | Ga0439444_0016539 | Ga0439444_0016539_401_733 | 108 |
| 741 | 3300042439 | Ga0439464_0056449 | Ga0439464_0056449_474_806 | 108 |
| 742 | 3300042993 | Ga0439440_0027727 | Ga0439440_0027727_646_978 | 108 |
| 743 | 3300045976 | Ga0466967_0234889 | Ga0466967_0234889_1267_1599 | 108 |
| 744 | 3300046455 | Ga0495603_0281648 | Ga0495603_0281648_440_772 | 108 |
| 745 | 3300046459 | Ga0495629_0947594 | Ga0495629_0947594_35_418 | 108 |
| 746 | 3300046460 | Ga0495638_0050217 | Ga0495638_0050217_920_1252 | 108 |
| 747 | 3300046474 | Ga0495605_0143411 | Ga0495605_0143411_611_943 | 108 |
| 748 | 3300046500 | Ga0495596_0332611 | Ga0495596_0332611_97_423 | 108 |
| 749 | 3300046525 | Ga0495663_0117853 | Ga0495663_0117853_369_701 | 108 |
| 750 | 3300046537 | Ga0495598_0025940 | Ga0495598_0025940_444_776 | 108 |
| 751 | 3300046615 | Ga0495656_0008096 | Ga0495656_0008096_1734_2066 | 108 |
| 752 | 3300047315 | Ga0495581_0765410 | Ga0495581_0765410_131_463 | 108 |
| 753 | 3300047318 | Ga0495636_0142587 | Ga0495636_0142587_516_848 | 108 |
| 754 | 3300047469 | Ga0495673_0297914 | Ga0495673_0297914_13_345 | 108 |
| 755 | 3300047472 | Ga0495686_0452624 | Ga0495686_0452624_26_361 | 108 |
| 756 | 3300048090 | Ga0495615_0120012 | Ga0495615_0120012_415_747 | 108 |
| 757 | 3300048903 | Ga0496100_0032369 | Ga0496100_0032369_34_366 | 108 |
| 758 | 3300048903 | Ga0496100_0412854 | Ga0496100_0412854_23_352 | 108 |
| 759 | 3300048903 | Ga0496100_0756373 | Ga0496100_0756373_395_721 | 108 |
| 760 | 3300048904 | Ga0496101_0379805 | Ga0496101_0379805_132_461 | 108 |
| 761 | 3300048905 | Ga0496102_0183530 | Ga0496102_0183530_1070_1399 | 108 |
| 762 | 3300048905 | Ga0496102_0317457 | Ga0496102_0317457_963_1292 | 108 |
| 763 | 3300048907 | Ga0496104_0002236 | Ga0496104_0002236_6777_7106 | 108 |
| 764 | 3300048907 | Ga0496104_0015358 | Ga0496104_0015358_2327_2656 | 108 |
| 765 | 3300048907 | Ga0496104_0224291 | Ga0496104_0224291_1017_1346 | 108 |
| 766 | 3300048908 | Ga0496105_0007126 | Ga0496105_0007126_3201_3530 | 108 |
| 767 | 3300048908 | Ga0496105_0087197 | Ga0496105_0087197_2110_2439 | 108 |
| 768 | 3300048909 | Ga0496106_0063854 | Ga0496106_0063854_1799_2128 | 108 |
| 769 | 3300048909 | Ga0496106_0316621 | Ga0496106_0316621_668_997 | 108 |
| 770 | 3300048909 | Ga0496106_1517416 | Ga0496106_1517416_178_504 | 108 |
| 771 | 3300048910 | Ga0496107_0095771 | Ga0496107_0095771_1472_1801 | 108 |
| 772 | 3300048911 | Ga0496108_0106953 | Ga0496108_0106953_1215_1541 | 108 |
| 773 | 3300048911 | Ga0496108_0259668 | Ga0496108_0259668_567_896 | 108 |
| 774 | 3300048912 | Ga0496109_0109600 | Ga0496109_0109600_2222_2551 | 108 |
| 775 | 3300048912 | Ga0496109_0375569 | Ga0496109_0375569_143_469 | 108 |
| 776 | 3300048913 | Ga0496110_0395208 | Ga0496110_0395208_97_426 | 108 |
| 777 | 3300048913 | Ga0496110_0638454 | Ga0496110_0638454_496_822 | 108 |
| 778 | 3300048913 | Ga0496110_1517974 | Ga0496110_1517974_37_369 | 108 |
| 779 | 3300048915 | Ga0496112_0231140 | Ga0496112_0231140_87_416 | 108 |
| 780 | 3300048915 | Ga0496112_0356470 | Ga0496112_0356470_793_1119 | 108 |
| 781 | 3300048915 | Ga0496112_1872157 | Ga0496112_1872157_159_488 | 108 |
| 782 | 3300048916 | Ga0496113_0148934 | Ga0496113_0148934_219_548 | 108 |
| 783 | 3300048916 | Ga0496113_0319178 | Ga0496113_0319178_475_804 | 108 |
| 784 | 3300048917 | Ga0496114_0830785 | Ga0496114_0830785_123_452 | 108 |
| 785 | 3300048917 | Ga0496114_1583171 | Ga0496114_1583171_34_360 | 108 |
| 786 | 3300048918 | Ga0496115_0010124 | Ga0496115_0010124_1603_1932 | 108 |
| 787 | 3300048918 | Ga0496115_0042092 | Ga0496115_0042092_1745_2074 | 108 |
| 788 | 3300048918 | Ga0496115_0164982 | Ga0496115_0164982_1321_1653 | 108 |
| 789 | 3300049568 | Ga0501031_0350544 | Ga0501031_0350544_92_421 | 108 |
| 790 | 3300049569 | Ga0501032_0022475 | Ga0501032_0022475_1967_2293 | 108 |
| 791 | 3300049570 | Ga0501033_0034246 | Ga0501033_0034246_1493_1843 | 108 |
| 792 | 3300049570 | Ga0501033_0051505 | Ga0501033_0051505_1966_2292 | 108 |
| 793 | 3300049571 | Ga0501034_0187416 | Ga0501034_0187416_256_585 | 108 |
| 794 | 3300049571 | Ga0501034_0189550 | Ga0501034_0189550_404_730 | 108 |
| 795 | 3300049571 | Ga0501034_0219409 | Ga0501034_0219409_394_720 | 108 |
| 796 | 3300049571 | Ga0501034_0679670 | Ga0501034_0679670_579_905 | 108 |
| 797 | 3300049571 | Ga0501034_1259757 | Ga0501034_1259757_205_591 | 108 |
| 798 | 3300049572 | Ga0501036_0072422 | Ga0501036_0072422_1470_1796 | 108 |
| 799 | 3300049572 | Ga0501036_0420616 | Ga0501036_0420616_187_537 | 108 |
| 800 | 3300049572 | Ga0501036_1364045 | Ga0501036_1364045_92_424 | 108 |
| 801 | 3300049573 | Ga0501037_0003013 | Ga0501037_0003013_3370_3696 | 108 |
| 802 | 3300049573 | Ga0501037_0298615 | Ga0501037_0298615_239_589 | 108 |
| 803 | 3300049574 | Ga0501038_0040986 | Ga0501038_0040986_1652_1978 | 108 |
| 804 | 3300049574 | Ga0501038_0123626 | Ga0501038_0123626_1274_1624 | 108 |
| 805 | 3300049574 | Ga0501038_1262943 | Ga0501038_1262943_181_507 | 108 |
| 806 | 3300049575 | Ga0501039_0012604 | Ga0501039_0012604_2767_3093 | 108 |
| 807 | 3300049575 | Ga0501039_0093853 | Ga0501039_0093853_544_873 | 108 |
| 808 | 3300049575 | Ga0501039_0165302 | Ga0501039_0165302_851_1177 | 108 |
| 809 | 3300049576 | Ga0501040_0411503 | Ga0501040_0411503_41_370 | 108 |
| 810 | 3300049576 | Ga0501040_1164593 | Ga0501040_1164593_160_489 | 108 |
| 811 | 3300049577 | Ga0501041_0401512 | Ga0501041_0401512_174_515 | 108 |
| 812 | 3300049578 | Ga0501042_0045932 | Ga0501042_0045932_682_1008 | 108 |
| 813 | 3300049578 | Ga0501042_0167681 | Ga0501042_0167681_427_768 | 108 |
| 814 | 3300049579 | Ga0501043_0132534 | Ga0501043_0132534_630_980 | 108 |
| 815 | 3300049579 | Ga0501043_0190807 | Ga0501043_0190807_80_406 | 108 |
| 816 | 3300049579 | Ga0501043_0621027 | Ga0501043_0621027_314_640 | 108 |
| 817 | 3300049580 | Ga0501046_0035916 | Ga0501046_0035916_1378_1719 | 108 |
| 818 | 3300049580 | Ga0501046_0096383 | Ga0501046_0096383_612_938 | 108 |
| 819 | 3300049581 | Ga0501047_0136974 | Ga0501047_0136974_568_918 | 108 |
| 820 | 3300049581 | Ga0501047_0162134 | Ga0501047_0162134_664_990 | 108 |
| 821 | 3300049581 | Ga0501047_0353517 | Ga0501047_0353517_674_1000 | 108 |
| 822 | 3300049581 | Ga0501047_1132811 | Ga0501047_1132811_114_440 | 108 |
| 823 | 3300049582 | Ga0501048_0020394 | Ga0501048_0020394_1355_1681 | 108 |
| 824 | 3300049582 | Ga0501048_0146814 | Ga0501048_0146814_427_768 | 108 |
| 825 | 3300049582 | Ga0501048_0592618 | Ga0501048_0592618_19_348 | 108 |
| 826 | 3300049583 | Ga0501067_0056276 | Ga0501067_0056276_600_926 | 108 |
| 827 | 3300049584 | Ga0501068_0151513 | Ga0501068_0151513_207_533 | 108 |
| 828 | 3300049585 | Ga0501069_0112454 | Ga0501069_0112454_108_434 | 108 |
| 829 | 3300049586 | Ga0501070_0009260 | Ga0501070_0009260_7276_7626 | 108 |
| 830 | 3300049586 | Ga0501070_0172082 | Ga0501070_0172082_1195_1521 | 108 |
| 831 | 3300049587 | Ga0501071_0078678 | Ga0501071_0078678_1383_1709 | 108 |
| 832 | 3300049587 | Ga0501071_0116039 | Ga0501071_0116039_605_934 | 108 |
| 833 | 3300049587 | Ga0501071_0188311 | Ga0501071_0188311_243_569 | 108 |
| 834 | 3300049587 | Ga0501071_1125318 | Ga0501071_1125318_33_362 | 108 |
| 835 | 3300049588 | Ga0501072_0005240 | Ga0501072_0005240_1548_1880 | 108 |
| 836 | 3300049588 | Ga0501072_0192649 | Ga0501072_0192649_1084_1410 | 108 |
| 837 | 3300049588 | Ga0501072_0514449 | Ga0501072_0514449_68_394 | 108 |
| 838 | 3300049589 | Ga0501073_0029808 | Ga0501073_0029808_394_720 | 108 |
| 839 | 3300049589 | Ga0501073_0282529 | Ga0501073_0282529_219_545 | 108 |
| 840 | 3300049590 | Ga0501074_0155885 | Ga0501074_0155885_642_968 | 108 |
| 841 | 3300049590 | Ga0501074_0678135 | Ga0501074_0678135_97_429 | 108 |
| 842 | 3300049591 | Ga0501075_0165221 | Ga0501075_0165221_1198_1524 | 108 |
| 843 | 3300049591 | Ga0501075_0417884 | Ga0501075_0417884_436_777 | 108 |
| 844 | 3300049591 | Ga0501075_0536198 | Ga0501075_0536198_543_872 | 108 |
| 845 | 3300049591 | Ga0501075_0909463 | Ga0501075_0909463_158_484 | 108 |
| 846 | 3300049592 | Ga0501076_0157801 | Ga0501076_0157801_594_920 | 108 |
| 847 | 3300049592 | Ga0501076_0222639 | Ga0501076_0222639_595_924 | 108 |
| 848 | 3300049592 | Ga0501076_0226131 | Ga0501076_0226131_619_948 | 108 |
| 849 | 3300049592 | Ga0501076_1355418 | Ga0501076_1355418_240_566 | 108 |
| 850 | 3300049593 | Ga0501077_0092185 | Ga0501077_0092185_782_1108 | 108 |
| 851 | 3300049593 | Ga0501077_0654797 | Ga0501077_0654797_45_371 | 108 |
| 852 | 3300049593 | Ga0501077_0678480 | Ga0501077_0678480_285_614 | 108 |
| 853 | 3300049593 | Ga0501077_1005037 | Ga0501077_1005037_38_364 | 108 |
| 854 | 3300049593 | Ga0501077_1120002 | Ga0501077_1120002_161_490 | 108 |
| 855 | 3300049741 | Ga0501079_0052864 | Ga0501079_0052864_1983_2309 | 108 |
| 856 | 3300049741 | Ga0501079_0208242 | Ga0501079_0208242_325_651 | 108 |
| 857 | 3300049741 | Ga0501079_0510527 | Ga0501079_0510527_412_741 | 108 |
| 858 | 3300049742 | Ga0501080_0020013 | Ga0501080_0020013_822_1172 | 108 |
| 859 | 3300049742 | Ga0501080_0073111 | Ga0501080_0073111_189_515 | 108 |
| 860 | 3300049742 | Ga0501080_0108802 | Ga0501080_0108802_1246_1572 | 108 |
| 861 | 3300049742 | Ga0501080_0230623 | Ga0501080_0230623_664_990 | 108 |
| 862 | 3300049742 | Ga0501080_1644127 | Ga0501080_1644127_140_469 | 108 |
| 863 | 3300049743 | Ga0501081_0140554 | Ga0501081_0140554_668_997 | 108 |
| 864 | 3300049743 | Ga0501081_0264421 | Ga0501081_0264421_814_1140 | 108 |
| 865 | 3300049743 | Ga0501081_0704708 | Ga0501081_0704708_244_573 | 108 |
| 866 | 3300049743 | Ga0501081_1121583 | Ga0501081_1121583_67_396 | 108 |
| 867 | 3300049743 | Ga0501081_1520025 | Ga0501081_1520025_150_476 | 108 |
| 868 | 3300049744 | Ga0501083_0017239 | Ga0501083_0017239_3212_3538 | 108 |
| 869 | 3300049822 | Ga0501035_0019125 | Ga0501035_0019125_4969_5319 | 108 |
| 870 | 3300049822 | Ga0501035_0280386 | Ga0501035_0280386_926_1252 | 108 |
| 871 | 3300049822 | Ga0501035_0809646 | Ga0501035_0809646_167_499 | 108 |
| 872 | 3300049823 | Ga0501044_0000140 | Ga0501044_0000140_56135_56461 | 108 |
| 873 | 3300049823 | Ga0501044_0140214 | Ga0501044_0140214_1091_1417 | 108 |
| 874 | 3300049823 | Ga0501044_0497508 | Ga0501044_0497508_701_1027 | 108 |
| 875 | 3300049823 | Ga0501044_1344427 | Ga0501044_1344427_120_458 | 108 |
| 876 | 3300049824 | Ga0501045_0022475 | Ga0501045_0022475_677_1003 | 108 |
| 877 | 3300049824 | Ga0501045_0528106 | Ga0501045_0528106_112_441 | 108 |
| 878 | 3300050489 | nmdc:mga03683_100192_c1 | nmdc:mga03683_100192_c1_294_626 | 108 |
| 879 | 3300050489 | nmdc:mga03683_589135_c1 | nmdc:mga03683_589135_c1_159_488 | 108 |
| 880 | 3300050489 | nmdc:mga03683_82153_c1 | nmdc:mga03683_82153_c1_586_915 | 108 |
| 881 | 3300050490 | nmdc:mga03n38_202881_c1 | nmdc:mga03n38_202881_c1_682_1008 | 108 |
| 882 | 3300050490 | nmdc:mga03n38_36002_c1 | nmdc:mga03n38_36002_c1_742_1071 | 108 |
| 883 | 3300050490 | nmdc:mga03n38_571265_c1 | nmdc:mga03n38_571265_c1_52_378 | 108 |
| 884 | 3300050492 | nmdc:mga0yw44_524966_c1 | nmdc:mga0yw44_524966_c1_447_776 | 108 |
| 885 | 3300050493 | nmdc:mga0k408_244099_c1 | nmdc:mga0k408_244099_c1_15_347 | 108 |
| 886 | 3300050493 | nmdc:mga0k408_275244_c1 | nmdc:mga0k408_275244_c1_136_465 | 108 |
| 887 | 3300050493 | nmdc:mga0k408_279892_c1 | nmdc:mga0k408_279892_c1_627_956 | 108 |
| 888 | 3300050493 | nmdc:mga0k408_323835_c1 | nmdc:mga0k408_323835_c1_57_386 | 108 |
| 889 | 3300050493 | nmdc:mga0k408_408468_c1 | nmdc:mga0k408_408468_c1_352_678 | 108 |
| 890 | 3300050493 | nmdc:mga0k408_49335_c1 | nmdc:mga0k408_49335_c1_672_998 | 108 |
| 891 | 3300050493 | nmdc:mga0k408_578242_c1 | nmdc:mga0k408_578242_c1_72_398 | 108 |
| 892 | 3300050494 | nmdc:mga06z11_138845_c1 | nmdc:mga06z11_138845_c1_982_1308 | 108 |
| 893 | 3300050494 | nmdc:mga06z11_297300_c1 | nmdc:mga06z11_297300_c1_100_426 | 108 |
| 894 | 3300050494 | nmdc:mga06z11_31578_c1 | nmdc:mga06z11_31578_c1_734_1063 | 108 |
| 895 | 3300050494 | nmdc:mga06z11_864954_c1 | nmdc:mga06z11_864954_c1_85_411 | 108 |
| 896 | 3300050496 | nmdc:mga07m45_33970_c1 | nmdc:mga07m45_33970_c1_296_625 | 108 |
| 897 | 3300050496 | nmdc:mga07m45_404620_c1 | nmdc:mga07m45_404620_c1_204_536 | 108 |
| 898 | 3300050507 | nmdc:mga05p37_457236_c1 | nmdc:mga05p37_457236_c1_860_1186 | 108 |
| 899 | 3300050509 | nmdc:mga0qj67_291231_c1 | nmdc:mga0qj67_291231_c1_664_990 | 108 |
| 900 | 3300050510 | nmdc:mga06r32_43346_c1 | nmdc:mga06r32_43346_c1_1003_1329 | 108 |
| 901 | 3300050511 | nmdc:mga08y16_700921_c1 | nmdc:mga08y16_700921_c1_479_808 | 108 |
| 902 | 3300050516 | nmdc:mga0sz30_336856_c1 | nmdc:mga0sz30_336856_c1_249_575 | 108 |
| 903 | 3300050516 | nmdc:mga0sz30_51680_c1 | nmdc:mga0sz30_51680_c1_1321_1650 | 108 |
| 904 | 3300053079 | Ga0500610_0280170 | Ga0500610_0280170_169_501 | 108 |
| 905 | 3300053086 | Ga0500578_0160559 | Ga0500578_0160559_246_578 | 108 |
| 906 | 3300053096 | Ga0500641_0026924 | Ga0500641_0026924_1864_2196 | 108 |
| 907 | 3300053096 | Ga0500641_0293434 | Ga0500641_0293434_90_419 | 108 |
| 908 | 3300053098 | Ga0500650_0182263 | Ga0500650_0182263_85_414 | 108 |
| 909 | 3300053108 | Ga0500562_044858 | Ga0500562_044858_71_400 | 108 |
| 910 | 3300053117 | Ga0500593_014188 | Ga0500593_014188_2113_2439 | 108 |
| 911 | 3300053119 | Ga0500595_043501 | Ga0500595_043501_368_697 | 108 |
| 912 | 3300053130 | Ga0500642_0169441 | Ga0500642_0169441_494_823 | 108 |
| 913 | 3300053131 | Ga0500652_144336 | Ga0500652_144336_262_591 | 108 |
| 914 | 3300053139 | Ga0500568_0174483 | Ga0500568_0174483_72_401 | 108 |
| 915 | 3300053142 | Ga0500577_0521560 | Ga0500577_0521560_64_396 | 108 |
| 916 | 3300053151 | Ga0500604_0069710 | Ga0500604_0069710_259_591 | 108 |
| 917 | 3300053153 | Ga0500616_0068500 | Ga0500616_0068500_759_1094 | 108 |
| 918 | 3300053153 | Ga0500616_0073614 | Ga0500616_0073614_1330_1659 | 108 |
| 919 | 3300053153 | Ga0500616_0129623 | Ga0500616_0129623_574_903 | 108 |
| 920 | 3300053158 | Ga0500627_0081998 | Ga0500627_0081998_952_1284 | 108 |
| 921 | 3300053158 | Ga0500627_0197702 | Ga0500627_0197702_111_437 | 108 |
| 922 | 3300053178 | Ga0500637_0459932 | Ga0500637_0459932_242_571 | 108 |
| 923 | 3300054114 | Ga0501084_0066185 | Ga0501084_0066185_1584_1910 | 108 |
| 924 | 3300054114 | Ga0501084_0172032 | Ga0501084_0172032_330_656 | 108 |
| 925 | 3300054114 | Ga0501084_0223698 | Ga0501084_0223698_873_1202 | 108 |
| 926 | 3300054114 | Ga0501084_0467581 | Ga0501084_0467581_318_647 | 108 |
| 927 | 3300054114 | Ga0501084_0480142 | Ga0501084_0480142_483_809 | 108 |
| 928 | 3300054114 | Ga0501084_1145262 | Ga0501084_1145262_24_356 | 108 |
| 929 | 3300060353 | Ga0501082_0000025 | Ga0501082_0000025_50991_51323 | 108 |
| 930 | 3300060353 | Ga0501082_0098054 | Ga0501082_0098054_1013_1339 | 108 |
| 931 | 3300060353 | Ga0501082_0102805 | Ga0501082_0102805_296_637 | 108 |
| 932 | 3300060353 | Ga0501082_0111040 | Ga0501082_0111040_896_1222 | 108 |
| 933 | 3300060353 | Ga0501082_0357520 | Ga0501082_0357520_737_1069 | 108 |
| 934 | 3300060353 | Ga0501082_0416113 | Ga0501082_0416113_461_790 | 108 |
| 935 | 3300060353 | Ga0501082_1068369 | Ga0501082_1068369_82_411 | 108 |
| 936 | 3300060353 | Ga0501082_1833241 | Ga0501082_1833241_47_373 | 108 |
| 937 | 3300061734 | Ga0530510_0102300 | Ga0530510_0102300_144_473 | 108 |
| 938 | 3300061734 | Ga0530510_0393853 | Ga0530510_0393853_38_367 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8499 | 3 | 107 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8475 | 3 | 108 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8416 | 3 | 108 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.832 | 3 | 108 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8193 | 3 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8475 | 3 | 108 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.832 | 3 | 108 | 2.60.40.10 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.7899 | 5 | 108 | 2.60.40.2470 |
| 4j3oD03 | Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein | 0.7714 | 46 | 103 | 2.60.40.3110 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7503 | 3 | 106 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1B118-F1-model_v4 | deleted | 0.844 | 43 | 108 |
|
| AF-A0A2M6VCV0-F1-model_v4 | Ig-like SoxY domain-containing protein | 0.8297 | 5 | 108 |
|
| AF-A0A651FJ43-F1-model_v4 | Sulfur oxidation protein | 0.8287 | 3 | 108 |
|
| AF-A0A6P1B118-F1-model_v4 | deleted | 0.8217 | 43 | 108 |
|
| AF-A0A522V9H2-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.82 | 1 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar