F486272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 417 | 1878 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10011335|Ga0070658_100113354 |
| Length | 150 |
| Sequence | MSETGTLREYVTAEIGGELIGMPILRVQDVFIPESPTRVPLAPPEIAGVLNLRGRIVTLIDMRRRLGLSGGSDKASLAIGVELRGESYGLLIDAIGEVLKLDDDAREGNPVNLDPRLARVSTGIHRLNDRLLMVLDVDRVLDIAVQSIAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 129 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 130 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 131 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 132 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 133 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 294 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 300 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 301 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 302 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 303 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 411 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 412 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0 |
| Rhizoplane | 6.39 |
| Rhizosphere | 91.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10011335 | 3300005327 | Bacteria | 7148 |
| 2 | 2214544922 | 2209111006 | Bacteria | 19930 |
| 3 | ARcpr5oldR_c000056 | 3300000041 | Bacteria | 20790 |
| 4 | ARSoilYngRDRAFT_c00038 | 3300000042 | Bacteria | 20556 |
| 5 | ARcpr5yngRDRAFT_c000037 | 3300000043 | Bacteria | 20897 |
| 6 | ARSoilOldRDRAFT_c000060 | 3300000044 | Bacteria | 22426 |
| 7 | ARCol0oldRDRAFT_c00584 | 3300000045 | Bacteria | 3237 |
| 8 | ARCol0yngRDRAFT_1000282 | 3300000652 | Bacteria | 8006 |
| 9 | JGI24739J22299_10005110 | 3300001989 | Bacteria | 4996 |
| 10 | JGI24737J22298_10010531 | 3300001990 | Bacteria | 3050 |
| 11 | JGI24737J22298_10018489 | 3300001990 | Bacteria | 2237 |
| 12 | JGI24750J21931_1000905 | 3300002070 | Bacteria | 4030 |
| 13 | JGI24748J21848_1000368 | 3300002074 | Bacteria | 5120 |
| 14 | JGI24738J21930_10000907 | 3300002075 | Bacteria | 8520 |
| 15 | JGI24744J21845_10000074 | 3300002077 | Bacteria | 12517 |
| 16 | JGI24035J26624_1000024 | 3300002126 | Bacteria | 10977 |
| 17 | JGI24035J26624_1000069 | 3300002126 | Bacteria | 8293 |
| 18 | JGI24742J22300_10001012 | 3300002244 | Bacteria | 4326 |
| 19 | JGI24751J29686_10005292 | 3300002459 | Bacteria | 2625 |
| 20 | JGI25405J52794_10146540 | 3300003911 | Bacteria | 538 |
| 21 | Ga0065717_1001986 | 3300005276 | Bacteria | 4090 |
| 22 | Ga0065704_10075779 | 3300005289 | Bacteria | 5428 |
| 23 | Ga0065712_10009656 | 3300005290 | Bacteria | 2559 |
| 24 | Ga0065712_10078326 | 3300005290 | Bacteria | 3364 |
| 25 | Ga0065712_10080698 | 3300005290 | Bacteria | 3078 |
| 26 | Ga0065715_10020644 | 3300005293 | Bacteria | 3110 |
| 27 | Ga0070658_10445637 | 3300005327 | Bacteria | 1115 |
| 28 | Ga0070676_10000085 | 3300005328 | Bacteria | 32591 |
| 29 | Ga0070676_10164820 | 3300005328 | Bacteria | 1429 |
| 30 | Ga0070683_100003426 | 3300005329 | Bacteria | 12877 |
| 31 | Ga0070683_100010425 | 3300005329 | Bacteria | 7992 |
| 32 | Ga0070683_100179463 | 3300005329 | Bacteria | 2010 |
| 33 | Ga0070690_100023770 | 3300005330 | Bacteria | 3762 |
| 34 | Ga0070690_100217662 | 3300005330 | Bacteria | 1337 |
| 35 | Ga0070670_100045650 | 3300005331 | Bacteria | 3767 |
| 36 | Ga0070677_10000381 | 3300005333 | Bacteria | 15617 |
| 37 | Ga0068869_100000832 | 3300005334 | Bacteria | 17622 |
| 38 | Ga0070666_10050801 | 3300005335 | Bacteria | 2789 |
| 39 | Ga0070666_10154150 | 3300005335 | Bacteria | 1604 |
| 40 | Ga0070680_100005059 | 3300005336 | Bacteria | 9947 |
| 41 | Ga0070680_100008571 | 3300005336 | Bacteria | 7835 |
| 42 | Ga0070680_100270099 | 3300005336 | Bacteria | 1440 |
| 43 | Ga0070680_100865053 | 3300005336 | Bacteria | 779 |
| 44 | Ga0070682_100028237 | 3300005337 | Bacteria | 3374 |
| 45 | Ga0070682_100031073 | 3300005337 | Bacteria | 3229 |
| 46 | Ga0070682_100114322 | 3300005337 | Bacteria | 1804 |
| 47 | Ga0068868_100000495 | 3300005338 | Bacteria | 26269 |
| 48 | Ga0068868_100210301 | 3300005338 | Bacteria | 1625 |
| 49 | Ga0070660_100007071 | 3300005339 | Bacteria | 7798 |
| 50 | Ga0070660_100068323 | 3300005339 | Bacteria | 2769 |
| 51 | Ga0070660_100068984 | 3300005339 | Bacteria | 2756 |
| 52 | Ga0070660_100484773 | 3300005339 | Bacteria | 1028 |
| 53 | Ga0070660_100939211 | 3300005339 | Bacteria | 730 |
| 54 | Ga0070689_100064034 | 3300005340 | Bacteria | 2861 |
| 55 | Ga0070689_100297273 | 3300005340 | Bacteria | 1343 |
| 56 | Ga0070691_10002861 | 3300005341 | Bacteria | 7728 |
| 57 | Ga0070691_10101797 | 3300005341 | Bacteria | 1427 |
| 58 | Ga0070687_100001770 | 3300005343 | Bacteria | 7798 |
| 59 | Ga0070661_100000983 | 3300005344 | Bacteria | 20204 |
| 60 | Ga0070692_10002229 | 3300005345 | Bacteria | 7429 |
| 61 | Ga0070668_100005583 | 3300005347 | Bacteria | 9331 |
| 62 | Ga0070668_100099878 | 3300005347 | Bacteria | 2298 |
| 63 | Ga0070669_100002421 | 3300005353 | Bacteria | 13502 |
| 64 | Ga0070675_100001045 | 3300005354 | Bacteria | 19938 |
| 65 | Ga0070671_100000386 | 3300005355 | Bacteria | 30345 |
| 66 | Ga0070671_100028690 | 3300005355 | Bacteria | 4584 |
| 67 | Ga0070671_100167936 | 3300005355 | Bacteria | 1855 |
| 68 | Ga0070671_100737816 | 3300005355 | Bacteria | 855 |
| 69 | Ga0070674_100006162 | 3300005356 | Bacteria | 6974 |
| 70 | Ga0070674_100957957 | 3300005356 | Bacteria | 749 |
| 71 | Ga0070673_100009652 | 3300005364 | Bacteria | 6491 |
| 72 | Ga0070688_100033469 | 3300005365 | Bacteria | 3107 |
| 73 | Ga0070688_100125808 | 3300005365 | Bacteria | 1722 |
| 74 | Ga0070688_100126315 | 3300005365 | Bacteria | 1719 |
| 75 | Ga0070659_100007775 | 3300005366 | Bacteria | 7798 |
| 76 | Ga0070659_100222970 | 3300005366 | Bacteria | 1557 |
| 77 | Ga0070667_100296318 | 3300005367 | Bacteria | 1455 |
| 78 | Ga0070667_100657925 | 3300005367 | Bacteria | 967 |
| 79 | Ga0070703_10005487 | 3300005406 | Bacteria | 3548 |
| 80 | Ga0070709_10016725 | 3300005434 | Bacteria | 4193 |
| 81 | Ga0070709_10023290 | 3300005434 | Bacteria | 3633 |
| 82 | Ga0070709_10143939 | 3300005434 | Bacteria | 1640 |
| 83 | Ga0070709_10829887 | 3300005434 | Bacteria | 727 |
| 84 | Ga0070709_11070810 | 3300005434 | Bacteria | 644 |
| 85 | Ga0070714_100028926 | 3300005435 | Bacteria | 4603 |
| 86 | Ga0070714_100031838 | 3300005435 | Bacteria | 4402 |
| 87 | Ga0070714_100076629 | 3300005435 | Bacteria | 2904 |
| 88 | Ga0070714_100736146 | 3300005435 | Bacteria | 953 |
| 89 | Ga0070713_100028382 | 3300005436 | Bacteria | 4418 |
| 90 | Ga0070713_100242511 | 3300005436 | Bacteria | 1642 |
| 91 | Ga0070713_100833977 | 3300005436 | Bacteria | 885 |
| 92 | Ga0070713_100895097 | 3300005436 | Bacteria | 853 |
| 93 | Ga0070710_10034212 | 3300005437 | Bacteria | 2764 |
| 94 | Ga0070710_10050952 | 3300005437 | Bacteria | 2323 |
| 95 | Ga0070701_10000908 | 3300005438 | Bacteria | 10710 |
| 96 | Ga0070711_100011651 | 3300005439 | Bacteria | 5464 |
| 97 | Ga0070711_100054215 | 3300005439 | Bacteria | 2766 |
| 98 | Ga0070711_100125077 | 3300005439 | Bacteria | 1908 |
| 99 | Ga0070711_100214232 | 3300005439 | Bacteria | 1493 |
| 100 | Ga0070711_100245600 | 3300005439 | Bacteria | 1401 |
| 101 | Ga0070711_101677175 | 3300005439 | Bacteria | 557 |
| 102 | Ga0070705_100003404 | 3300005440 | Bacteria | 7798 |
| 103 | Ga0070705_100365850 | 3300005440 | Bacteria | 1056 |
| 104 | Ga0070705_100408374 | 3300005440 | Bacteria | 1007 |
| 105 | Ga0070700_100003334 | 3300005441 | Bacteria | 8278 |
| 106 | Ga0070700_101561241 | 3300005441 | Unclassified | 563 |
| 107 | Ga0070694_100005587 | 3300005444 | Bacteria | 7622 |
| 108 | Ga0070708_100064337 | 3300005445 | Bacteria | 3286 |
| 109 | Ga0070663_100012099 | 3300005455 | Bacteria | 5446 |
| 110 | Ga0070663_100150828 | 3300005455 | Bacteria | 1782 |
| 111 | Ga0070663_100240197 | 3300005455 | Bacteria | 1429 |
| 112 | Ga0070663_100733134 | 3300005455 | Bacteria | 842 |
| 113 | Ga0070678_100000260 | 3300005456 | Bacteria | 24374 |
| 114 | Ga0070678_100154027 | 3300005456 | Bacteria | 1855 |
| 115 | Ga0070678_100594102 | 3300005456 | Bacteria | 987 |
| 116 | Ga0070662_100084360 | 3300005457 | Bacteria | 2372 |
| 117 | Ga0070662_100414481 | 3300005457 | Bacteria | 1113 |
| 118 | Ga0070662_100497392 | 3300005457 | Bacteria | 1017 |
| 119 | Ga0070681_10003989 | 3300005458 | Bacteria | 13923 |
| 120 | Ga0070681_10035093 | 3300005458 | Bacteria | 5038 |
| 121 | Ga0070681_10071454 | 3300005458 | Bacteria | 3435 |
| 122 | Ga0070681_10405100 | 3300005458 | Bacteria | 1275 |
| 123 | Ga0068867_100002696 | 3300005459 | Bacteria | 12524 |
| 124 | Ga0068867_100107284 | 3300005459 | Bacteria | 2140 |
| 125 | Ga0070685_10007108 | 3300005466 | Bacteria | 5717 |
| 126 | Ga0070685_10023063 | 3300005466 | Bacteria | 3403 |
| 127 | Ga0070685_10149156 | 3300005466 | Bacteria | 1480 |
| 128 | Ga0070707_100222997 | 3300005468 | Bacteria | 1836 |
| 129 | Ga0070698_100733499 | 3300005471 | Bacteria | 931 |
| 130 | Ga0070699_100506441 | 3300005518 | Bacteria | 1097 |
| 131 | Ga0070679_100016998 | 3300005530 | Bacteria | 7032 |
| 132 | Ga0070679_100043302 | 3300005530 | Bacteria | 4483 |
| 133 | Ga0070679_100062508 | 3300005530 | Bacteria | 3712 |
| 134 | Ga0070679_100460335 | 3300005530 | Bacteria | 1216 |
| 135 | Ga0070679_100527303 | 3300005530 | Bacteria | 1125 |
| 136 | Ga0070679_100864914 | 3300005530 | Bacteria | 847 |
| 137 | Ga0070684_100002858 | 3300005535 | Bacteria | 12838 |
| 138 | Ga0070684_100029407 | 3300005535 | Bacteria | 4656 |
| 139 | Ga0070684_101135567 | 3300005535 | Bacteria | 734 |
| 140 | Ga0070684_101321803 | 3300005535 | Bacteria | 679 |
| 141 | Ga0070684_101622635 | 3300005535 | Unclassified | 610 |
| 142 | Ga0070697_100443608 | 3300005536 | Bacteria | 1130 |
| 143 | Ga0068853_100073074 | 3300005539 | Bacteria | 2989 |
| 144 | Ga0068853_100173730 | 3300005539 | Bacteria | 1950 |
| 145 | Ga0070672_100006644 | 3300005543 | Bacteria | 7790 |
| 146 | Ga0070686_100030263 | 3300005544 | Bacteria | 3300 |
| 147 | Ga0070686_100197802 | 3300005544 | Bacteria | 1439 |
| 148 | Ga0070695_100020350 | 3300005545 | Bacteria | 4051 |
| 149 | Ga0070695_100022315 | 3300005545 | Bacteria | 3882 |
| 150 | Ga0070696_100034090 | 3300005546 | Bacteria | 3501 |
| 151 | Ga0070696_100328134 | 3300005546 | Bacteria | 1179 |
| 152 | Ga0070696_101826230 | 3300005546 | Bacteria | 525 |
| 153 | Ga0070693_100000947 | 3300005547 | Bacteria | 12881 |
| 154 | Ga0070693_100024354 | 3300005547 | Bacteria | 3245 |
| 155 | Ga0070693_100027275 | 3300005547 | Bacteria | 3094 |
| 156 | Ga0070665_100355973 | 3300005548 | Bacteria | 1470 |
| 157 | Ga0070665_100718134 | 3300005548 | Bacteria | 1012 |
| 158 | Ga0070704_100239051 | 3300005549 | Bacteria | 1485 |
| 159 | Ga0068855_100147058 | 3300005563 | Bacteria | 2682 |
| 160 | Ga0068855_100216080 | 3300005563 | Bacteria | 2152 |
| 161 | Ga0068855_100261759 | 3300005563 | Bacteria | 1926 |
| 162 | Ga0068855_100417287 | 3300005563 | Bacteria | 1468 |
| 163 | Ga0070664_100002866 | 3300005564 | Bacteria | 13967 |
| 164 | Ga0070664_100701938 | 3300005564 | Bacteria | 943 |
| 165 | Ga0068857_100002854 | 3300005577 | Bacteria | 14200 |
| 166 | Ga0068857_100185441 | 3300005577 | Bacteria | 1894 |
| 167 | Ga0068854_100014002 | 3300005578 | Bacteria | 5277 |
| 168 | Ga0068854_100213516 | 3300005578 | Bacteria | 1523 |
| 169 | Ga0068854_100489761 | 3300005578 | Bacteria | 1034 |
| 170 | Ga0068856_100002432 | 3300005614 | Bacteria | 19156 |
| 171 | Ga0068856_100064883 | 3300005614 | Bacteria | 3608 |
| 172 | Ga0068856_100192582 | 3300005614 | Bacteria | 2053 |
| 173 | Ga0068856_100460879 | 3300005614 | Bacteria | 1292 |
| 174 | Ga0068856_100957560 | 3300005614 | Bacteria | 874 |
| 175 | Ga0070702_100001455 | 3300005615 | Bacteria | 9702 |
| 176 | Ga0068852_100022111 | 3300005616 | Bacteria | 5093 |
| 177 | Ga0068852_100426174 | 3300005616 | Bacteria | 1309 |
| 178 | Ga0068852_100580087 | 3300005616 | Bacteria | 1124 |
| 179 | Ga0068859_100268285 | 3300005617 | Bacteria | 1799 |
| 180 | Ga0068859_100402635 | 3300005617 | Bacteria | 1465 |
| 181 | Ga0068864_100003611 | 3300005618 | Bacteria | 12790 |
| 182 | Ga0068866_10000364 | 3300005718 | Bacteria | 21278 |
| 183 | Ga0068866_11110913 | 3300005718 | Bacteria | 567 |
| 184 | Ga0068861_100006781 | 3300005719 | Bacteria | 7824 |
| 185 | Ga0068861_100310779 | 3300005719 | Bacteria | 1369 |
| 186 | Ga0068851_10026178 | 3300005834 | Bacteria | 2864 |
| 187 | Ga0068851_10305352 | 3300005834 | Bacteria | 916 |
| 188 | Ga0068870_10000015 | 3300005840 | Bacteria | 63346 |
| 189 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 190 | Ga0068863_100043782 | 3300005841 | Bacteria | 4249 |
| 191 | Ga0068858_100042094 | 3300005842 | Bacteria | 4235 |
| 192 | Ga0068858_100357013 | 3300005842 | Bacteria | 1400 |
| 193 | Ga0068860_100005473 | 3300005843 | Bacteria | 12870 |
| 194 | Ga0068860_100196722 | 3300005843 | Bacteria | 1952 |
| 195 | Ga0068860_100374697 | 3300005843 | Bacteria | 1404 |
| 196 | Ga0068860_100422597 | 3300005843 | Bacteria | 1321 |
| 197 | Ga0068860_100976067 | 3300005843 | Unclassified | 865 |
| 198 | Ga0068862_100003784 | 3300005844 | Bacteria | 12895 |
| 199 | Ga0068862_100435980 | 3300005844 | Bacteria | 1232 |
| 200 | Ga0068862_101571878 | 3300005844 | Bacteria | 664 |
| 201 | Ga0081455_10001601 | 3300005937 | Bacteria | 27658 |
| 202 | Ga0081455_10082066 | 3300005937 | Bacteria | 2638 |
| 203 | Ga0070717_10144648 | 3300006028 | Bacteria | 2053 |
| 204 | Ga0075432_10240718 | 3300006058 | Bacteria | 731 |
| 205 | Ga0070715_10016578 | 3300006163 | Bacteria | 2771 |
| 206 | Ga0070716_100018193 | 3300006173 | Bacteria | 3656 |
| 207 | Ga0070716_100114391 | 3300006173 | Bacteria | 1678 |
| 208 | Ga0070716_100153419 | 3300006173 | Bacteria | 1484 |
| 209 | Ga0070712_100012900 | 3300006175 | Bacteria | 5324 |
| 210 | Ga0070712_100078211 | 3300006175 | Bacteria | 2387 |
| 211 | Ga0070712_100309321 | 3300006175 | Bacteria | 1281 |
| 212 | Ga0070712_100371284 | 3300006175 | Bacteria | 1175 |
| 213 | Ga0070712_100440913 | 3300006175 | Bacteria | 1083 |
| 214 | Ga0070712_100773489 | 3300006175 | Bacteria | 822 |
| 215 | Ga0075367_10035568 | 3300006178 | Bacteria | 2883 |
| 216 | Ga0097621_100009409 | 3300006237 | Bacteria | 7089 |
| 217 | Ga0097621_100019613 | 3300006237 | Bacteria | 5194 |
| 218 | Ga0097621_100252555 | 3300006237 | Bacteria | 1544 |
| 219 | Ga0075370_10041043 | 3300006353 | Bacteria | 2612 |
| 220 | Ga0075370_10116379 | 3300006353 | Bacteria | 1554 |
| 221 | Ga0068871_100005915 | 3300006358 | Bacteria | 8606 |
| 222 | Ga0068871_100088803 | 3300006358 | Bacteria | 2572 |
| 223 | Ga0068871_100153104 | 3300006358 | Bacteria | 1967 |
| 224 | Ga0075433_10088886 | 3300006852 | Bacteria | 2730 |
| 225 | Ga0075434_100011707 | 3300006871 | Bacteria | 8283 |
| 226 | Ga0075429_100543689 | 3300006880 | Bacteria | 1018 |
| 227 | Ga0068865_100046627 | 3300006881 | Bacteria | 2974 |
| 228 | Ga0075436_100144184 | 3300006914 | Bacteria | 1674 |
| 229 | Ga0097620_100268300 | 3300006931 | Bacteria | 1799 |
| 230 | Ga0097620_100402642 | 3300006931 | Bacteria | 1465 |
| 231 | Ga0075435_100307280 | 3300007076 | Bacteria | 1357 |
| 232 | Ga0075435_100434709 | 3300007076 | Bacteria | 1131 |
| 233 | Ga0075435_100491581 | 3300007076 | Bacteria | 1060 |
| 234 | Ga0105251_10079855 | 3300009011 | Bacteria | 1513 |
| 235 | Ga0105251_10284245 | 3300009011 | Bacteria | 748 |
| 236 | Ga0105244_10092970 | 3300009036 | Bacteria | 1482 |
| 237 | Ga0105250_10041851 | 3300009092 | Bacteria | 1836 |
| 238 | Ga0105250_10166071 | 3300009092 | Bacteria | 923 |
| 239 | Ga0111539_10022188 | 3300009094 | Bacteria | 7804 |
| 240 | Ga0111539_10080457 | 3300009094 | Bacteria | 3833 |
| 241 | Ga0111539_10121090 | 3300009094 | Bacteria | 3066 |
| 242 | Ga0105245_10003800 | 3300009098 | Bacteria | 13429 |
| 243 | Ga0105245_10158044 | 3300009098 | Bacteria | 2149 |
| 244 | Ga0105245_11102628 | 3300009098 | Bacteria | 840 |
| 245 | Ga0105245_11284263 | 3300009098 | Bacteria | 781 |
| 246 | Ga0105245_12090982 | 3300009098 | Bacteria | 620 |
| 247 | Ga0105247_10012563 | 3300009101 | Bacteria | 5087 |
| 248 | Ga0105247_10029045 | 3300009101 | Bacteria | 3348 |
| 249 | Ga0105247_10427843 | 3300009101 | Bacteria | 949 |
| 250 | Ga0105247_10978299 | 3300009101 | Bacteria | 659 |
| 251 | Ga0105243_10007557 | 3300009148 | Bacteria | 8357 |
| 252 | Ga0105243_10023375 | 3300009148 | Bacteria | 4707 |
| 253 | Ga0105243_10185610 | 3300009148 | Bacteria | 1812 |
| 254 | Ga0105241_10000982 | 3300009174 | Bacteria | 21606 |
| 255 | Ga0105241_10023898 | 3300009174 | Bacteria | 4536 |
| 256 | Ga0105241_10280611 | 3300009174 | Bacteria | 1423 |
| 257 | Ga0105241_10291363 | 3300009174 | Bacteria | 1398 |
| 258 | Ga0105242_10001299 | 3300009176 | Bacteria | 19749 |
| 259 | Ga0105242_10008924 | 3300009176 | Bacteria | 7694 |
| 260 | Ga0105242_10133517 | 3300009176 | Bacteria | 2146 |
| 261 | Ga0105248_10002736 | 3300009177 | Bacteria | 19584 |
| 262 | Ga0105248_10011811 | 3300009177 | Bacteria | 9634 |
| 263 | Ga0105248_10157656 | 3300009177 | Bacteria | 2561 |
| 264 | Ga0105248_10358083 | 3300009177 | Bacteria | 1643 |
| 265 | Ga0105237_10019497 | 3300009545 | Bacteria | 7004 |
| 266 | Ga0105237_10295171 | 3300009545 | Bacteria | 1624 |
| 267 | Ga0105237_10365882 | 3300009545 | Bacteria | 1447 |
| 268 | Ga0105237_10372078 | 3300009545 | Bacteria | 1433 |
| 269 | Ga0105237_11521316 | 3300009545 | Unclassified | 676 |
| 270 | Ga0105238_10040330 | 3300009551 | Bacteria | 4731 |
| 271 | Ga0105238_10278821 | 3300009551 | Bacteria | 1653 |
| 272 | Ga0105238_10545414 | 3300009551 | Bacteria | 1163 |
| 273 | Ga0105249_10003014 | 3300009553 | Bacteria | 14526 |
| 274 | Ga0105249_10087070 | 3300009553 | Bacteria | 2914 |
| 275 | Ga0105249_10114678 | 3300009553 | Bacteria | 2551 |
| 276 | Ga0105249_10420896 | 3300009553 | Bacteria | 1369 |
| 277 | Ga0105249_10540713 | 3300009553 | Bacteria | 1215 |
| 278 | Ga0105239_10015884 | 3300010375 | Bacteria | 8334 |
| 279 | Ga0105239_10101705 | 3300010375 | Bacteria | 3179 |
| 280 | Ga0105239_10350876 | 3300010375 | Bacteria | 1666 |
| 281 | Ga0105239_10634999 | 3300010375 | Bacteria | 1219 |
| 282 | Ga0105246_10004947 | 3300011119 | Bacteria | 8112 |
| 283 | Ga0105246_10158676 | 3300011119 | Bacteria | 1721 |
| 284 | Ga0157328_1001908 | 3300012478 | Bacteria | 947 |
| 285 | Ga0157346_1001147 | 3300012480 | Bacteria | 1230 |
| 286 | Ga0157343_1004982 | 3300012488 | Bacteria | 845 |
| 287 | Ga0157322_1001471 | 3300012490 | Bacteria | 1175 |
| 288 | Ga0157347_1011258 | 3300012502 | Bacteria | 948 |
| 289 | Ga0157342_1004570 | 3300012507 | Bacteria | 1235 |
| 290 | Ga0157315_1007302 | 3300012508 | Bacteria | 892 |
| 291 | Ga0157373_10017859 | 3300013100 | Bacteria | 5166 |
| 292 | Ga0157373_10065620 | 3300013100 | Bacteria | 2568 |
| 293 | Ga0157373_10178233 | 3300013100 | Bacteria | 1496 |
| 294 | Ga0157373_10481740 | 3300013100 | Bacteria | 895 |
| 295 | Ga0157371_10160695 | 3300013102 | Bacteria | 1604 |
| 296 | Ga0157371_10226602 | 3300013102 | Bacteria | 1343 |
| 297 | Ga0157370_10125769 | 3300013104 | Bacteria | 2392 |
| 298 | Ga0157370_10196656 | 3300013104 | Bacteria | 1871 |
| 299 | Ga0157369_10045190 | 3300013105 | Bacteria | 4792 |
| 300 | Ga0157369_10373571 | 3300013105 | Bacteria | 1480 |
| 301 | Ga0157369_11556141 | 3300013105 | Bacteria | 672 |
| 302 | Ga0157374_10009129 | 3300013296 | Bacteria | 8498 |
| 303 | Ga0157374_10091222 | 3300013296 | Bacteria | 2905 |
| 304 | Ga0157374_10487326 | 3300013296 | Bacteria | 1236 |
| 305 | Ga0157378_10004364 | 3300013297 | Bacteria | 12450 |
| 306 | Ga0157378_10042070 | 3300013297 | Bacteria | 4054 |
| 307 | Ga0157378_10474274 | 3300013297 | Bacteria | 1246 |
| 308 | Ga0163162_10011614 | 3300013306 | Bacteria | 8587 |
| 309 | Ga0163162_10087519 | 3300013306 | Bacteria | 3194 |
| 310 | Ga0163162_10341842 | 3300013306 | Bacteria | 1629 |
| 311 | Ga0157372_10195872 | 3300013307 | Bacteria | 2341 |
| 312 | Ga0157372_10249843 | 3300013307 | Bacteria | 2059 |
| 313 | Ga0157372_10611866 | 3300013307 | Bacteria | 1270 |
| 314 | Ga0157372_10618363 | 3300013307 | Bacteria | 1262 |
| 315 | Ga0157372_10721470 | 3300013307 | Bacteria | 1159 |
| 316 | Ga0157372_11798275 | 3300013307 | Bacteria | 705 |
| 317 | Ga0157375_10008586 | 3300013308 | Bacteria | 8945 |
| 318 | Ga0157375_10330690 | 3300013308 | Bacteria | 1689 |
| 319 | Ga0157375_10657776 | 3300013308 | Bacteria | 1204 |
| 320 | Ga0163163_10063140 | 3300014325 | Bacteria | 3672 |
| 321 | Ga0163163_10260337 | 3300014325 | Bacteria | 1786 |
| 322 | Ga0163163_10842531 | 3300014325 | Bacteria | 980 |
| 323 | Ga0163163_12583151 | 3300014325 | Unclassified | 565 |
| 324 | Ga0157380_10003889 | 3300014326 | Bacteria | 10302 |
| 325 | Ga0157380_10113220 | 3300014326 | Bacteria | 2284 |
| 326 | Ga0157380_11219269 | 3300014326 | Bacteria | 797 |
| 327 | Ga0157377_10000317 | 3300014745 | Bacteria | 22023 |
| 328 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 329 | Ga0157379_10018396 | 3300014968 | Bacteria | 6160 |
| 330 | Ga0157379_10516277 | 3300014968 | Bacteria | 1108 |
| 331 | Ga0157376_10005894 | 3300014969 | Bacteria | 8601 |
| 332 | Ga0157376_11634894 | 3300014969 | Bacteria | 679 |
| 333 | Ga0163161_10000693 | 3300017792 | Bacteria | 26852 |
| 334 | Ga0163161_10126818 | 3300017792 | Bacteria | 1922 |
| 335 | Ga0163161_11175856 | 3300017792 | Bacteria | 662 |
| 336 | Ga0206356_10272352 | 3300020070 | Bacteria | 918 |
| 337 | Ga0206356_11494623 | 3300020070 | Bacteria | 1061 |
| 338 | Ga0213876_10013750 | 3300021384 | Bacteria | 4289 |
| 339 | Ga0207666_1000681 | 3300025271 | Bacteria | 4075 |
| 340 | Ga0207666_1001215 | 3300025271 | Bacteria | 3027 |
| 341 | Ga0207673_1001404 | 3300025290 | Bacteria | 2624 |
| 342 | Ga0207697_10016607 | 3300025315 | Bacteria | 3031 |
| 343 | Ga0207697_10119883 | 3300025315 | Bacteria | 1131 |
| 344 | Ga0207653_10003762 | 3300025885 | Bacteria | 4774 |
| 345 | Ga0207653_10074057 | 3300025885 | Bacteria | 1168 |
| 346 | Ga0207682_10000264 | 3300025893 | Bacteria | 23612 |
| 347 | Ga0207692_10002735 | 3300025898 | Bacteria | 6804 |
| 348 | Ga0207642_10000834 | 3300025899 | Bacteria | 9610 |
| 349 | Ga0207642_10300214 | 3300025899 | Bacteria | 931 |
| 350 | Ga0207710_10005159 | 3300025900 | Bacteria | 5644 |
| 351 | Ga0207710_10025358 | 3300025900 | Bacteria | 2558 |
| 352 | Ga0207710_10087483 | 3300025900 | Bacteria | 1453 |
| 353 | Ga0207710_10379584 | 3300025900 | Bacteria | 723 |
| 354 | Ga0207688_10015833 | 3300025901 | Bacteria | 4091 |
| 355 | Ga0207688_10062252 | 3300025901 | Bacteria | 2103 |
| 356 | Ga0207680_10013218 | 3300025903 | Bacteria | 4233 |
| 357 | Ga0207647_10041608 | 3300025904 | Bacteria | 2888 |
| 358 | Ga0207685_10004366 | 3300025905 | Bacteria | 3586 |
| 359 | Ga0207685_10043609 | 3300025905 | Bacteria | 1691 |
| 360 | Ga0207699_10040119 | 3300025906 | Bacteria | 2696 |
| 361 | Ga0207699_10128144 | 3300025906 | Bacteria | 1651 |
| 362 | Ga0207699_10173029 | 3300025906 | Bacteria | 1446 |
| 363 | Ga0207699_10513252 | 3300025906 | Bacteria | 866 |
| 364 | Ga0207645_10000926 | 3300025907 | Bacteria | 24341 |
| 365 | Ga0207645_10222865 | 3300025907 | Bacteria | 1243 |
| 366 | Ga0207645_10451235 | 3300025907 | Bacteria | 868 |
| 367 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 368 | Ga0207705_11374108 | 3300025909 | Bacteria | 538 |
| 369 | Ga0207684_10096691 | 3300025910 | Bacteria | 2521 |
| 370 | Ga0207654_10000437 | 3300025911 | Bacteria | 23909 |
| 371 | Ga0207654_10872418 | 3300025911 | Unclassified | 652 |
| 372 | Ga0207707_10004519 | 3300025912 | Bacteria | 12230 |
| 373 | Ga0207707_10060140 | 3300025912 | Bacteria | 3305 |
| 374 | Ga0207707_11118437 | 3300025912 | Bacteria | 641 |
| 375 | Ga0207671_10010091 | 3300025914 | Bacteria | 7829 |
| 376 | Ga0207671_10283607 | 3300025914 | Bacteria | 1307 |
| 377 | Ga0207693_10001239 | 3300025915 | Bacteria | 22700 |
| 378 | Ga0207693_10006137 | 3300025915 | Bacteria | 9961 |
| 379 | Ga0207693_10013383 | 3300025915 | Bacteria | 6614 |
| 380 | Ga0207693_10064686 | 3300025915 | Bacteria | 2865 |
| 381 | Ga0207693_10335098 | 3300025915 | Bacteria | 1184 |
| 382 | Ga0207663_10019511 | 3300025916 | Bacteria | 3822 |
| 383 | Ga0207663_10022853 | 3300025916 | Bacteria | 3580 |
| 384 | Ga0207663_10071352 | 3300025916 | Bacteria | 2241 |
| 385 | Ga0207663_11144628 | 3300025916 | Bacteria | 626 |
| 386 | Ga0207660_10004154 | 3300025917 | Bacteria | 9422 |
| 387 | Ga0207660_10015766 | 3300025917 | Bacteria | 4994 |
| 388 | Ga0207660_10028341 | 3300025917 | Bacteria | 3830 |
| 389 | Ga0207660_10140445 | 3300025917 | Bacteria | 1846 |
| 390 | Ga0207660_11010526 | 3300025917 | Bacteria | 678 |
| 391 | Ga0207662_10032660 | 3300025918 | Bacteria | 3031 |
| 392 | Ga0207662_10328773 | 3300025918 | Bacteria | 1022 |
| 393 | Ga0207662_10381012 | 3300025918 | Bacteria | 953 |
| 394 | Ga0207657_10052397 | 3300025919 | Bacteria | 3541 |
| 395 | Ga0207657_10054228 | 3300025919 | Bacteria | 3468 |
| 396 | Ga0207657_10077345 | 3300025919 | Bacteria | 2804 |
| 397 | Ga0207657_10643333 | 3300025919 | Bacteria | 826 |
| 398 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 399 | Ga0207652_10001397 | 3300025921 | Bacteria | 21434 |
| 400 | Ga0207652_10004018 | 3300025921 | Bacteria | 12012 |
| 401 | Ga0207652_10068573 | 3300025921 | Bacteria | 3078 |
| 402 | Ga0207652_10250845 | 3300025921 | Bacteria | 1596 |
| 403 | Ga0207652_10424313 | 3300025921 | Bacteria | 1199 |
| 404 | Ga0207652_10613162 | 3300025921 | Bacteria | 975 |
| 405 | Ga0207681_10001592 | 3300025923 | Bacteria | 14608 |
| 406 | Ga0207694_11216550 | 3300025924 | Bacteria | 637 |
| 407 | Ga0207650_10007098 | 3300025925 | Bacteria | 7630 |
| 408 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 409 | Ga0207687_10000445 | 3300025927 | Bacteria | 28075 |
| 410 | Ga0207687_10017603 | 3300025927 | Bacteria | 4707 |
| 411 | Ga0207700_10003402 | 3300025928 | Bacteria | 9241 |
| 412 | Ga0207700_10085958 | 3300025928 | Bacteria | 2470 |
| 413 | Ga0207700_10099918 | 3300025928 | Bacteria | 2311 |
| 414 | Ga0207664_10608410 | 3300025929 | Bacteria | 981 |
| 415 | Ga0207644_10000816 | 3300025931 | Bacteria | 19791 |
| 416 | Ga0207644_10514398 | 3300025931 | Bacteria | 988 |
| 417 | Ga0207690_10000440 | 3300025932 | Bacteria | 26959 |
| 418 | Ga0207690_10082283 | 3300025932 | Bacteria | 2251 |
| 419 | Ga0207690_10144572 | 3300025932 | Bacteria | 1757 |
| 420 | Ga0207690_10244781 | 3300025932 | Bacteria | 1383 |
| 421 | Ga0207690_10440704 | 3300025932 | Bacteria | 1045 |
| 422 | Ga0207706_10008938 | 3300025933 | Bacteria | 9223 |
| 423 | Ga0207706_10055499 | 3300025933 | Bacteria | 3493 |
| 424 | Ga0207706_10059966 | 3300025933 | Bacteria | 3351 |
| 425 | Ga0207686_10000433 | 3300025934 | Bacteria | 28288 |
| 426 | Ga0207686_10369100 | 3300025934 | Bacteria | 1085 |
| 427 | Ga0207709_10000494 | 3300025935 | Bacteria | 35647 |
| 428 | Ga0207709_10021426 | 3300025935 | Bacteria | 3659 |
| 429 | Ga0207709_10184343 | 3300025935 | Bacteria | 1477 |
| 430 | Ga0207670_10001363 | 3300025936 | Bacteria | 12858 |
| 431 | Ga0207670_10139679 | 3300025936 | Bacteria | 1785 |
| 432 | Ga0207670_10512922 | 3300025936 | Bacteria | 975 |
| 433 | Ga0207670_11006992 | 3300025936 | Bacteria | 701 |
| 434 | Ga0207669_10000063 | 3300025937 | Bacteria | 53494 |
| 435 | Ga0207669_10109699 | 3300025937 | Bacteria | 1846 |
| 436 | Ga0207669_10455866 | 3300025937 | Bacteria | 1014 |
| 437 | Ga0207704_10001268 | 3300025938 | Bacteria | 11299 |
| 438 | Ga0207665_10003373 | 3300025939 | Bacteria | 10695 |
| 439 | Ga0207665_10028918 | 3300025939 | Bacteria | 3664 |
| 440 | Ga0207665_10030904 | 3300025939 | Bacteria | 3541 |
| 441 | Ga0207665_10108301 | 3300025939 | Bacteria | 1949 |
| 442 | Ga0207691_10000981 | 3300025940 | Bacteria | 28361 |
| 443 | Ga0207691_10517083 | 3300025940 | Bacteria | 1013 |
| 444 | Ga0207711_10000792 | 3300025941 | Bacteria | 31089 |
| 445 | Ga0207711_10012513 | 3300025941 | Bacteria | 7052 |
| 446 | Ga0207711_10075463 | 3300025941 | Bacteria | 2934 |
| 447 | Ga0207689_10002635 | 3300025942 | Bacteria | 16609 |
| 448 | Ga0207689_10247590 | 3300025942 | Bacteria | 1474 |
| 449 | Ga0207689_10419153 | 3300025942 | Bacteria | 1117 |
| 450 | Ga0207661_10000531 | 3300025944 | Bacteria | 24434 |
| 451 | Ga0207661_10284230 | 3300025944 | Bacteria | 1479 |
| 452 | Ga0207661_10473035 | 3300025944 | Bacteria | 1143 |
| 453 | Ga0207679_10001109 | 3300025945 | Bacteria | 17141 |
| 454 | Ga0207679_10054930 | 3300025945 | Bacteria | 2934 |
| 455 | Ga0207679_10231357 | 3300025945 | Bacteria | 1561 |
| 456 | Ga0207679_10526080 | 3300025945 | Bacteria | 1058 |
| 457 | Ga0207667_10022580 | 3300025949 | Bacteria | 6945 |
| 458 | Ga0207667_10554214 | 3300025949 | Bacteria | 1162 |
| 459 | Ga0207651_10000379 | 3300025960 | Bacteria | 18945 |
| 460 | Ga0207651_10565668 | 3300025960 | Bacteria | 990 |
| 461 | Ga0207712_10000717 | 3300025961 | Bacteria | 25585 |
| 462 | Ga0207712_10339234 | 3300025961 | Bacteria | 1246 |
| 463 | Ga0207712_10659694 | 3300025961 | Bacteria | 910 |
| 464 | Ga0207668_10000429 | 3300025972 | Bacteria | 26510 |
| 465 | Ga0207668_10016879 | 3300025972 | Bacteria | 4567 |
| 466 | Ga0207640_10000516 | 3300025981 | Bacteria | 23270 |
| 467 | Ga0207658_10020967 | 3300025986 | Bacteria | 4530 |
| 468 | Ga0207658_10079727 | 3300025986 | Bacteria | 2506 |
| 469 | Ga0207658_10436337 | 3300025986 | Bacteria | 1157 |
| 470 | Ga0207677_10001164 | 3300026023 | Bacteria | 14343 |
| 471 | Ga0207677_10217318 | 3300026023 | Bacteria | 1530 |
| 472 | Ga0207703_10007685 | 3300026035 | Bacteria | 8544 |
| 473 | Ga0207703_10074671 | 3300026035 | Bacteria | 2808 |
| 474 | Ga0207703_10140580 | 3300026035 | Bacteria | 2095 |
| 475 | Ga0207703_10456481 | 3300026035 | Bacteria | 1194 |
| 476 | Ga0207639_10003596 | 3300026041 | Bacteria | 10414 |
| 477 | Ga0207639_10292101 | 3300026041 | Bacteria | 1438 |
| 478 | Ga0207639_10346725 | 3300026041 | Bacteria | 1325 |
| 479 | Ga0207678_10002770 | 3300026067 | Bacteria | 15870 |
| 480 | Ga0207678_10026091 | 3300026067 | Bacteria | 5097 |
| 481 | Ga0207678_10140321 | 3300026067 | Bacteria | 2062 |
| 482 | Ga0207708_10055110 | 3300026075 | Bacteria | 3031 |
| 483 | Ga0207708_10055122 | 3300026075 | Bacteria | 3031 |
| 484 | Ga0207702_10003627 | 3300026078 | Bacteria | 14009 |
| 485 | Ga0207702_10230482 | 3300026078 | Bacteria | 1731 |
| 486 | Ga0207702_10430426 | 3300026078 | Bacteria | 1277 |
| 487 | Ga0207702_11190156 | 3300026078 | Unclassified | 756 |
| 488 | Ga0207641_10003728 | 3300026088 | Bacteria | 13402 |
| 489 | Ga0207641_10046965 | 3300026088 | Bacteria | 3640 |
| 490 | Ga0207641_10535008 | 3300026088 | Bacteria | 1141 |
| 491 | Ga0207648_10013027 | 3300026089 | Bacteria | 7756 |
| 492 | Ga0207648_10412631 | 3300026089 | Bacteria | 1225 |
| 493 | Ga0207648_10648804 | 3300026089 | Bacteria | 975 |
| 494 | Ga0207676_10000583 | 3300026095 | Bacteria | 30033 |
| 495 | Ga0207676_10078337 | 3300026095 | Bacteria | 2677 |
| 496 | Ga0207676_10295329 | 3300026095 | Bacteria | 1477 |
| 497 | Ga0207674_10028860 | 3300026116 | Bacteria | 5849 |
| 498 | Ga0207674_10409594 | 3300026116 | Bacteria | 1310 |
| 499 | Ga0207675_100036186 | 3300026118 | Bacteria | 4605 |
| 500 | Ga0207675_100429521 | 3300026118 | Bacteria | 1306 |
| 501 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 502 | Ga0207683_10025410 | 3300026121 | Bacteria | 5109 |
| 503 | Ga0207683_10228463 | 3300026121 | Bacteria | 1697 |
| 504 | Ga0207698_10005821 | 3300026142 | Bacteria | 7655 |
| 505 | Ga0207698_10649640 | 3300026142 | Bacteria | 1045 |
| 506 | Ga0209973_1012711 | 3300027252 | Bacteria | 1027 |
| 507 | Ga0209967_1001718 | 3300027364 | Bacteria | 2816 |
| 508 | Ga0209995_1003384 | 3300027471 | Bacteria | 2540 |
| 509 | Ga0209968_1009407 | 3300027526 | Bacteria | 1496 |
| 510 | Ga0210002_1000870 | 3300027617 | Bacteria | 4142 |
| 511 | Ga0210002_1023208 | 3300027617 | Bacteria | 1008 |
| 512 | Ga0209983_1005120 | 3300027665 | Bacteria | 2729 |
| 513 | Ga0209971_1014116 | 3300027682 | Bacteria | 1892 |
| 514 | Ga0209971_1057654 | 3300027682 | Bacteria | 939 |
| 515 | Ga0209966_1003383 | 3300027695 | Bacteria | 2682 |
| 516 | Ga0209966_1013394 | 3300027695 | Bacteria | 1518 |
| 517 | Ga0209998_10007335 | 3300027717 | Bacteria | 2288 |
| 518 | Ga0209998_10008256 | 3300027717 | Bacteria | 2159 |
| 519 | Ga0209974_10006454 | 3300027876 | Bacteria | 4094 |
| 520 | Ga0209974_10063771 | 3300027876 | Bacteria | 1250 |
| 521 | Ga0207428_10001759 | 3300027907 | Bacteria | 22205 |
| 522 | Ga0207428_10023515 | 3300027907 | Bacteria | 5182 |
| 523 | Ga0207428_10194065 | 3300027907 | Bacteria | 1530 |
| 524 | Ga0268266_10062397 | 3300028379 | Bacteria | 3216 |
| 525 | Ga0268265_10002569 | 3300028380 | Bacteria | 13569 |
| 526 | Ga0268265_10551182 | 3300028380 | Bacteria | 1094 |
| 527 | Ga0268264_10002097 | 3300028381 | Bacteria | 17812 |
| 528 | Ga0268264_10271581 | 3300028381 | Bacteria | 1584 |
| 529 | Ga0268264_10529914 | 3300028381 | Bacteria | 1153 |
| 530 | Ga0268264_10715518 | 3300028381 | Bacteria | 995 |
| 531 | Ga0268264_11680334 | 3300028381 | Bacteria | 645 |
| 532 | Ga0268264_12150210 | 3300028381 | Unclassified | 566 |
| 533 | Ga0265337_1001017 | 3300028556 | Bacteria | 14559 |
| 534 | Ga0265338_10184604 | 3300028800 | Bacteria | 1586 |
| 535 | Ga0265338_10328354 | 3300028800 | Bacteria | 1105 |
| 536 | Ga0265338_10444083 | 3300028800 | Bacteria | 919 |
| 537 | Ga0265330_10009166 | 3300031235 | Bacteria | 4716 |
| 538 | Ga0265332_10168956 | 3300031238 | Bacteria | 913 |
| 539 | Ga0265332_10170392 | 3300031238 | Bacteria | 909 |
| 540 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 541 | Ga0265325_10004257 | 3300031241 | Bacteria | 9079 |
| 542 | Ga0265325_10043241 | 3300031241 | Bacteria | 2351 |
| 543 | Ga0265340_10055326 | 3300031247 | Bacteria | 1911 |
| 544 | Ga0265340_10122121 | 3300031247 | Bacteria | 1198 |
| 545 | Ga0265339_10001671 | 3300031249 | Bacteria | 16385 |
| 546 | Ga0265339_10019397 | 3300031249 | Bacteria | 3992 |
| 547 | Ga0265316_10016529 | 3300031344 | Bacteria | 6395 |
| 548 | Ga0307408_100939644 | 3300031548 | Bacteria | 794 |
| 549 | Ga0265313_10001789 | 3300031595 | Bacteria | 19628 |
| 550 | Ga0265313_10004986 | 3300031595 | Bacteria | 9932 |
| 551 | Ga0265313_10023160 | 3300031595 | Bacteria | 3351 |
| 552 | Ga0265313_10024803 | 3300031595 | Bacteria | 3193 |
| 553 | Ga0316575_10096374 | 3300031665 | Bacteria | 1201 |
| 554 | Ga0316579_10030720 | 3300031691 | Bacteria | 2456 |
| 555 | Ga0265314_10000577 | 3300031711 | Bacteria | 46408 |
| 556 | Ga0265314_10028869 | 3300031711 | Bacteria | 4129 |
| 557 | Ga0265342_10000211 | 3300031712 | Bacteria | 65440 |
| 558 | Ga0307406_10525537 | 3300031901 | Bacteria | 964 |
| 559 | Ga0307414_11928885 | 3300032004 | Bacteria | 551 |
| 560 | Ga0307411_10340846 | 3300032005 | Bacteria | 1218 |
| 561 | Ga0307415_100792740 | 3300032126 | Bacteria | 864 |
| 562 | Ga0316583_10002625 | 3300032133 | Bacteria | 6274 |
| 563 | Ga0373930_0000568 | 3300034816 | Bacteria | 5085 |
| 564 | Ga0373930_0180071 | 3300034816 | Bacteria | 542 |
| 565 | Ga0373948_0000092 | 3300034817 | Bacteria | 9192 |
| 566 | Ga0373950_0008904 | 3300034818 | Bacteria | 1590 |
| 567 | Ga0373958_0000576 | 3300034819 | Bacteria | 4549 |
| 568 | Ga0373958_0018463 | 3300034819 | Bacteria | 1264 |
| 569 | Ga0373959_0000576 | 3300034820 | Bacteria | 6439 |
| 570 | Ga0373959_0018902 | 3300034820 | Bacteria | 1300 |
| 571 | Ga0373938_0008030 | 3300034957 | Bacteria | 1876 |
| 572 | Ga0373926_0010362 | 3300035083 | Bacteria | 3123 |
| 573 | Ga0373928_0000100 | 3300035084 | Bacteria | 15370 |
| 574 | Ga0373928_0010483 | 3300035084 | Bacteria | 1821 |
| 575 | Ga0373934_0015086 | 3300035086 | Bacteria | 2930 |
| 576 | Ga0373940_0000073 | 3300035088 | Bacteria | 11686 |
| 577 | Ga0373940_0039370 | 3300035088 | Bacteria | 1293 |
| 578 | Ga0373944_0008786 | 3300035089 | Bacteria | 2730 |
| 579 | Ga0373949_0007976 | 3300035090 | Bacteria | 2318 |
| 580 | Ga0373951_0000189 | 3300035091 | Bacteria | 22384 |
| 581 | Ga0373951_0053331 | 3300035091 | Bacteria | 999 |
| 582 | Ga0373952_0002023 | 3300035092 | Bacteria | 3660 |
| 583 | Ga0373952_0003463 | 3300035092 | Bacteria | 2848 |
| 584 | Ga0373932_0001729 | 3300035112 | Bacteria | 5928 |
| 585 | Ga0373932_0041963 | 3300035112 | Bacteria | 1325 |
| 586 | Ga0373939_0002882 | 3300035114 | Bacteria | 4043 |
| 587 | Ga0373939_0023616 | 3300035114 | Bacteria | 1705 |
| 588 | Ga0373939_0025973 | 3300035114 | Bacteria | 1646 |
| 589 | Ga0373939_0128354 | 3300035114 | Bacteria | 902 |
| 590 | Ga0373941_0000363 | 3300035115 | Bacteria | 8980 |
| 591 | Ga0373941_0068324 | 3300035115 | Bacteria | 1173 |
| 592 | Ga0373945_0023425 | 3300035116 | Bacteria | 2132 |
| 593 | Ga0373953_0014530 | 3300035117 | Bacteria | 2834 |
| 594 | Ga0373953_0025742 | 3300035117 | Bacteria | 2250 |
| 595 | Ga0373953_0034276 | 3300035117 | Bacteria | 1989 |
| 596 | Ga0373954_0009564 | 3300035118 | Bacteria | 4266 |
| 597 | Ga0373954_0036308 | 3300035118 | Bacteria | 2287 |
| 598 | Ga0373954_0057838 | 3300035118 | Bacteria | 1826 |
| 599 | Ga0373956_0016343 | 3300035119 | Bacteria | 3116 |
| 600 | Ga0373956_0026913 | 3300035119 | Bacteria | 2493 |
| 601 | Ga0373956_0034039 | 3300035119 | Bacteria | 2243 |
| 602 | Ga0373956_0340127 | 3300035119 | Bacteria | 715 |
| 603 | Ga0373957_0013580 | 3300035120 | Bacteria | 2766 |
| 604 | Ga0373957_0049474 | 3300035120 | Bacteria | 1604 |
| 605 | Ga0373960_0005418 | 3300035121 | Bacteria | 2955 |
| 606 | Ga0373960_0037620 | 3300035121 | Bacteria | 1383 |
| 607 | Ga0373943_0011131 | 3300035170 | Bacteria | 4044 |
| 608 | Ga0373946_0051342 | 3300035171 | Bacteria | 1725 |
| 609 | Ga0373955_0000249 | 3300035172 | Bacteria | 22417 |
| 610 | Ga0373955_0002898 | 3300035172 | Bacteria | 7524 |
| 611 | Ga0373955_0022122 | 3300035172 | Bacteria | 3221 |
| 612 | Ga0373955_0026958 | 3300035172 | Bacteria | 2965 |
| 613 | Ga0373955_0106574 | 3300035172 | Bacteria | 1616 |
| 614 | Ga0373942_0001810 | 3300035207 | Bacteria | 5406 |
| 615 | Ga0373942_0049618 | 3300035207 | Bacteria | 1172 |
| 616 | Ga0373961_0000633 | 3300035241 | Bacteria | 12709 |
| 617 | Ga0373961_0078130 | 3300035241 | Bacteria | 1036 |
| 618 | Ga0373961_0130379 | 3300035241 | Bacteria | 841 |
| 619 | Ga0373962_0000689 | 3300035242 | Bacteria | 7635 |
| 620 | Ga0373962_0004675 | 3300035242 | Bacteria | 3305 |
| 621 | Ga0373924_0009601 | 3300035410 | Bacteria | 3551 |
| 622 | Ga0373924_0053480 | 3300035410 | Bacteria | 1677 |
| 623 | Ga0373931_0002415 | 3300035691 | Bacteria | 8264 |
| 624 | Ga0373931_0023900 | 3300035691 | Bacteria | 3089 |
| 625 | Ga0373931_0193365 | 3300035691 | Bacteria | 1212 |
| 626 | Ga0373935_0141903 | 3300035692 | Bacteria | 1623 |
| 627 | Ga0373935_0261213 | 3300035692 | Bacteria | 1214 |
| 628 | Ga0373935_0430927 | 3300035692 | Bacteria | 950 |
| 629 | Ga0373927_0871100 | 3300035695 | Unclassified | 594 |
| 630 | Ga0373933_0002548 | 3300035724 | Bacteria | 10223 |
| 631 | Ga0373933_0015532 | 3300035724 | Bacteria | 4246 |
| 632 | Ga0373933_0029959 | 3300035724 | Bacteria | 3149 |
| 633 | Ga0373937_0003343 | 3300036401 | Bacteria | 13462 |
| 634 | Ga0373937_0005946 | 3300036401 | Bacteria | 10502 |
| 635 | Ga0373937_0006652 | 3300036401 | Bacteria | 9974 |
| 636 | Ga0373937_0032148 | 3300036401 | Bacteria | 4758 |
| 637 | Ga0373937_0375534 | 3300036401 | Bacteria | 1348 |
| 638 | Ga0316582_0522086 | 3300036647 | Bacteria | 818 |
| 639 | Ga0373925_0010323 | 3300037068 | Bacteria | 6776 |
| 640 | Ga0373925_0291256 | 3300037068 | Bacteria | 1316 |
| 641 | Ga0395899_0023868 | 3300037312 | Bacteria | 4627 |
| 642 | Ga0395899_0548684 | 3300037312 | Unclassified | 743 |
| 643 | Ga0395900_0025072 | 3300037418 | Bacteria | 6104 |
| 644 | Ga0395900_0030088 | 3300037418 | Bacteria | 5573 |
| 645 | Ga0395900_0032733 | 3300037418 | Bacteria | 5347 |
| 646 | Ga0395900_0067088 | 3300037418 | Bacteria | 3686 |
| 647 | Ga0395900_0557877 | 3300037418 | Bacteria | 1089 |
| 648 | Ga0395898_0012791 | 3300037466 | Bacteria | 8664 |
| 649 | Ga0395898_0044840 | 3300037466 | Bacteria | 4349 |
| 650 | Ga0395898_0064147 | 3300037466 | Bacteria | 3563 |
| 651 | Ga0395898_0096286 | 3300037466 | Bacteria | 2843 |
| 652 | Ga0395901_0052189 | 3300038443 | Bacteria | 4250 |
| 653 | Ga0395901_0062934 | 3300038443 | Bacteria | 3861 |
| 654 | Ga0395901_0079781 | 3300038443 | Bacteria | 3417 |
| 655 | Ga0242419_001940 | 3300038698 | Bacteria | 1319 |
| 656 | Ga0242420_017826 | 3300038996 | Bacteria | 1245 |
| 657 | Ga0436365_0121354 | 3300039437 | Bacteria | 2188 |
| 658 | Ga0436365_0240412 | 3300039437 | Bacteria | 11459 |
| 659 | Ga0436362_1251783 | 3300039453 | Bacteria | 1180 |
| 660 | Ga0439441_008331 | 3300042001 | Bacteria | 1691 |
| 661 | Ga0439448_0015191 | 3300042005 | Bacteria | 2330 |
| 662 | Ga0439455_0010382 | 3300042012 | Bacteria | 2047 |
| 663 | Ga0439463_008538 | 3300042016 | Bacteria | 2525 |
| 664 | Ga0439458_0181699 | 3300042157 | Bacteria | 571 |
| 665 | Ga0439460_0007591 | 3300042461 | Bacteria | 2718 |
| 666 | Ga0450916_069745 | 3300042530 | Bacteria | 585 |
| 667 | Ga0466966_0196236 | 3300044684 | Bacteria | 1222 |
| 668 | Ga0466961_0193538 | 3300044693 | Bacteria | 1260 |
| 669 | Ga0466961_0283374 | 3300044693 | Bacteria | 1014 |
| 670 | Ga0466963_0815007 | 3300044694 | Bacteria | 658 |
| 671 | Ga0466963_0935382 | 3300044694 | Bacteria | 611 |
| 672 | Ga0453684_0081063 | 3300044712 | Bacteria | 4049 |
| 673 | Ga0466971_0098808 | 3300044719 | Bacteria | 1340 |
| 674 | Ga0466959_0051788 | 3300045049 | Bacteria | 3009 |
| 675 | Ga0451576_0023984 | 3300045051 | Bacteria | 6594 |
| 676 | Ga0451576_0843923 | 3300045051 | Bacteria | 962 |
| 677 | Ga0466958_0145501 | 3300045836 | Bacteria | 1493 |
| 678 | Ga0466958_0802816 | 3300045836 | Bacteria | 614 |
| 679 | Ga0466967_0040855 | 3300045976 | Bacteria | 3995 |
| 680 | Ga0466967_0348804 | 3300045976 | Bacteria | 1432 |
| 681 | Ga0495592_0000604 | 3300046454 | Bacteria | 25327 |
| 682 | Ga0495629_0167300 | 3300046459 | Bacteria | 1526 |
| 683 | Ga0495629_0435814 | 3300046459 | Bacteria | 888 |
| 684 | Ga0495641_0040433 | 3300046461 | Bacteria | 2168 |
| 685 | Ga0495651_0006587 | 3300046462 | Bacteria | 8867 |
| 686 | Ga0495651_0557123 | 3300046462 | Bacteria | 727 |
| 687 | Ga0495653_0004982 | 3300046463 | Bacteria | 10779 |
| 688 | Ga0495653_0198794 | 3300046463 | Bacteria | 1362 |
| 689 | Ga0495653_0776423 | 3300046463 | Bacteria | 577 |
| 690 | Ga0495580_0271808 | 3300046472 | Bacteria | 1157 |
| 691 | Ga0495582_0052609 | 3300046473 | Bacteria | 2245 |
| 692 | Ga0495639_0106598 | 3300046475 | Bacteria | 1327 |
| 693 | Ga0495664_0009456 | 3300046477 | Bacteria | 5455 |
| 694 | Ga0495664_0058441 | 3300046477 | Bacteria | 2294 |
| 695 | Ga0495664_0302996 | 3300046477 | Bacteria | 964 |
| 696 | Ga0495608_0011300 | 3300046511 | Bacteria | 6215 |
| 697 | Ga0495618_0008660 | 3300046514 | Bacteria | 6149 |
| 698 | Ga0495618_0056738 | 3300046514 | Bacteria | 2479 |
| 699 | Ga0495618_0079083 | 3300046514 | Bacteria | 2097 |
| 700 | Ga0495618_0144176 | 3300046514 | Bacteria | 1523 |
| 701 | Ga0495628_0076911 | 3300046516 | Bacteria | 2597 |
| 702 | Ga0495628_0295278 | 3300046516 | Bacteria | 1200 |
| 703 | Ga0495630_0165508 | 3300046517 | Bacteria | 1684 |
| 704 | Ga0495630_0532319 | 3300046517 | Bacteria | 901 |
| 705 | Ga0495666_0167768 | 3300046526 | Bacteria | 1016 |
| 706 | Ga0495652_0011134 | 3300046529 | Bacteria | 8150 |
| 707 | Ga0495652_0081886 | 3300046529 | Bacteria | 2661 |
| 708 | Ga0495652_0408858 | 3300046529 | Bacteria | 959 |
| 709 | Ga0495652_0463006 | 3300046529 | Bacteria | 885 |
| 710 | Ga0495665_0047369 | 3300046531 | Bacteria | 2280 |
| 711 | Ga0495640_0063961 | 3300046533 | Bacteria | 2489 |
| 712 | Ga0495640_0395095 | 3300046533 | Bacteria | 849 |
| 713 | Ga0495640_0424261 | 3300046533 | Bacteria | 814 |
| 714 | Ga0495640_0756063 | 3300046533 | Bacteria | 581 |
| 715 | Ga0495586_0007329 | 3300046535 | Bacteria | 5888 |
| 716 | Ga0495586_0698286 | 3300046535 | Bacteria | 586 |
| 717 | Ga0495587_0003722 | 3300046536 | Bacteria | 10121 |
| 718 | Ga0495587_0031441 | 3300046536 | Bacteria | 3214 |
| 719 | Ga0495587_0351648 | 3300046536 | Bacteria | 821 |
| 720 | Ga0495645_0002643 | 3300046543 | Bacteria | 12188 |
| 721 | Ga0495645_0005135 | 3300046543 | Bacteria | 8967 |
| 722 | Ga0495645_0686841 | 3300046543 | Bacteria | 622 |
| 723 | Ga0495667_0014666 | 3300046559 | Bacteria | 5295 |
| 724 | Ga0495667_0015973 | 3300046559 | Bacteria | 5073 |
| 725 | Ga0495667_0646138 | 3300046559 | Bacteria | 657 |
| 726 | Ga0495634_0081330 | 3300046642 | Bacteria | 2118 |
| 727 | Ga0495634_0330982 | 3300046642 | Bacteria | 915 |
| 728 | Ga0495635_0014791 | 3300046663 | Bacteria | 5459 |
| 729 | Ga0495635_0148863 | 3300046663 | Bacteria | 1593 |
| 730 | Ga0495635_0238116 | 3300046663 | Bacteria | 1228 |
| 731 | Ga0495657_0266273 | 3300046675 | Bacteria | 1028 |
| 732 | Ga0495657_0325479 | 3300046675 | Bacteria | 913 |
| 733 | Ga0495599_0006067 | 3300046678 | Bacteria | 7271 |
| 734 | Ga0495623_0005084 | 3300046679 | Bacteria | 8628 |
| 735 | Ga0495646_0001510 | 3300046680 | Bacteria | 13865 |
| 736 | Ga0495646_0181357 | 3300046680 | Bacteria | 1155 |
| 737 | Ga0495669_0108929 | 3300046684 | Bacteria | 1292 |
| 738 | Ga0495613_0175258 | 3300046689 | Bacteria | 1520 |
| 739 | Ga0495613_0380363 | 3300046689 | Bacteria | 965 |
| 740 | Ga0495624_0150794 | 3300046690 | Bacteria | 1422 |
| 741 | Ga0495624_0487288 | 3300046690 | Bacteria | 738 |
| 742 | Ga0495600_0002242 | 3300046809 | Bacteria | 11012 |
| 743 | Ga0495600_0007130 | 3300046809 | Bacteria | 6830 |
| 744 | Ga0495600_0407634 | 3300046809 | Bacteria | 845 |
| 745 | Ga0495600_0516478 | 3300046809 | Bacteria | 733 |
| 746 | Ga0495581_0379853 | 3300047315 | Bacteria | 824 |
| 747 | Ga0495581_0411699 | 3300047315 | Bacteria | 788 |
| 748 | Ga0495604_0000807 | 3300047317 | Bacteria | 26338 |
| 749 | Ga0495604_0018346 | 3300047317 | Bacteria | 5603 |
| 750 | Ga0495604_0032681 | 3300047317 | Bacteria | 4123 |
| 751 | Ga0495674_0060527 | 3300047319 | Bacteria | 3303 |
| 752 | Ga0495674_0109001 | 3300047319 | Bacteria | 2349 |
| 753 | Ga0495674_0531030 | 3300047319 | Bacteria | 938 |
| 754 | Ga0495676_0283497 | 3300047321 | Bacteria | 1121 |
| 755 | Ga0495676_0547610 | 3300047321 | Bacteria | 756 |
| 756 | Ga0495680_0026918 | 3300047322 | Bacteria | 4733 |
| 757 | Ga0495680_0038199 | 3300047322 | Bacteria | 3839 |
| 758 | Ga0495680_0100807 | 3300047322 | Bacteria | 2151 |
| 759 | Ga0495680_0106631 | 3300047322 | Bacteria | 2082 |
| 760 | Ga0495680_0330292 | 3300047322 | Bacteria | 1065 |
| 761 | Ga0495675_0000700 | 3300047444 | Bacteria | 20964 |
| 762 | Ga0495675_0010767 | 3300047444 | Bacteria | 5729 |
| 763 | Ga0495675_0433279 | 3300047444 | Bacteria | 763 |
| 764 | Ga0495684_0255811 | 3300047471 | Bacteria | 1272 |
| 765 | Ga0495593_0056182 | 3300047673 | Bacteria | 2070 |
| 766 | Ga0495593_0200878 | 3300047673 | Bacteria | 1002 |
| 767 | Ga0495602_0001773 | 3300048088 | Bacteria | 21601 |
| 768 | Ga0495602_0012708 | 3300048088 | Bacteria | 8637 |
| 769 | Ga0495602_0054174 | 3300048088 | Bacteria | 3544 |
| 770 | Ga0495614_0430706 | 3300048089 | Bacteria | 622 |
| 771 | Ga0496100_0000839 | 3300048903 | Bacteria | 14752 |
| 772 | Ga0496100_0161943 | 3300048903 | Bacteria | 1604 |
| 773 | Ga0496100_0170130 | 3300048903 | Bacteria | 1568 |
| 774 | Ga0496100_0971509 | 3300048903 | Bacteria | 668 |
| 775 | Ga0496101_0000633 | 3300048904 | Bacteria | 21327 |
| 776 | Ga0496101_0004102 | 3300048904 | Bacteria | 9113 |
| 777 | Ga0496101_0192773 | 3300048904 | Bacteria | 1573 |
| 778 | Ga0496101_0279530 | 3300048904 | Bacteria | 1304 |
| 779 | Ga0496101_0949479 | 3300048904 | Bacteria | 676 |
| 780 | Ga0496102_0002481 | 3300048905 | Bacteria | 15749 |
| 781 | Ga0496102_0128171 | 3300048905 | Bacteria | 2373 |
| 782 | Ga0496102_0149712 | 3300048905 | Bacteria | 2192 |
| 783 | Ga0496102_0488791 | 3300048905 | Bacteria | 1152 |
| 784 | Ga0496102_1178696 | 3300048905 | Bacteria | 685 |
| 785 | Ga0496103_0000717 | 3300048906 | Bacteria | 24507 |
| 786 | Ga0496103_0009959 | 3300048906 | Bacteria | 5621 |
| 787 | Ga0496103_0632701 | 3300048906 | Bacteria | 680 |
| 788 | Ga0496104_0013489 | 3300048907 | Bacteria | 7362 |
| 789 | Ga0496104_0081209 | 3300048907 | Bacteria | 3091 |
| 790 | Ga0496104_0330060 | 3300048907 | Bacteria | 1438 |
| 791 | Ga0496104_0425177 | 3300048907 | Bacteria | 1240 |
| 792 | Ga0496105_0000950 | 3300048908 | Bacteria | 19841 |
| 793 | Ga0496105_0080899 | 3300048908 | Bacteria | 2683 |
| 794 | Ga0496105_0140839 | 3300048908 | Bacteria | 1985 |
| 795 | Ga0496106_0002354 | 3300048909 | Bacteria | 14076 |
| 796 | Ga0496106_0103947 | 3300048909 | Bacteria | 2205 |
| 797 | Ga0496106_0140922 | 3300048909 | Bacteria | 1896 |
| 798 | Ga0496106_0243951 | 3300048909 | Bacteria | 1435 |
| 799 | Ga0496107_0001263 | 3300048910 | Bacteria | 15487 |
| 800 | Ga0496107_0010575 | 3300048910 | Bacteria | 6416 |
| 801 | Ga0496107_0076401 | 3300048910 | Bacteria | 2439 |
| 802 | Ga0496107_0081726 | 3300048910 | Bacteria | 2356 |
| 803 | Ga0496107_0133211 | 3300048910 | Bacteria | 1835 |
| 804 | Ga0496108_0005842 | 3300048911 | Bacteria | 9975 |
| 805 | Ga0496108_0014469 | 3300048911 | Bacteria | 6442 |
| 806 | Ga0496108_0045694 | 3300048911 | Bacteria | 3658 |
| 807 | Ga0496108_0072423 | 3300048911 | Bacteria | 2908 |
| 808 | Ga0496108_0615737 | 3300048911 | Bacteria | 945 |
| 809 | Ga0496108_0844072 | 3300048911 | Bacteria | 788 |
| 810 | Ga0496109_0002017 | 3300048912 | Bacteria | 16843 |
| 811 | Ga0496109_0064505 | 3300048912 | Bacteria | 3352 |
| 812 | Ga0496109_0264743 | 3300048912 | Bacteria | 1619 |
| 813 | Ga0496109_0420494 | 3300048912 | Bacteria | 1262 |
| 814 | Ga0496109_0797386 | 3300048912 | Bacteria | 882 |
| 815 | Ga0496110_0062959 | 3300048913 | Bacteria | 3277 |
| 816 | Ga0496110_0824306 | 3300048913 | Bacteria | 832 |
| 817 | Ga0496111_0047606 | 3300048914 | Bacteria | 3088 |
| 818 | Ga0496111_0126152 | 3300048914 | Bacteria | 1892 |
| 819 | Ga0496112_0011955 | 3300048915 | Bacteria | 7955 |
| 820 | Ga0496112_0063884 | 3300048915 | Bacteria | 3631 |
| 821 | Ga0496112_0182295 | 3300048915 | Bacteria | 2063 |
| 822 | Ga0496112_0381482 | 3300048915 | Bacteria | 1350 |
| 823 | Ga0496113_0002233 | 3300048916 | Bacteria | 11186 |
| 824 | Ga0496113_0029827 | 3300048916 | Bacteria | 3943 |
| 825 | Ga0496113_0182856 | 3300048916 | Bacteria | 1662 |
| 826 | Ga0496114_0068146 | 3300048917 | Bacteria | 2987 |
| 827 | Ga0496114_0316138 | 3300048917 | Bacteria | 1379 |
| 828 | Ga0496115_0013377 | 3300048918 | Bacteria | 6207 |
| 829 | Ga0496115_0173982 | 3300048918 | Bacteria | 1780 |
| 830 | Ga0496115_0259085 | 3300048918 | Bacteria | 1430 |
| 831 | Ga0501031_0001817 | 3300049568 | Bacteria | 13417 |
| 832 | Ga0501032_0014494 | 3300049569 | Bacteria | 5582 |
| 833 | Ga0501032_0138065 | 3300049569 | Bacteria | 1606 |
| 834 | Ga0501033_0014506 | 3300049570 | Bacteria | 5982 |
| 835 | Ga0501033_0069790 | 3300049570 | Bacteria | 2582 |
| 836 | Ga0501033_0491419 | 3300049570 | Bacteria | 850 |
| 837 | Ga0501034_0021775 | 3300049571 | Bacteria | 6531 |
| 838 | Ga0501034_0068635 | 3300049571 | Bacteria | 3555 |
| 839 | Ga0501034_0311509 | 3300049571 | Bacteria | 1508 |
| 840 | Ga0501034_0357091 | 3300049571 | Bacteria | 1389 |
| 841 | Ga0501034_1010191 | 3300049571 | Bacteria | 715 |
| 842 | Ga0501036_0019391 | 3300049572 | Bacteria | 5709 |
| 843 | Ga0501036_0202693 | 3300049572 | Bacteria | 1668 |
| 844 | Ga0501036_0386489 | 3300049572 | Bacteria | 1168 |
| 845 | Ga0501037_0665499 | 3300049573 | Bacteria | 695 |
| 846 | Ga0501038_0101807 | 3300049574 | Bacteria | 2391 |
| 847 | Ga0501038_0105053 | 3300049574 | Bacteria | 2346 |
| 848 | Ga0501039_0363704 | 3300049575 | Bacteria | 1137 |
| 849 | Ga0501043_0218212 | 3300049579 | Bacteria | 1476 |
| 850 | Ga0501043_0498564 | 3300049579 | Bacteria | 910 |
| 851 | Ga0501043_0588455 | 3300049579 | Bacteria | 823 |
| 852 | Ga0501046_0173852 | 3300049580 | Bacteria | 1615 |
| 853 | Ga0501047_0043849 | 3300049581 | Bacteria | 4320 |
| 854 | Ga0501047_0534888 | 3300049581 | Bacteria | 997 |
| 855 | Ga0501047_0736179 | 3300049581 | Bacteria | 802 |
| 856 | Ga0501047_1307430 | 3300049581 | Archaea | 539 |
| 857 | Ga0501048_0049894 | 3300049582 | Bacteria | 2982 |
| 858 | Ga0501048_1339513 | 3300049582 | Bacteria | 515 |
| 859 | Ga0501069_0522343 | 3300049585 | Bacteria | 709 |
| 860 | Ga0501069_0870878 | 3300049585 | Bacteria | 547 |
| 861 | Ga0501070_0106381 | 3300049586 | Bacteria | 2319 |
| 862 | Ga0501070_0124351 | 3300049586 | Bacteria | 2132 |
| 863 | Ga0501070_0478792 | 3300049586 | Bacteria | 1001 |
| 864 | Ga0501070_0582403 | 3300049586 | Bacteria | 893 |
| 865 | Ga0501071_0109523 | 3300049587 | Bacteria | 2040 |
| 866 | Ga0501071_0576804 | 3300049587 | Bacteria | 864 |
| 867 | Ga0501071_0757097 | 3300049587 | Bacteria | 748 |
| 868 | Ga0501071_0975056 | 3300049587 | Bacteria | 655 |
| 869 | Ga0501072_0114497 | 3300049588 | Bacteria | 2147 |
| 870 | Ga0501072_0367395 | 3300049588 | Bacteria | 1142 |
| 871 | Ga0501073_0028170 | 3300049589 | Bacteria | 4014 |
| 872 | Ga0501074_0264212 | 3300049590 | Bacteria | 1223 |
| 873 | Ga0501076_0022574 | 3300049592 | Bacteria | 4838 |
| 874 | Ga0501077_0461930 | 3300049593 | Bacteria | 813 |
| 875 | Ga0501077_0669517 | 3300049593 | Bacteria | 667 |
| 876 | Ga0501079_1245584 | 3300049741 | Bacteria | 586 |
| 877 | Ga0501083_0015623 | 3300049744 | Bacteria | 5315 |
| 878 | Ga0501083_0185831 | 3300049744 | Bacteria | 1357 |
| 879 | Ga0501083_0642080 | 3300049744 | Bacteria | 690 |
| 880 | Ga0501035_0021027 | 3300049822 | Bacteria | 5998 |
| 881 | Ga0501035_0078558 | 3300049822 | Bacteria | 2915 |
| 882 | Ga0501044_0023194 | 3300049823 | Bacteria | 6604 |
| 883 | Ga0501044_0058854 | 3300049823 | Bacteria | 3939 |
| 884 | Ga0501044_0131262 | 3300049823 | Bacteria | 2499 |
| 885 | Ga0501044_0151201 | 3300049823 | Bacteria | 2303 |
| 886 | Ga0501044_0220640 | 3300049823 | Bacteria | 1846 |
| 887 | Ga0501044_0927325 | 3300049823 | Unclassified | 745 |
| 888 | Ga0501044_1363734 | 3300049823 | Bacteria | 575 |
| 889 | nmdc:mga06z11_2876_c1 | 3300050494 | Bacteria | 6617 |
| 890 | nmdc:mga06z11_307728_c1 | 3300050494 | Bacteria | 943 |
| 891 | nmdc:mga06z11_928495_c1 | 3300050494 | Unclassified | 530 |
| 892 | nmdc:mga07m45_166240_c1 | 3300050496 | Bacteria | 1281 |
| 893 | nmdc:mga07m45_16715_c1 | 3300050496 | Bacteria | 3929 |
| 894 | nmdc:mga07m45_71480_c1 | 3300050496 | Bacteria | 1974 |
| 895 | nmdc:mga09592_489504_c1 | 3300050508 | Bacteria | 1059 |
| 896 | nmdc:mga08y16_22355_c1 | 3300050511 | Bacteria | 6675 |
| 897 | nmdc:mga08y16_22831_c1 | 3300050511 | Bacteria | 6603 |
| 898 | nmdc:mga0n895_5206_c1 | 3300050512 | Bacteria | 10827 |
| 899 | nmdc:mga0n895_754317_c1 | 3300050512 | Bacteria | 966 |
| 900 | nmdc:mga0n895_999538_c1 | 3300050512 | Bacteria | 818 |
| 901 | nmdc:mga0rr50_158506_c1 | 3300050513 | Bacteria | 1835 |
| 902 | nmdc:mga0rr50_223325_c1 | 3300050513 | Bacteria | 983 |
| 903 | nmdc:mga0rr50_312938_c1 | 3300050513 | Bacteria | 1315 |
| 904 | nmdc:mga08x19_54072_c1 | 3300050514 | Bacteria | 2584 |
| 905 | nmdc:mga0a205_13129_c1 | 3300050515 | Bacteria | 7693 |
| 906 | nmdc:mga0a205_98453_c1 | 3300050515 | Bacteria | 2823 |
| 907 | Ga0495601_0000233 | 3300053077 | Bacteria | 29812 |
| 908 | Ga0495601_0006401 | 3300053077 | Bacteria | 6886 |
| 909 | Ga0495601_0034773 | 3300053077 | Bacteria | 3144 |
| 910 | Ga0495601_0037667 | 3300053077 | Bacteria | 3023 |
| 911 | Ga0495601_0238201 | 3300053077 | Bacteria | 1188 |
| 912 | Ga0495601_0255778 | 3300053077 | Bacteria | 1143 |
| 913 | Ga0495612_0000533 | 3300053078 | Bacteria | 15307 |
| 914 | Ga0495612_0016648 | 3300053078 | Bacteria | 2946 |
| 915 | Ga0495612_0035482 | 3300053078 | Bacteria | 2021 |
| 916 | Ga0495595_0000360 | 3300053084 | Bacteria | 17303 |
| 917 | Ga0495595_0008907 | 3300053084 | Bacteria | 4135 |
| 918 | Ga0495595_0011483 | 3300053084 | Bacteria | 3703 |
| 919 | Ga0495595_0066145 | 3300053084 | Bacteria | 1701 |
| 920 | Ga0495619_0001179 | 3300053085 | Bacteria | 17221 |
| 921 | Ga0495619_0002698 | 3300053085 | Bacteria | 11606 |
| 922 | Ga0495619_0007775 | 3300053085 | Bacteria | 6786 |
| 923 | Ga0495619_0033967 | 3300053085 | Bacteria | 3314 |
| 924 | Ga0495619_0119157 | 3300053085 | Bacteria | 1809 |
| 925 | Ga0495619_0291014 | 3300053085 | Bacteria | 1131 |
| 926 | Ga0500643_005032 | 3300053087 | Bacteria | 5790 |
| 927 | Ga0500643_125844 | 3300053087 | Unclassified | 690 |
| 928 | Ga0500644_0001907 | 3300053088 | Bacteria | 5349 |
| 929 | Ga0500651_0416824 | 3300053093 | Bacteria | 752 |
| 930 | Ga0500641_0001278 | 3300053096 | Bacteria | 8932 |
| 931 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 932 | Ga0500652_065133 | 3300053131 | Bacteria | 1505 |
| 933 | Ga0500577_0228948 | 3300053142 | Bacteria | 806 |
| 934 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 935 | Ga0500645_001358 | 3300053730 | Bacteria | 12602 |
| 936 | Ga0501084_0554597 | 3300054114 | Bacteria | 971 |
| 937 | Ga0501082_0044600 | 3300060353 | Bacteria | 3824 |
| 938 | Ga0501082_0185934 | 3300060353 | Bacteria | 1808 |
| 939 | Ga0530510_0753301 | 3300061734 | Bacteria | 743 |
| 940 | Ga0070658_10011335 | |||
| 941 | 2214544922 | |||
| 942 | ARcpr5oldR_c000056 | |||
| 943 | ARSoilYngRDRAFT_c00038 | |||
| 944 | ARcpr5yngRDRAFT_c000037 | |||
| 945 | ARSoilOldRDRAFT_c000060 | |||
| 946 | ARCol0oldRDRAFT_c00584 | |||
| 947 | ARCol0yngRDRAFT_1000282 | |||
| 948 | JGI24739J22299_10005110 | |||
| 949 | JGI24737J22298_10010531 | |||
| 950 | JGI24737J22298_10018489 | |||
| 951 | JGI24750J21931_1000905 | |||
| 952 | JGI24748J21848_1000368 | |||
| 953 | JGI24738J21930_10000907 | |||
| 954 | JGI24744J21845_10000074 | |||
| 955 | JGI24035J26624_1000024 | |||
| 956 | JGI24035J26624_1000069 | |||
| 957 | JGI24742J22300_10001012 | |||
| 958 | JGI24751J29686_10005292 | |||
| 959 | JGI25405J52794_10146540 | |||
| 960 | Ga0065717_1001986 | |||
| 961 | Ga0065704_10075779 | |||
| 962 | Ga0065712_10009656 | |||
| 963 | Ga0065712_10078326 | |||
| 964 | Ga0065712_10080698 | |||
| 965 | Ga0065715_10020644 | |||
| 966 | Ga0070658_10445637 | |||
| 967 | Ga0070676_10000085 | |||
| 968 | Ga0070676_10164820 | |||
| 969 | Ga0070683_100003426 | |||
| 970 | Ga0070683_100010425 | |||
| 971 | Ga0070683_100179463 | |||
| 972 | Ga0070690_100023770 | |||
| 973 | Ga0070690_100217662 | |||
| 974 | Ga0070670_100045650 | |||
| 975 | Ga0070677_10000381 | |||
| 976 | Ga0068869_100000832 | |||
| 977 | Ga0070666_10050801 | |||
| 978 | Ga0070666_10154150 | |||
| 979 | Ga0070680_100005059 | |||
| 980 | Ga0070680_100008571 | |||
| 981 | Ga0070680_100270099 | |||
| 982 | Ga0070680_100865053 | |||
| 983 | Ga0070682_100028237 | |||
| 984 | Ga0070682_100031073 | |||
| 985 | Ga0070682_100114322 | |||
| 986 | Ga0068868_100000495 | |||
| 987 | Ga0068868_100210301 | |||
| 988 | Ga0070660_100007071 | |||
| 989 | Ga0070660_100068323 | |||
| 990 | Ga0070660_100068984 | |||
| 991 | Ga0070660_100484773 | |||
| 992 | Ga0070660_100939211 | |||
| 993 | Ga0070689_100064034 | |||
| 994 | Ga0070689_100297273 | |||
| 995 | Ga0070691_10002861 | |||
| 996 | Ga0070691_10101797 | |||
| 997 | Ga0070687_100001770 | |||
| 998 | Ga0070661_100000983 | |||
| 999 | Ga0070692_10002229 | |||
| 1000 | Ga0070668_100005583 | |||
| 1001 | Ga0070668_100099878 | |||
| 1002 | Ga0070669_100002421 | |||
| 1003 | Ga0070675_100001045 | |||
| 1004 | Ga0070671_100000386 | |||
| 1005 | Ga0070671_100028690 | |||
| 1006 | Ga0070671_100167936 | |||
| 1007 | Ga0070671_100737816 | |||
| 1008 | Ga0070674_100006162 | |||
| 1009 | Ga0070674_100957957 | |||
| 1010 | Ga0070673_100009652 | |||
| 1011 | Ga0070688_100033469 | |||
| 1012 | Ga0070688_100125808 | |||
| 1013 | Ga0070688_100126315 | |||
| 1014 | Ga0070659_100007775 | |||
| 1015 | Ga0070659_100222970 | |||
| 1016 | Ga0070667_100296318 | |||
| 1017 | Ga0070667_100657925 | |||
| 1018 | Ga0070703_10005487 | |||
| 1019 | Ga0070709_10016725 | |||
| 1020 | Ga0070709_10023290 | |||
| 1021 | Ga0070709_10143939 | |||
| 1022 | Ga0070709_10829887 | |||
| 1023 | Ga0070709_11070810 | |||
| 1024 | Ga0070714_100028926 | |||
| 1025 | Ga0070714_100031838 | |||
| 1026 | Ga0070714_100076629 | |||
| 1027 | Ga0070714_100736146 | |||
| 1028 | Ga0070713_100028382 | |||
| 1029 | Ga0070713_100242511 | |||
| 1030 | Ga0070713_100833977 | |||
| 1031 | Ga0070713_100895097 | |||
| 1032 | Ga0070710_10034212 | |||
| 1033 | Ga0070710_10050952 | |||
| 1034 | Ga0070701_10000908 | |||
| 1035 | Ga0070711_100011651 | |||
| 1036 | Ga0070711_100054215 | |||
| 1037 | Ga0070711_100125077 | |||
| 1038 | Ga0070711_100214232 | |||
| 1039 | Ga0070711_100245600 | |||
| 1040 | Ga0070711_101677175 | |||
| 1041 | Ga0070705_100003404 | |||
| 1042 | Ga0070705_100365850 | |||
| 1043 | Ga0070705_100408374 | |||
| 1044 | Ga0070700_100003334 | |||
| 1045 | Ga0070700_101561241 | |||
| 1046 | Ga0070694_100005587 | |||
| 1047 | Ga0070708_100064337 | |||
| 1048 | Ga0070663_100012099 | |||
| 1049 | Ga0070663_100150828 | |||
| 1050 | Ga0070663_100240197 | |||
| 1051 | Ga0070663_100733134 | |||
| 1052 | Ga0070678_100000260 | |||
| 1053 | Ga0070678_100154027 | |||
| 1054 | Ga0070678_100594102 | |||
| 1055 | Ga0070662_100084360 | |||
| 1056 | Ga0070662_100414481 | |||
| 1057 | Ga0070662_100497392 | |||
| 1058 | Ga0070681_10003989 | |||
| 1059 | Ga0070681_10035093 | |||
| 1060 | Ga0070681_10071454 | |||
| 1061 | Ga0070681_10405100 | |||
| 1062 | Ga0068867_100002696 | |||
| 1063 | Ga0068867_100107284 | |||
| 1064 | Ga0070685_10007108 | |||
| 1065 | Ga0070685_10023063 | |||
| 1066 | Ga0070685_10149156 | |||
| 1067 | Ga0070707_100222997 | |||
| 1068 | Ga0070698_100733499 | |||
| 1069 | Ga0070699_100506441 | |||
| 1070 | Ga0070679_100016998 | |||
| 1071 | Ga0070679_100043302 | |||
| 1072 | Ga0070679_100062508 | |||
| 1073 | Ga0070679_100460335 | |||
| 1074 | Ga0070679_100527303 | |||
| 1075 | Ga0070679_100864914 | |||
| 1076 | Ga0070684_100002858 | |||
| 1077 | Ga0070684_100029407 | |||
| 1078 | Ga0070684_101135567 | |||
| 1079 | Ga0070684_101321803 | |||
| 1080 | Ga0070684_101622635 | |||
| 1081 | Ga0070697_100443608 | |||
| 1082 | Ga0068853_100073074 | |||
| 1083 | Ga0068853_100173730 | |||
| 1084 | Ga0070672_100006644 | |||
| 1085 | Ga0070686_100030263 | |||
| 1086 | Ga0070686_100197802 | |||
| 1087 | Ga0070695_100020350 | |||
| 1088 | Ga0070695_100022315 | |||
| 1089 | Ga0070696_100034090 | |||
| 1090 | Ga0070696_100328134 | |||
| 1091 | Ga0070696_101826230 | |||
| 1092 | Ga0070693_100000947 | |||
| 1093 | Ga0070693_100024354 | |||
| 1094 | Ga0070693_100027275 | |||
| 1095 | Ga0070665_100355973 | |||
| 1096 | Ga0070665_100718134 | |||
| 1097 | Ga0070704_100239051 | |||
| 1098 | Ga0068855_100147058 | |||
| 1099 | Ga0068855_100216080 | |||
| 1100 | Ga0068855_100261759 | |||
| 1101 | Ga0068855_100417287 | |||
| 1102 | Ga0070664_100002866 | |||
| 1103 | Ga0070664_100701938 | |||
| 1104 | Ga0068857_100002854 | |||
| 1105 | Ga0068857_100185441 | |||
| 1106 | Ga0068854_100014002 | |||
| 1107 | Ga0068854_100213516 | |||
| 1108 | Ga0068854_100489761 | |||
| 1109 | Ga0068856_100002432 | |||
| 1110 | Ga0068856_100064883 | |||
| 1111 | Ga0068856_100192582 | |||
| 1112 | Ga0068856_100460879 | |||
| 1113 | Ga0068856_100957560 | |||
| 1114 | Ga0070702_100001455 | |||
| 1115 | Ga0068852_100022111 | |||
| 1116 | Ga0068852_100426174 | |||
| 1117 | Ga0068852_100580087 | |||
| 1118 | Ga0068859_100268285 | |||
| 1119 | Ga0068859_100402635 | |||
| 1120 | Ga0068864_100003611 | |||
| 1121 | Ga0068866_10000364 | |||
| 1122 | Ga0068866_11110913 | |||
| 1123 | Ga0068861_100006781 | |||
| 1124 | Ga0068861_100310779 | |||
| 1125 | Ga0068851_10026178 | |||
| 1126 | Ga0068851_10305352 | |||
| 1127 | Ga0068870_10000015 | |||
| 1128 | Ga0068863_100000278 | |||
| 1129 | Ga0068863_100043782 | |||
| 1130 | Ga0068858_100042094 | |||
| 1131 | Ga0068858_100357013 | |||
| 1132 | Ga0068860_100005473 | |||
| 1133 | Ga0068860_100196722 | |||
| 1134 | Ga0068860_100374697 | |||
| 1135 | Ga0068860_100422597 | |||
| 1136 | Ga0068860_100976067 | |||
| 1137 | Ga0068862_100003784 | |||
| 1138 | Ga0068862_100435980 | |||
| 1139 | Ga0068862_101571878 | |||
| 1140 | Ga0081455_10001601 | |||
| 1141 | Ga0081455_10082066 | |||
| 1142 | Ga0070717_10144648 | |||
| 1143 | Ga0075432_10240718 | |||
| 1144 | Ga0070715_10016578 | |||
| 1145 | Ga0070716_100018193 | |||
| 1146 | Ga0070716_100114391 | |||
| 1147 | Ga0070716_100153419 | |||
| 1148 | Ga0070712_100012900 | |||
| 1149 | Ga0070712_100078211 | |||
| 1150 | Ga0070712_100309321 | |||
| 1151 | Ga0070712_100371284 | |||
| 1152 | Ga0070712_100440913 | |||
| 1153 | Ga0070712_100773489 | |||
| 1154 | Ga0075367_10035568 | |||
| 1155 | Ga0097621_100009409 | |||
| 1156 | Ga0097621_100019613 | |||
| 1157 | Ga0097621_100252555 | |||
| 1158 | Ga0075370_10041043 | |||
| 1159 | Ga0075370_10116379 | |||
| 1160 | Ga0068871_100005915 | |||
| 1161 | Ga0068871_100088803 | |||
| 1162 | Ga0068871_100153104 | |||
| 1163 | Ga0075433_10088886 | |||
| 1164 | Ga0075434_100011707 | |||
| 1165 | Ga0075429_100543689 | |||
| 1166 | Ga0068865_100046627 | |||
| 1167 | Ga0075436_100144184 | |||
| 1168 | Ga0097620_100268300 | |||
| 1169 | Ga0097620_100402642 | |||
| 1170 | Ga0075435_100307280 | |||
| 1171 | Ga0075435_100434709 | |||
| 1172 | Ga0075435_100491581 | |||
| 1173 | Ga0105251_10079855 | |||
| 1174 | Ga0105251_10284245 | |||
| 1175 | Ga0105244_10092970 | |||
| 1176 | Ga0105250_10041851 | |||
| 1177 | Ga0105250_10166071 | |||
| 1178 | Ga0111539_10022188 | |||
| 1179 | Ga0111539_10080457 | |||
| 1180 | Ga0111539_10121090 | |||
| 1181 | Ga0105245_10003800 | |||
| 1182 | Ga0105245_10158044 | |||
| 1183 | Ga0105245_11102628 | |||
| 1184 | Ga0105245_11284263 | |||
| 1185 | Ga0105245_12090982 | |||
| 1186 | Ga0105247_10012563 | |||
| 1187 | Ga0105247_10029045 | |||
| 1188 | Ga0105247_10427843 | |||
| 1189 | Ga0105247_10978299 | |||
| 1190 | Ga0105243_10007557 | |||
| 1191 | Ga0105243_10023375 | |||
| 1192 | Ga0105243_10185610 | |||
| 1193 | Ga0105241_10000982 | |||
| 1194 | Ga0105241_10023898 | |||
| 1195 | Ga0105241_10280611 | |||
| 1196 | Ga0105241_10291363 | |||
| 1197 | Ga0105242_10001299 | |||
| 1198 | Ga0105242_10008924 | |||
| 1199 | Ga0105242_10133517 | |||
| 1200 | Ga0105248_10002736 | |||
| 1201 | Ga0105248_10011811 | |||
| 1202 | Ga0105248_10157656 | |||
| 1203 | Ga0105248_10358083 | |||
| 1204 | Ga0105237_10019497 | |||
| 1205 | Ga0105237_10295171 | |||
| 1206 | Ga0105237_10365882 | |||
| 1207 | Ga0105237_10372078 | |||
| 1208 | Ga0105237_11521316 | |||
| 1209 | Ga0105238_10040330 | |||
| 1210 | Ga0105238_10278821 | |||
| 1211 | Ga0105238_10545414 | |||
| 1212 | Ga0105249_10003014 | |||
| 1213 | Ga0105249_10087070 | |||
| 1214 | Ga0105249_10114678 | |||
| 1215 | Ga0105249_10420896 | |||
| 1216 | Ga0105249_10540713 | |||
| 1217 | Ga0105239_10015884 | |||
| 1218 | Ga0105239_10101705 | |||
| 1219 | Ga0105239_10350876 | |||
| 1220 | Ga0105239_10634999 | |||
| 1221 | Ga0105246_10004947 | |||
| 1222 | Ga0105246_10158676 | |||
| 1223 | Ga0157328_1001908 | |||
| 1224 | Ga0157346_1001147 | |||
| 1225 | Ga0157343_1004982 | |||
| 1226 | Ga0157322_1001471 | |||
| 1227 | Ga0157347_1011258 | |||
| 1228 | Ga0157342_1004570 | |||
| 1229 | Ga0157315_1007302 | |||
| 1230 | Ga0157373_10017859 | |||
| 1231 | Ga0157373_10065620 | |||
| 1232 | Ga0157373_10178233 | |||
| 1233 | Ga0157373_10481740 | |||
| 1234 | Ga0157371_10160695 | |||
| 1235 | Ga0157371_10226602 | |||
| 1236 | Ga0157370_10125769 | |||
| 1237 | Ga0157370_10196656 | |||
| 1238 | Ga0157369_10045190 | |||
| 1239 | Ga0157369_10373571 | |||
| 1240 | Ga0157369_11556141 | |||
| 1241 | Ga0157374_10009129 | |||
| 1242 | Ga0157374_10091222 | |||
| 1243 | Ga0157374_10487326 | |||
| 1244 | Ga0157378_10004364 | |||
| 1245 | Ga0157378_10042070 | |||
| 1246 | Ga0157378_10474274 | |||
| 1247 | Ga0163162_10011614 | |||
| 1248 | Ga0163162_10087519 | |||
| 1249 | Ga0163162_10341842 | |||
| 1250 | Ga0157372_10195872 | |||
| 1251 | Ga0157372_10249843 | |||
| 1252 | Ga0157372_10611866 | |||
| 1253 | Ga0157372_10618363 | |||
| 1254 | Ga0157372_10721470 | |||
| 1255 | Ga0157372_11798275 | |||
| 1256 | Ga0157375_10008586 | |||
| 1257 | Ga0157375_10330690 | |||
| 1258 | Ga0157375_10657776 | |||
| 1259 | Ga0163163_10063140 | |||
| 1260 | Ga0163163_10260337 | |||
| 1261 | Ga0163163_10842531 | |||
| 1262 | Ga0163163_12583151 | |||
| 1263 | Ga0157380_10003889 | |||
| 1264 | Ga0157380_10113220 | |||
| 1265 | Ga0157380_11219269 | |||
| 1266 | Ga0157377_10000317 | |||
| 1267 | Ga0157379_10000067 | |||
| 1268 | Ga0157379_10018396 | |||
| 1269 | Ga0157379_10516277 | |||
| 1270 | Ga0157376_10005894 | |||
| 1271 | Ga0157376_11634894 | |||
| 1272 | Ga0163161_10000693 | |||
| 1273 | Ga0163161_10126818 | |||
| 1274 | Ga0163161_11175856 | |||
| 1275 | Ga0206356_10272352 | |||
| 1276 | Ga0206356_11494623 | |||
| 1277 | Ga0213876_10013750 | |||
| 1278 | Ga0207666_1000681 | |||
| 1279 | Ga0207666_1001215 | |||
| 1280 | Ga0207673_1001404 | |||
| 1281 | Ga0207697_10016607 | |||
| 1282 | Ga0207697_10119883 | |||
| 1283 | Ga0207653_10003762 | |||
| 1284 | Ga0207653_10074057 | |||
| 1285 | Ga0207682_10000264 | |||
| 1286 | Ga0207692_10002735 | |||
| 1287 | Ga0207642_10000834 | |||
| 1288 | Ga0207642_10300214 | |||
| 1289 | Ga0207710_10005159 | |||
| 1290 | Ga0207710_10025358 | |||
| 1291 | Ga0207710_10087483 | |||
| 1292 | Ga0207710_10379584 | |||
| 1293 | Ga0207688_10015833 | |||
| 1294 | Ga0207688_10062252 | |||
| 1295 | Ga0207680_10013218 | |||
| 1296 | Ga0207647_10041608 | |||
| 1297 | Ga0207685_10004366 | |||
| 1298 | Ga0207685_10043609 | |||
| 1299 | Ga0207699_10040119 | |||
| 1300 | Ga0207699_10128144 | |||
| 1301 | Ga0207699_10173029 | |||
| 1302 | Ga0207699_10513252 | |||
| 1303 | Ga0207645_10000926 | |||
| 1304 | Ga0207645_10222865 | |||
| 1305 | Ga0207645_10451235 | |||
| 1306 | Ga0207643_10000004 | |||
| 1307 | Ga0207705_11374108 | |||
| 1308 | Ga0207684_10096691 | |||
| 1309 | Ga0207654_10000437 | |||
| 1310 | Ga0207654_10872418 | |||
| 1311 | Ga0207707_10004519 | |||
| 1312 | Ga0207707_10060140 | |||
| 1313 | Ga0207707_11118437 | |||
| 1314 | Ga0207671_10010091 | |||
| 1315 | Ga0207671_10283607 | |||
| 1316 | Ga0207693_10001239 | |||
| 1317 | Ga0207693_10006137 | |||
| 1318 | Ga0207693_10013383 | |||
| 1319 | Ga0207693_10064686 | |||
| 1320 | Ga0207693_10335098 | |||
| 1321 | Ga0207663_10019511 | |||
| 1322 | Ga0207663_10022853 | |||
| 1323 | Ga0207663_10071352 | |||
| 1324 | Ga0207663_11144628 | |||
| 1325 | Ga0207660_10004154 | |||
| 1326 | Ga0207660_10015766 | |||
| 1327 | Ga0207660_10028341 | |||
| 1328 | Ga0207660_10140445 | |||
| 1329 | Ga0207660_11010526 | |||
| 1330 | Ga0207662_10032660 | |||
| 1331 | Ga0207662_10328773 | |||
| 1332 | Ga0207662_10381012 | |||
| 1333 | Ga0207657_10052397 | |||
| 1334 | Ga0207657_10054228 | |||
| 1335 | Ga0207657_10077345 | |||
| 1336 | Ga0207657_10643333 | |||
| 1337 | Ga0207649_10000090 | |||
| 1338 | Ga0207652_10001397 | |||
| 1339 | Ga0207652_10004018 | |||
| 1340 | Ga0207652_10068573 | |||
| 1341 | Ga0207652_10250845 | |||
| 1342 | Ga0207652_10424313 | |||
| 1343 | Ga0207652_10613162 | |||
| 1344 | Ga0207681_10001592 | |||
| 1345 | Ga0207694_11216550 | |||
| 1346 | Ga0207650_10007098 | |||
| 1347 | Ga0207659_10000038 | |||
| 1348 | Ga0207687_10000445 | |||
| 1349 | Ga0207687_10017603 | |||
| 1350 | Ga0207700_10003402 | |||
| 1351 | Ga0207700_10085958 | |||
| 1352 | Ga0207700_10099918 | |||
| 1353 | Ga0207664_10608410 | |||
| 1354 | Ga0207644_10000816 | |||
| 1355 | Ga0207644_10514398 | |||
| 1356 | Ga0207690_10000440 | |||
| 1357 | Ga0207690_10082283 | |||
| 1358 | Ga0207690_10144572 | |||
| 1359 | Ga0207690_10244781 | |||
| 1360 | Ga0207690_10440704 | |||
| 1361 | Ga0207706_10008938 | |||
| 1362 | Ga0207706_10055499 | |||
| 1363 | Ga0207706_10059966 | |||
| 1364 | Ga0207686_10000433 | |||
| 1365 | Ga0207686_10369100 | |||
| 1366 | Ga0207709_10000494 | |||
| 1367 | Ga0207709_10021426 | |||
| 1368 | Ga0207709_10184343 | |||
| 1369 | Ga0207670_10001363 | |||
| 1370 | Ga0207670_10139679 | |||
| 1371 | Ga0207670_10512922 | |||
| 1372 | Ga0207670_11006992 | |||
| 1373 | Ga0207669_10000063 | |||
| 1374 | Ga0207669_10109699 | |||
| 1375 | Ga0207669_10455866 | |||
| 1376 | Ga0207704_10001268 | |||
| 1377 | Ga0207665_10003373 | |||
| 1378 | Ga0207665_10028918 | |||
| 1379 | Ga0207665_10030904 | |||
| 1380 | Ga0207665_10108301 | |||
| 1381 | Ga0207691_10000981 | |||
| 1382 | Ga0207691_10517083 | |||
| 1383 | Ga0207711_10000792 | |||
| 1384 | Ga0207711_10012513 | |||
| 1385 | Ga0207711_10075463 | |||
| 1386 | Ga0207689_10002635 | |||
| 1387 | Ga0207689_10247590 | |||
| 1388 | Ga0207689_10419153 | |||
| 1389 | Ga0207661_10000531 | |||
| 1390 | Ga0207661_10284230 | |||
| 1391 | Ga0207661_10473035 | |||
| 1392 | Ga0207679_10001109 | |||
| 1393 | Ga0207679_10054930 | |||
| 1394 | Ga0207679_10231357 | |||
| 1395 | Ga0207679_10526080 | |||
| 1396 | Ga0207667_10022580 | |||
| 1397 | Ga0207667_10554214 | |||
| 1398 | Ga0207651_10000379 | |||
| 1399 | Ga0207651_10565668 | |||
| 1400 | Ga0207712_10000717 | |||
| 1401 | Ga0207712_10339234 | |||
| 1402 | Ga0207712_10659694 | |||
| 1403 | Ga0207668_10000429 | |||
| 1404 | Ga0207668_10016879 | |||
| 1405 | Ga0207640_10000516 | |||
| 1406 | Ga0207658_10020967 | |||
| 1407 | Ga0207658_10079727 | |||
| 1408 | Ga0207658_10436337 | |||
| 1409 | Ga0207677_10001164 | |||
| 1410 | Ga0207677_10217318 | |||
| 1411 | Ga0207703_10007685 | |||
| 1412 | Ga0207703_10074671 | |||
| 1413 | Ga0207703_10140580 | |||
| 1414 | Ga0207703_10456481 | |||
| 1415 | Ga0207639_10003596 | |||
| 1416 | Ga0207639_10292101 | |||
| 1417 | Ga0207639_10346725 | |||
| 1418 | Ga0207678_10002770 | |||
| 1419 | Ga0207678_10026091 | |||
| 1420 | Ga0207678_10140321 | |||
| 1421 | Ga0207708_10055110 | |||
| 1422 | Ga0207708_10055122 | |||
| 1423 | Ga0207702_10003627 | |||
| 1424 | Ga0207702_10230482 | |||
| 1425 | Ga0207702_10430426 | |||
| 1426 | Ga0207702_11190156 | |||
| 1427 | Ga0207641_10003728 | |||
| 1428 | Ga0207641_10046965 | |||
| 1429 | Ga0207641_10535008 | |||
| 1430 | Ga0207648_10013027 | |||
| 1431 | Ga0207648_10412631 | |||
| 1432 | Ga0207648_10648804 | |||
| 1433 | Ga0207676_10000583 | |||
| 1434 | Ga0207676_10078337 | |||
| 1435 | Ga0207676_10295329 | |||
| 1436 | Ga0207674_10028860 | |||
| 1437 | Ga0207674_10409594 | |||
| 1438 | Ga0207675_100036186 | |||
| 1439 | Ga0207675_100429521 | |||
| 1440 | Ga0207683_10000138 | |||
| 1441 | Ga0207683_10025410 | |||
| 1442 | Ga0207683_10228463 | |||
| 1443 | Ga0207698_10005821 | |||
| 1444 | Ga0207698_10649640 | |||
| 1445 | Ga0209973_1012711 | |||
| 1446 | Ga0209967_1001718 | |||
| 1447 | Ga0209995_1003384 | |||
| 1448 | Ga0209968_1009407 | |||
| 1449 | Ga0210002_1000870 | |||
| 1450 | Ga0210002_1023208 | |||
| 1451 | Ga0209983_1005120 | |||
| 1452 | Ga0209971_1014116 | |||
| 1453 | Ga0209971_1057654 | |||
| 1454 | Ga0209966_1003383 | |||
| 1455 | Ga0209966_1013394 | |||
| 1456 | Ga0209998_10007335 | |||
| 1457 | Ga0209998_10008256 | |||
| 1458 | Ga0209974_10006454 | |||
| 1459 | Ga0209974_10063771 | |||
| 1460 | Ga0207428_10001759 | |||
| 1461 | Ga0207428_10023515 | |||
| 1462 | Ga0207428_10194065 | |||
| 1463 | Ga0268266_10062397 | |||
| 1464 | Ga0268265_10002569 | |||
| 1465 | Ga0268265_10551182 | |||
| 1466 | Ga0268264_10002097 | |||
| 1467 | Ga0268264_10271581 | |||
| 1468 | Ga0268264_10529914 | |||
| 1469 | Ga0268264_10715518 | |||
| 1470 | Ga0268264_11680334 | |||
| 1471 | Ga0268264_12150210 | |||
| 1472 | Ga0265337_1001017 | |||
| 1473 | Ga0265338_10184604 | |||
| 1474 | Ga0265338_10328354 | |||
| 1475 | Ga0265338_10444083 | |||
| 1476 | Ga0265330_10009166 | |||
| 1477 | Ga0265332_10168956 | |||
| 1478 | Ga0265332_10170392 | |||
| 1479 | Ga0265325_10000019 | |||
| 1480 | Ga0265325_10004257 | |||
| 1481 | Ga0265325_10043241 | |||
| 1482 | Ga0265340_10055326 | |||
| 1483 | Ga0265340_10122121 | |||
| 1484 | Ga0265339_10001671 | |||
| 1485 | Ga0265339_10019397 | |||
| 1486 | Ga0265316_10016529 | |||
| 1487 | Ga0307408_100939644 | |||
| 1488 | Ga0265313_10001789 | |||
| 1489 | Ga0265313_10004986 | |||
| 1490 | Ga0265313_10023160 | |||
| 1491 | Ga0265313_10024803 | |||
| 1492 | Ga0316575_10096374 | |||
| 1493 | Ga0316579_10030720 | |||
| 1494 | Ga0265314_10000577 | |||
| 1495 | Ga0265314_10028869 | |||
| 1496 | Ga0265342_10000211 | |||
| 1497 | Ga0307406_10525537 | |||
| 1498 | Ga0307414_11928885 | |||
| 1499 | Ga0307411_10340846 | |||
| 1500 | Ga0307415_100792740 | |||
| 1501 | Ga0316583_10002625 | |||
| 1502 | Ga0373930_0000568 | |||
| 1503 | Ga0373930_0180071 | |||
| 1504 | Ga0373948_0000092 | |||
| 1505 | Ga0373950_0008904 | |||
| 1506 | Ga0373958_0000576 | |||
| 1507 | Ga0373958_0018463 | |||
| 1508 | Ga0373959_0000576 | |||
| 1509 | Ga0373959_0018902 | |||
| 1510 | Ga0373938_0008030 | |||
| 1511 | Ga0373926_0010362 | |||
| 1512 | Ga0373928_0000100 | |||
| 1513 | Ga0373928_0010483 | |||
| 1514 | Ga0373934_0015086 | |||
| 1515 | Ga0373940_0000073 | |||
| 1516 | Ga0373940_0039370 | |||
| 1517 | Ga0373944_0008786 | |||
| 1518 | Ga0373949_0007976 | |||
| 1519 | Ga0373951_0000189 | |||
| 1520 | Ga0373951_0053331 | |||
| 1521 | Ga0373952_0002023 | |||
| 1522 | Ga0373952_0003463 | |||
| 1523 | Ga0373932_0001729 | |||
| 1524 | Ga0373932_0041963 | |||
| 1525 | Ga0373939_0002882 | |||
| 1526 | Ga0373939_0023616 | |||
| 1527 | Ga0373939_0025973 | |||
| 1528 | Ga0373939_0128354 | |||
| 1529 | Ga0373941_0000363 | |||
| 1530 | Ga0373941_0068324 | |||
| 1531 | Ga0373945_0023425 | |||
| 1532 | Ga0373953_0014530 | |||
| 1533 | Ga0373953_0025742 | |||
| 1534 | Ga0373953_0034276 | |||
| 1535 | Ga0373954_0009564 | |||
| 1536 | Ga0373954_0036308 | |||
| 1537 | Ga0373954_0057838 | |||
| 1538 | Ga0373956_0016343 | |||
| 1539 | Ga0373956_0026913 | |||
| 1540 | Ga0373956_0034039 | |||
| 1541 | Ga0373956_0340127 | |||
| 1542 | Ga0373957_0013580 | |||
| 1543 | Ga0373957_0049474 | |||
| 1544 | Ga0373960_0005418 | |||
| 1545 | Ga0373960_0037620 | |||
| 1546 | Ga0373943_0011131 | |||
| 1547 | Ga0373946_0051342 | |||
| 1548 | Ga0373955_0000249 | |||
| 1549 | Ga0373955_0002898 | |||
| 1550 | Ga0373955_0022122 | |||
| 1551 | Ga0373955_0026958 | |||
| 1552 | Ga0373955_0106574 | |||
| 1553 | Ga0373942_0001810 | |||
| 1554 | Ga0373942_0049618 | |||
| 1555 | Ga0373961_0000633 | |||
| 1556 | Ga0373961_0078130 | |||
| 1557 | Ga0373961_0130379 | |||
| 1558 | Ga0373962_0000689 | |||
| 1559 | Ga0373962_0004675 | |||
| 1560 | Ga0373924_0009601 | |||
| 1561 | Ga0373924_0053480 | |||
| 1562 | Ga0373931_0002415 | |||
| 1563 | Ga0373931_0023900 | |||
| 1564 | Ga0373931_0193365 | |||
| 1565 | Ga0373935_0141903 | |||
| 1566 | Ga0373935_0261213 | |||
| 1567 | Ga0373935_0430927 | |||
| 1568 | Ga0373927_0871100 | |||
| 1569 | Ga0373933_0002548 | |||
| 1570 | Ga0373933_0015532 | |||
| 1571 | Ga0373933_0029959 | |||
| 1572 | Ga0373937_0003343 | |||
| 1573 | Ga0373937_0005946 | |||
| 1574 | Ga0373937_0006652 | |||
| 1575 | Ga0373937_0032148 | |||
| 1576 | Ga0373937_0375534 | |||
| 1577 | Ga0316582_0522086 | |||
| 1578 | Ga0373925_0010323 | |||
| 1579 | Ga0373925_0291256 | |||
| 1580 | Ga0395899_0023868 | |||
| 1581 | Ga0395899_0548684 | |||
| 1582 | Ga0395900_0025072 | |||
| 1583 | Ga0395900_0030088 | |||
| 1584 | Ga0395900_0032733 | |||
| 1585 | Ga0395900_0067088 | |||
| 1586 | Ga0395900_0557877 | |||
| 1587 | Ga0395898_0012791 | |||
| 1588 | Ga0395898_0044840 | |||
| 1589 | Ga0395898_0064147 | |||
| 1590 | Ga0395898_0096286 | |||
| 1591 | Ga0395901_0052189 | |||
| 1592 | Ga0395901_0062934 | |||
| 1593 | Ga0395901_0079781 | |||
| 1594 | Ga0242419_001940 | |||
| 1595 | Ga0242420_017826 | |||
| 1596 | Ga0436365_0121354 | |||
| 1597 | Ga0436365_0240412 | |||
| 1598 | Ga0436362_1251783 | |||
| 1599 | Ga0439441_008331 | |||
| 1600 | Ga0439448_0015191 | |||
| 1601 | Ga0439455_0010382 | |||
| 1602 | Ga0439463_008538 | |||
| 1603 | Ga0439458_0181699 | |||
| 1604 | Ga0439460_0007591 | |||
| 1605 | Ga0450916_069745 | |||
| 1606 | Ga0466966_0196236 | |||
| 1607 | Ga0466961_0193538 | |||
| 1608 | Ga0466961_0283374 | |||
| 1609 | Ga0466963_0815007 | |||
| 1610 | Ga0466963_0935382 | |||
| 1611 | Ga0453684_0081063 | |||
| 1612 | Ga0466971_0098808 | |||
| 1613 | Ga0466959_0051788 | |||
| 1614 | Ga0451576_0023984 | |||
| 1615 | Ga0451576_0843923 | |||
| 1616 | Ga0466958_0145501 | |||
| 1617 | Ga0466958_0802816 | |||
| 1618 | Ga0466967_0040855 | |||
| 1619 | Ga0466967_0348804 | |||
| 1620 | Ga0495592_0000604 | |||
| 1621 | Ga0495629_0167300 | |||
| 1622 | Ga0495629_0435814 | |||
| 1623 | Ga0495641_0040433 | |||
| 1624 | Ga0495651_0006587 | |||
| 1625 | Ga0495651_0557123 | |||
| 1626 | Ga0495653_0004982 | |||
| 1627 | Ga0495653_0198794 | |||
| 1628 | Ga0495653_0776423 | |||
| 1629 | Ga0495580_0271808 | |||
| 1630 | Ga0495582_0052609 | |||
| 1631 | Ga0495639_0106598 | |||
| 1632 | Ga0495664_0009456 | |||
| 1633 | Ga0495664_0058441 | |||
| 1634 | Ga0495664_0302996 | |||
| 1635 | Ga0495608_0011300 | |||
| 1636 | Ga0495618_0008660 | |||
| 1637 | Ga0495618_0056738 | |||
| 1638 | Ga0495618_0079083 | |||
| 1639 | Ga0495618_0144176 | |||
| 1640 | Ga0495628_0076911 | |||
| 1641 | Ga0495628_0295278 | |||
| 1642 | Ga0495630_0165508 | |||
| 1643 | Ga0495630_0532319 | |||
| 1644 | Ga0495666_0167768 | |||
| 1645 | Ga0495652_0011134 | |||
| 1646 | Ga0495652_0081886 | |||
| 1647 | Ga0495652_0408858 | |||
| 1648 | Ga0495652_0463006 | |||
| 1649 | Ga0495665_0047369 | |||
| 1650 | Ga0495640_0063961 | |||
| 1651 | Ga0495640_0395095 | |||
| 1652 | Ga0495640_0424261 | |||
| 1653 | Ga0495640_0756063 | |||
| 1654 | Ga0495586_0007329 | |||
| 1655 | Ga0495586_0698286 | |||
| 1656 | Ga0495587_0003722 | |||
| 1657 | Ga0495587_0031441 | |||
| 1658 | Ga0495587_0351648 | |||
| 1659 | Ga0495645_0002643 | |||
| 1660 | Ga0495645_0005135 | |||
| 1661 | Ga0495645_0686841 | |||
| 1662 | Ga0495667_0014666 | |||
| 1663 | Ga0495667_0015973 | |||
| 1664 | Ga0495667_0646138 | |||
| 1665 | Ga0495634_0081330 | |||
| 1666 | Ga0495634_0330982 | |||
| 1667 | Ga0495635_0014791 | |||
| 1668 | Ga0495635_0148863 | |||
| 1669 | Ga0495635_0238116 | |||
| 1670 | Ga0495657_0266273 | |||
| 1671 | Ga0495657_0325479 | |||
| 1672 | Ga0495599_0006067 | |||
| 1673 | Ga0495623_0005084 | |||
| 1674 | Ga0495646_0001510 | |||
| 1675 | Ga0495646_0181357 | |||
| 1676 | Ga0495669_0108929 | |||
| 1677 | Ga0495613_0175258 | |||
| 1678 | Ga0495613_0380363 | |||
| 1679 | Ga0495624_0150794 | |||
| 1680 | Ga0495624_0487288 | |||
| 1681 | Ga0495600_0002242 | |||
| 1682 | Ga0495600_0007130 | |||
| 1683 | Ga0495600_0407634 | |||
| 1684 | Ga0495600_0516478 | |||
| 1685 | Ga0495581_0379853 | |||
| 1686 | Ga0495581_0411699 | |||
| 1687 | Ga0495604_0000807 | |||
| 1688 | Ga0495604_0018346 | |||
| 1689 | Ga0495604_0032681 | |||
| 1690 | Ga0495674_0060527 | |||
| 1691 | Ga0495674_0109001 | |||
| 1692 | Ga0495674_0531030 | |||
| 1693 | Ga0495676_0283497 | |||
| 1694 | Ga0495676_0547610 | |||
| 1695 | Ga0495680_0026918 | |||
| 1696 | Ga0495680_0038199 | |||
| 1697 | Ga0495680_0100807 | |||
| 1698 | Ga0495680_0106631 | |||
| 1699 | Ga0495680_0330292 | |||
| 1700 | Ga0495675_0000700 | |||
| 1701 | Ga0495675_0010767 | |||
| 1702 | Ga0495675_0433279 | |||
| 1703 | Ga0495684_0255811 | |||
| 1704 | Ga0495593_0056182 | |||
| 1705 | Ga0495593_0200878 | |||
| 1706 | Ga0495602_0001773 | |||
| 1707 | Ga0495602_0012708 | |||
| 1708 | Ga0495602_0054174 | |||
| 1709 | Ga0495614_0430706 | |||
| 1710 | Ga0496100_0000839 | |||
| 1711 | Ga0496100_0161943 | |||
| 1712 | Ga0496100_0170130 | |||
| 1713 | Ga0496100_0971509 | |||
| 1714 | Ga0496101_0000633 | |||
| 1715 | Ga0496101_0004102 | |||
| 1716 | Ga0496101_0192773 | |||
| 1717 | Ga0496101_0279530 | |||
| 1718 | Ga0496101_0949479 | |||
| 1719 | Ga0496102_0002481 | |||
| 1720 | Ga0496102_0128171 | |||
| 1721 | Ga0496102_0149712 | |||
| 1722 | Ga0496102_0488791 | |||
| 1723 | Ga0496102_1178696 | |||
| 1724 | Ga0496103_0000717 | |||
| 1725 | Ga0496103_0009959 | |||
| 1726 | Ga0496103_0632701 | |||
| 1727 | Ga0496104_0013489 | |||
| 1728 | Ga0496104_0081209 | |||
| 1729 | Ga0496104_0330060 | |||
| 1730 | Ga0496104_0425177 | |||
| 1731 | Ga0496105_0000950 | |||
| 1732 | Ga0496105_0080899 | |||
| 1733 | Ga0496105_0140839 | |||
| 1734 | Ga0496106_0002354 | |||
| 1735 | Ga0496106_0103947 | |||
| 1736 | Ga0496106_0140922 | |||
| 1737 | Ga0496106_0243951 | |||
| 1738 | Ga0496107_0001263 | |||
| 1739 | Ga0496107_0010575 | |||
| 1740 | Ga0496107_0076401 | |||
| 1741 | Ga0496107_0081726 | |||
| 1742 | Ga0496107_0133211 | |||
| 1743 | Ga0496108_0005842 | |||
| 1744 | Ga0496108_0014469 | |||
| 1745 | Ga0496108_0045694 | |||
| 1746 | Ga0496108_0072423 | |||
| 1747 | Ga0496108_0615737 | |||
| 1748 | Ga0496108_0844072 | |||
| 1749 | Ga0496109_0002017 | |||
| 1750 | Ga0496109_0064505 | |||
| 1751 | Ga0496109_0264743 | |||
| 1752 | Ga0496109_0420494 | |||
| 1753 | Ga0496109_0797386 | |||
| 1754 | Ga0496110_0062959 | |||
| 1755 | Ga0496110_0824306 | |||
| 1756 | Ga0496111_0047606 | |||
| 1757 | Ga0496111_0126152 | |||
| 1758 | Ga0496112_0011955 | |||
| 1759 | Ga0496112_0063884 | |||
| 1760 | Ga0496112_0182295 | |||
| 1761 | Ga0496112_0381482 | |||
| 1762 | Ga0496113_0002233 | |||
| 1763 | Ga0496113_0029827 | |||
| 1764 | Ga0496113_0182856 | |||
| 1765 | Ga0496114_0068146 | |||
| 1766 | Ga0496114_0316138 | |||
| 1767 | Ga0496115_0013377 | |||
| 1768 | Ga0496115_0173982 | |||
| 1769 | Ga0496115_0259085 | |||
| 1770 | Ga0501031_0001817 | |||
| 1771 | Ga0501032_0014494 | |||
| 1772 | Ga0501032_0138065 | |||
| 1773 | Ga0501033_0014506 | |||
| 1774 | Ga0501033_0069790 | |||
| 1775 | Ga0501033_0491419 | |||
| 1776 | Ga0501034_0021775 | |||
| 1777 | Ga0501034_0068635 | |||
| 1778 | Ga0501034_0311509 | |||
| 1779 | Ga0501034_0357091 | |||
| 1780 | Ga0501034_1010191 | |||
| 1781 | Ga0501036_0019391 | |||
| 1782 | Ga0501036_0202693 | |||
| 1783 | Ga0501036_0386489 | |||
| 1784 | Ga0501037_0665499 | |||
| 1785 | Ga0501038_0101807 | |||
| 1786 | Ga0501038_0105053 | |||
| 1787 | Ga0501039_0363704 | |||
| 1788 | Ga0501043_0218212 | |||
| 1789 | Ga0501043_0498564 | |||
| 1790 | Ga0501043_0588455 | |||
| 1791 | Ga0501046_0173852 | |||
| 1792 | Ga0501047_0043849 | |||
| 1793 | Ga0501047_0534888 | |||
| 1794 | Ga0501047_0736179 | |||
| 1795 | Ga0501047_1307430 | |||
| 1796 | Ga0501048_0049894 | |||
| 1797 | Ga0501048_1339513 | |||
| 1798 | Ga0501069_0522343 | |||
| 1799 | Ga0501069_0870878 | |||
| 1800 | Ga0501070_0106381 | |||
| 1801 | Ga0501070_0124351 | |||
| 1802 | Ga0501070_0478792 | |||
| 1803 | Ga0501070_0582403 | |||
| 1804 | Ga0501071_0109523 | |||
| 1805 | Ga0501071_0576804 | |||
| 1806 | Ga0501071_0757097 | |||
| 1807 | Ga0501071_0975056 | |||
| 1808 | Ga0501072_0114497 | |||
| 1809 | Ga0501072_0367395 | |||
| 1810 | Ga0501073_0028170 | |||
| 1811 | Ga0501074_0264212 | |||
| 1812 | Ga0501076_0022574 | |||
| 1813 | Ga0501077_0461930 | |||
| 1814 | Ga0501077_0669517 | |||
| 1815 | Ga0501079_1245584 | |||
| 1816 | Ga0501083_0015623 | |||
| 1817 | Ga0501083_0185831 | |||
| 1818 | Ga0501083_0642080 | |||
| 1819 | Ga0501035_0021027 | |||
| 1820 | Ga0501035_0078558 | |||
| 1821 | Ga0501044_0023194 | |||
| 1822 | Ga0501044_0058854 | |||
| 1823 | Ga0501044_0131262 | |||
| 1824 | Ga0501044_0151201 | |||
| 1825 | Ga0501044_0220640 | |||
| 1826 | Ga0501044_0927325 | |||
| 1827 | Ga0501044_1363734 | |||
| 1828 | nmdc:mga06z11_2876_c1 | |||
| 1829 | nmdc:mga06z11_307728_c1 | |||
| 1830 | nmdc:mga06z11_928495_c1 | |||
| 1831 | nmdc:mga07m45_166240_c1 | |||
| 1832 | nmdc:mga07m45_16715_c1 | |||
| 1833 | nmdc:mga07m45_71480_c1 | |||
| 1834 | nmdc:mga09592_489504_c1 | |||
| 1835 | nmdc:mga08y16_22355_c1 | |||
| 1836 | nmdc:mga08y16_22831_c1 | |||
| 1837 | nmdc:mga0n895_5206_c1 | |||
| 1838 | nmdc:mga0n895_754317_c1 | |||
| 1839 | nmdc:mga0n895_999538_c1 | |||
| 1840 | nmdc:mga0rr50_158506_c1 | |||
| 1841 | nmdc:mga0rr50_223325_c1 | |||
| 1842 | nmdc:mga0rr50_312938_c1 | |||
| 1843 | nmdc:mga08x19_54072_c1 | |||
| 1844 | nmdc:mga0a205_13129_c1 | |||
| 1845 | nmdc:mga0a205_98453_c1 | |||
| 1846 | Ga0495601_0000233 | |||
| 1847 | Ga0495601_0006401 | |||
| 1848 | Ga0495601_0034773 | |||
| 1849 | Ga0495601_0037667 | |||
| 1850 | Ga0495601_0238201 | |||
| 1851 | Ga0495601_0255778 | |||
| 1852 | Ga0495612_0000533 | |||
| 1853 | Ga0495612_0016648 | |||
| 1854 | Ga0495612_0035482 | |||
| 1855 | Ga0495595_0000360 | |||
| 1856 | Ga0495595_0008907 | |||
| 1857 | Ga0495595_0011483 | |||
| 1858 | Ga0495595_0066145 | |||
| 1859 | Ga0495619_0001179 | |||
| 1860 | Ga0495619_0002698 | |||
| 1861 | Ga0495619_0007775 | |||
| 1862 | Ga0495619_0033967 | |||
| 1863 | Ga0495619_0119157 | |||
| 1864 | Ga0495619_0291014 | |||
| 1865 | Ga0500643_005032 | |||
| 1866 | Ga0500643_125844 | |||
| 1867 | Ga0500644_0001907 | |||
| 1868 | Ga0500651_0416824 | |||
| 1869 | Ga0500641_0001278 | |||
| 1870 | Ga0500595_000003 | |||
| 1871 | Ga0500652_065133 | |||
| 1872 | Ga0500577_0228948 | |||
| 1873 | Ga0500616_0000002 | |||
| 1874 | Ga0500645_001358 | |||
| 1875 | Ga0501084_0554597 | |||
| 1876 | Ga0501082_0044600 | |||
| 1877 | Ga0501082_0185934 | |||
| 1878 | Ga0530510_0753301 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.9147 | 8 | 143 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.9002 | 8 | 143 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8989 | 10 | 147 |
| 2qdl-assembly1.cif.gz_A | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8936 | 10 | 140 |
| 8c5v-assembly1.cif.gz_H | chemotaxis core signalling unit from e protein lysed e. coli cells | 0.8819 | 10 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8898 | 29 | 96 | 2.40.50.180 |
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8818 | 30 | 96 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8682 | 29 | 92 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8445 | 29 | 92 | 2.40.50.180 |
| 1b3qA04 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8157 | 30 | 95 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327JSZ2-F1-model_v4 | Chemotaxis protein CheW | 0.9838 | 3 | 144 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A212IYY1-F1-model_v4 | CheW protein | 0.9799 | 2 | 144 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A522A6C7-F1-model_v4 | Chemotaxis protein CheW | 0.9785 | 13 | 145 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A317FC28-F1-model_v4 | Chemotaxis protein CheW | 0.9783 | 1 | 145 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A0P7VGF4-F1-model_v4 | Chemotaxis signal relay system purine-binding protiein CheW | 0.9766 | 5 | 144 |
GO:0005829
GO:0006935 GO:0007165 |