F486272

General Info

Members Datasets Scaffolds Average Seq Length
939 417 1878 153

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10011335|Ga0070658_100113354
Length 150
Sequence MSETGTLREYVTAEIGGELIGMPILRVQDVFIPESPTRVPLAPPEIAGVLNLRGRIVTLIDMRRRLGLSGGSDKASLAIGVELRGESYGLLIDAIGEVLKLDDDAREGNPVNLDPRLARVSTGIHRLNDRLLMVLDVDRVLDIAVQSIAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
129 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
130 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
131 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
132 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
133 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
134 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
255 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
256 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
257 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
270 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
271 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
272 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
273 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
294 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
300 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
301 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
302 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
303 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
311 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
329 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
330 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
331 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
390 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
411 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
412 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 6.39
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10011335 3300005327 Bacteria 7148
2 2214544922 2209111006 Bacteria 19930
3 ARcpr5oldR_c000056 3300000041 Bacteria 20790
4 ARSoilYngRDRAFT_c00038 3300000042 Bacteria 20556
5 ARcpr5yngRDRAFT_c000037 3300000043 Bacteria 20897
6 ARSoilOldRDRAFT_c000060 3300000044 Bacteria 22426
7 ARCol0oldRDRAFT_c00584 3300000045 Bacteria 3237
8 ARCol0yngRDRAFT_1000282 3300000652 Bacteria 8006
9 JGI24739J22299_10005110 3300001989 Bacteria 4996
10 JGI24737J22298_10010531 3300001990 Bacteria 3050
11 JGI24737J22298_10018489 3300001990 Bacteria 2237
12 JGI24750J21931_1000905 3300002070 Bacteria 4030
13 JGI24748J21848_1000368 3300002074 Bacteria 5120
14 JGI24738J21930_10000907 3300002075 Bacteria 8520
15 JGI24744J21845_10000074 3300002077 Bacteria 12517
16 JGI24035J26624_1000024 3300002126 Bacteria 10977
17 JGI24035J26624_1000069 3300002126 Bacteria 8293
18 JGI24742J22300_10001012 3300002244 Bacteria 4326
19 JGI24751J29686_10005292 3300002459 Bacteria 2625
20 JGI25405J52794_10146540 3300003911 Bacteria 538
21 Ga0065717_1001986 3300005276 Bacteria 4090
22 Ga0065704_10075779 3300005289 Bacteria 5428
23 Ga0065712_10009656 3300005290 Bacteria 2559
24 Ga0065712_10078326 3300005290 Bacteria 3364
25 Ga0065712_10080698 3300005290 Bacteria 3078
26 Ga0065715_10020644 3300005293 Bacteria 3110
27 Ga0070658_10445637 3300005327 Bacteria 1115
28 Ga0070676_10000085 3300005328 Bacteria 32591
29 Ga0070676_10164820 3300005328 Bacteria 1429
30 Ga0070683_100003426 3300005329 Bacteria 12877
31 Ga0070683_100010425 3300005329 Bacteria 7992
32 Ga0070683_100179463 3300005329 Bacteria 2010
33 Ga0070690_100023770 3300005330 Bacteria 3762
34 Ga0070690_100217662 3300005330 Bacteria 1337
35 Ga0070670_100045650 3300005331 Bacteria 3767
36 Ga0070677_10000381 3300005333 Bacteria 15617
37 Ga0068869_100000832 3300005334 Bacteria 17622
38 Ga0070666_10050801 3300005335 Bacteria 2789
39 Ga0070666_10154150 3300005335 Bacteria 1604
40 Ga0070680_100005059 3300005336 Bacteria 9947
41 Ga0070680_100008571 3300005336 Bacteria 7835
42 Ga0070680_100270099 3300005336 Bacteria 1440
43 Ga0070680_100865053 3300005336 Bacteria 779
44 Ga0070682_100028237 3300005337 Bacteria 3374
45 Ga0070682_100031073 3300005337 Bacteria 3229
46 Ga0070682_100114322 3300005337 Bacteria 1804
47 Ga0068868_100000495 3300005338 Bacteria 26269
48 Ga0068868_100210301 3300005338 Bacteria 1625
49 Ga0070660_100007071 3300005339 Bacteria 7798
50 Ga0070660_100068323 3300005339 Bacteria 2769
51 Ga0070660_100068984 3300005339 Bacteria 2756
52 Ga0070660_100484773 3300005339 Bacteria 1028
53 Ga0070660_100939211 3300005339 Bacteria 730
54 Ga0070689_100064034 3300005340 Bacteria 2861
55 Ga0070689_100297273 3300005340 Bacteria 1343
56 Ga0070691_10002861 3300005341 Bacteria 7728
57 Ga0070691_10101797 3300005341 Bacteria 1427
58 Ga0070687_100001770 3300005343 Bacteria 7798
59 Ga0070661_100000983 3300005344 Bacteria 20204
60 Ga0070692_10002229 3300005345 Bacteria 7429
61 Ga0070668_100005583 3300005347 Bacteria 9331
62 Ga0070668_100099878 3300005347 Bacteria 2298
63 Ga0070669_100002421 3300005353 Bacteria 13502
64 Ga0070675_100001045 3300005354 Bacteria 19938
65 Ga0070671_100000386 3300005355 Bacteria 30345
66 Ga0070671_100028690 3300005355 Bacteria 4584
67 Ga0070671_100167936 3300005355 Bacteria 1855
68 Ga0070671_100737816 3300005355 Bacteria 855
69 Ga0070674_100006162 3300005356 Bacteria 6974
70 Ga0070674_100957957 3300005356 Bacteria 749
71 Ga0070673_100009652 3300005364 Bacteria 6491
72 Ga0070688_100033469 3300005365 Bacteria 3107
73 Ga0070688_100125808 3300005365 Bacteria 1722
74 Ga0070688_100126315 3300005365 Bacteria 1719
75 Ga0070659_100007775 3300005366 Bacteria 7798
76 Ga0070659_100222970 3300005366 Bacteria 1557
77 Ga0070667_100296318 3300005367 Bacteria 1455
78 Ga0070667_100657925 3300005367 Bacteria 967
79 Ga0070703_10005487 3300005406 Bacteria 3548
80 Ga0070709_10016725 3300005434 Bacteria 4193
81 Ga0070709_10023290 3300005434 Bacteria 3633
82 Ga0070709_10143939 3300005434 Bacteria 1640
83 Ga0070709_10829887 3300005434 Bacteria 727
84 Ga0070709_11070810 3300005434 Bacteria 644
85 Ga0070714_100028926 3300005435 Bacteria 4603
86 Ga0070714_100031838 3300005435 Bacteria 4402
87 Ga0070714_100076629 3300005435 Bacteria 2904
88 Ga0070714_100736146 3300005435 Bacteria 953
89 Ga0070713_100028382 3300005436 Bacteria 4418
90 Ga0070713_100242511 3300005436 Bacteria 1642
91 Ga0070713_100833977 3300005436 Bacteria 885
92 Ga0070713_100895097 3300005436 Bacteria 853
93 Ga0070710_10034212 3300005437 Bacteria 2764
94 Ga0070710_10050952 3300005437 Bacteria 2323
95 Ga0070701_10000908 3300005438 Bacteria 10710
96 Ga0070711_100011651 3300005439 Bacteria 5464
97 Ga0070711_100054215 3300005439 Bacteria 2766
98 Ga0070711_100125077 3300005439 Bacteria 1908
99 Ga0070711_100214232 3300005439 Bacteria 1493
100 Ga0070711_100245600 3300005439 Bacteria 1401
101 Ga0070711_101677175 3300005439 Bacteria 557
102 Ga0070705_100003404 3300005440 Bacteria 7798
103 Ga0070705_100365850 3300005440 Bacteria 1056
104 Ga0070705_100408374 3300005440 Bacteria 1007
105 Ga0070700_100003334 3300005441 Bacteria 8278
106 Ga0070700_101561241 3300005441 Unclassified 563
107 Ga0070694_100005587 3300005444 Bacteria 7622
108 Ga0070708_100064337 3300005445 Bacteria 3286
109 Ga0070663_100012099 3300005455 Bacteria 5446
110 Ga0070663_100150828 3300005455 Bacteria 1782
111 Ga0070663_100240197 3300005455 Bacteria 1429
112 Ga0070663_100733134 3300005455 Bacteria 842
113 Ga0070678_100000260 3300005456 Bacteria 24374
114 Ga0070678_100154027 3300005456 Bacteria 1855
115 Ga0070678_100594102 3300005456 Bacteria 987
116 Ga0070662_100084360 3300005457 Bacteria 2372
117 Ga0070662_100414481 3300005457 Bacteria 1113
118 Ga0070662_100497392 3300005457 Bacteria 1017
119 Ga0070681_10003989 3300005458 Bacteria 13923
120 Ga0070681_10035093 3300005458 Bacteria 5038
121 Ga0070681_10071454 3300005458 Bacteria 3435
122 Ga0070681_10405100 3300005458 Bacteria 1275
123 Ga0068867_100002696 3300005459 Bacteria 12524
124 Ga0068867_100107284 3300005459 Bacteria 2140
125 Ga0070685_10007108 3300005466 Bacteria 5717
126 Ga0070685_10023063 3300005466 Bacteria 3403
127 Ga0070685_10149156 3300005466 Bacteria 1480
128 Ga0070707_100222997 3300005468 Bacteria 1836
129 Ga0070698_100733499 3300005471 Bacteria 931
130 Ga0070699_100506441 3300005518 Bacteria 1097
131 Ga0070679_100016998 3300005530 Bacteria 7032
132 Ga0070679_100043302 3300005530 Bacteria 4483
133 Ga0070679_100062508 3300005530 Bacteria 3712
134 Ga0070679_100460335 3300005530 Bacteria 1216
135 Ga0070679_100527303 3300005530 Bacteria 1125
136 Ga0070679_100864914 3300005530 Bacteria 847
137 Ga0070684_100002858 3300005535 Bacteria 12838
138 Ga0070684_100029407 3300005535 Bacteria 4656
139 Ga0070684_101135567 3300005535 Bacteria 734
140 Ga0070684_101321803 3300005535 Bacteria 679
141 Ga0070684_101622635 3300005535 Unclassified 610
142 Ga0070697_100443608 3300005536 Bacteria 1130
143 Ga0068853_100073074 3300005539 Bacteria 2989
144 Ga0068853_100173730 3300005539 Bacteria 1950
145 Ga0070672_100006644 3300005543 Bacteria 7790
146 Ga0070686_100030263 3300005544 Bacteria 3300
147 Ga0070686_100197802 3300005544 Bacteria 1439
148 Ga0070695_100020350 3300005545 Bacteria 4051
149 Ga0070695_100022315 3300005545 Bacteria 3882
150 Ga0070696_100034090 3300005546 Bacteria 3501
151 Ga0070696_100328134 3300005546 Bacteria 1179
152 Ga0070696_101826230 3300005546 Bacteria 525
153 Ga0070693_100000947 3300005547 Bacteria 12881
154 Ga0070693_100024354 3300005547 Bacteria 3245
155 Ga0070693_100027275 3300005547 Bacteria 3094
156 Ga0070665_100355973 3300005548 Bacteria 1470
157 Ga0070665_100718134 3300005548 Bacteria 1012
158 Ga0070704_100239051 3300005549 Bacteria 1485
159 Ga0068855_100147058 3300005563 Bacteria 2682
160 Ga0068855_100216080 3300005563 Bacteria 2152
161 Ga0068855_100261759 3300005563 Bacteria 1926
162 Ga0068855_100417287 3300005563 Bacteria 1468
163 Ga0070664_100002866 3300005564 Bacteria 13967
164 Ga0070664_100701938 3300005564 Bacteria 943
165 Ga0068857_100002854 3300005577 Bacteria 14200
166 Ga0068857_100185441 3300005577 Bacteria 1894
167 Ga0068854_100014002 3300005578 Bacteria 5277
168 Ga0068854_100213516 3300005578 Bacteria 1523
169 Ga0068854_100489761 3300005578 Bacteria 1034
170 Ga0068856_100002432 3300005614 Bacteria 19156
171 Ga0068856_100064883 3300005614 Bacteria 3608
172 Ga0068856_100192582 3300005614 Bacteria 2053
173 Ga0068856_100460879 3300005614 Bacteria 1292
174 Ga0068856_100957560 3300005614 Bacteria 874
175 Ga0070702_100001455 3300005615 Bacteria 9702
176 Ga0068852_100022111 3300005616 Bacteria 5093
177 Ga0068852_100426174 3300005616 Bacteria 1309
178 Ga0068852_100580087 3300005616 Bacteria 1124
179 Ga0068859_100268285 3300005617 Bacteria 1799
180 Ga0068859_100402635 3300005617 Bacteria 1465
181 Ga0068864_100003611 3300005618 Bacteria 12790
182 Ga0068866_10000364 3300005718 Bacteria 21278
183 Ga0068866_11110913 3300005718 Bacteria 567
184 Ga0068861_100006781 3300005719 Bacteria 7824
185 Ga0068861_100310779 3300005719 Bacteria 1369
186 Ga0068851_10026178 3300005834 Bacteria 2864
187 Ga0068851_10305352 3300005834 Bacteria 916
188 Ga0068870_10000015 3300005840 Bacteria 63346
189 Ga0068863_100000278 3300005841 Bacteria 53024
190 Ga0068863_100043782 3300005841 Bacteria 4249
191 Ga0068858_100042094 3300005842 Bacteria 4235
192 Ga0068858_100357013 3300005842 Bacteria 1400
193 Ga0068860_100005473 3300005843 Bacteria 12870
194 Ga0068860_100196722 3300005843 Bacteria 1952
195 Ga0068860_100374697 3300005843 Bacteria 1404
196 Ga0068860_100422597 3300005843 Bacteria 1321
197 Ga0068860_100976067 3300005843 Unclassified 865
198 Ga0068862_100003784 3300005844 Bacteria 12895
199 Ga0068862_100435980 3300005844 Bacteria 1232
200 Ga0068862_101571878 3300005844 Bacteria 664
201 Ga0081455_10001601 3300005937 Bacteria 27658
202 Ga0081455_10082066 3300005937 Bacteria 2638
203 Ga0070717_10144648 3300006028 Bacteria 2053
204 Ga0075432_10240718 3300006058 Bacteria 731
205 Ga0070715_10016578 3300006163 Bacteria 2771
206 Ga0070716_100018193 3300006173 Bacteria 3656
207 Ga0070716_100114391 3300006173 Bacteria 1678
208 Ga0070716_100153419 3300006173 Bacteria 1484
209 Ga0070712_100012900 3300006175 Bacteria 5324
210 Ga0070712_100078211 3300006175 Bacteria 2387
211 Ga0070712_100309321 3300006175 Bacteria 1281
212 Ga0070712_100371284 3300006175 Bacteria 1175
213 Ga0070712_100440913 3300006175 Bacteria 1083
214 Ga0070712_100773489 3300006175 Bacteria 822
215 Ga0075367_10035568 3300006178 Bacteria 2883
216 Ga0097621_100009409 3300006237 Bacteria 7089
217 Ga0097621_100019613 3300006237 Bacteria 5194
218 Ga0097621_100252555 3300006237 Bacteria 1544
219 Ga0075370_10041043 3300006353 Bacteria 2612
220 Ga0075370_10116379 3300006353 Bacteria 1554
221 Ga0068871_100005915 3300006358 Bacteria 8606
222 Ga0068871_100088803 3300006358 Bacteria 2572
223 Ga0068871_100153104 3300006358 Bacteria 1967
224 Ga0075433_10088886 3300006852 Bacteria 2730
225 Ga0075434_100011707 3300006871 Bacteria 8283
226 Ga0075429_100543689 3300006880 Bacteria 1018
227 Ga0068865_100046627 3300006881 Bacteria 2974
228 Ga0075436_100144184 3300006914 Bacteria 1674
229 Ga0097620_100268300 3300006931 Bacteria 1799
230 Ga0097620_100402642 3300006931 Bacteria 1465
231 Ga0075435_100307280 3300007076 Bacteria 1357
232 Ga0075435_100434709 3300007076 Bacteria 1131
233 Ga0075435_100491581 3300007076 Bacteria 1060
234 Ga0105251_10079855 3300009011 Bacteria 1513
235 Ga0105251_10284245 3300009011 Bacteria 748
236 Ga0105244_10092970 3300009036 Bacteria 1482
237 Ga0105250_10041851 3300009092 Bacteria 1836
238 Ga0105250_10166071 3300009092 Bacteria 923
239 Ga0111539_10022188 3300009094 Bacteria 7804
240 Ga0111539_10080457 3300009094 Bacteria 3833
241 Ga0111539_10121090 3300009094 Bacteria 3066
242 Ga0105245_10003800 3300009098 Bacteria 13429
243 Ga0105245_10158044 3300009098 Bacteria 2149
244 Ga0105245_11102628 3300009098 Bacteria 840
245 Ga0105245_11284263 3300009098 Bacteria 781
246 Ga0105245_12090982 3300009098 Bacteria 620
247 Ga0105247_10012563 3300009101 Bacteria 5087
248 Ga0105247_10029045 3300009101 Bacteria 3348
249 Ga0105247_10427843 3300009101 Bacteria 949
250 Ga0105247_10978299 3300009101 Bacteria 659
251 Ga0105243_10007557 3300009148 Bacteria 8357
252 Ga0105243_10023375 3300009148 Bacteria 4707
253 Ga0105243_10185610 3300009148 Bacteria 1812
254 Ga0105241_10000982 3300009174 Bacteria 21606
255 Ga0105241_10023898 3300009174 Bacteria 4536
256 Ga0105241_10280611 3300009174 Bacteria 1423
257 Ga0105241_10291363 3300009174 Bacteria 1398
258 Ga0105242_10001299 3300009176 Bacteria 19749
259 Ga0105242_10008924 3300009176 Bacteria 7694
260 Ga0105242_10133517 3300009176 Bacteria 2146
261 Ga0105248_10002736 3300009177 Bacteria 19584
262 Ga0105248_10011811 3300009177 Bacteria 9634
263 Ga0105248_10157656 3300009177 Bacteria 2561
264 Ga0105248_10358083 3300009177 Bacteria 1643
265 Ga0105237_10019497 3300009545 Bacteria 7004
266 Ga0105237_10295171 3300009545 Bacteria 1624
267 Ga0105237_10365882 3300009545 Bacteria 1447
268 Ga0105237_10372078 3300009545 Bacteria 1433
269 Ga0105237_11521316 3300009545 Unclassified 676
270 Ga0105238_10040330 3300009551 Bacteria 4731
271 Ga0105238_10278821 3300009551 Bacteria 1653
272 Ga0105238_10545414 3300009551 Bacteria 1163
273 Ga0105249_10003014 3300009553 Bacteria 14526
274 Ga0105249_10087070 3300009553 Bacteria 2914
275 Ga0105249_10114678 3300009553 Bacteria 2551
276 Ga0105249_10420896 3300009553 Bacteria 1369
277 Ga0105249_10540713 3300009553 Bacteria 1215
278 Ga0105239_10015884 3300010375 Bacteria 8334
279 Ga0105239_10101705 3300010375 Bacteria 3179
280 Ga0105239_10350876 3300010375 Bacteria 1666
281 Ga0105239_10634999 3300010375 Bacteria 1219
282 Ga0105246_10004947 3300011119 Bacteria 8112
283 Ga0105246_10158676 3300011119 Bacteria 1721
284 Ga0157328_1001908 3300012478 Bacteria 947
285 Ga0157346_1001147 3300012480 Bacteria 1230
286 Ga0157343_1004982 3300012488 Bacteria 845
287 Ga0157322_1001471 3300012490 Bacteria 1175
288 Ga0157347_1011258 3300012502 Bacteria 948
289 Ga0157342_1004570 3300012507 Bacteria 1235
290 Ga0157315_1007302 3300012508 Bacteria 892
291 Ga0157373_10017859 3300013100 Bacteria 5166
292 Ga0157373_10065620 3300013100 Bacteria 2568
293 Ga0157373_10178233 3300013100 Bacteria 1496
294 Ga0157373_10481740 3300013100 Bacteria 895
295 Ga0157371_10160695 3300013102 Bacteria 1604
296 Ga0157371_10226602 3300013102 Bacteria 1343
297 Ga0157370_10125769 3300013104 Bacteria 2392
298 Ga0157370_10196656 3300013104 Bacteria 1871
299 Ga0157369_10045190 3300013105 Bacteria 4792
300 Ga0157369_10373571 3300013105 Bacteria 1480
301 Ga0157369_11556141 3300013105 Bacteria 672
302 Ga0157374_10009129 3300013296 Bacteria 8498
303 Ga0157374_10091222 3300013296 Bacteria 2905
304 Ga0157374_10487326 3300013296 Bacteria 1236
305 Ga0157378_10004364 3300013297 Bacteria 12450
306 Ga0157378_10042070 3300013297 Bacteria 4054
307 Ga0157378_10474274 3300013297 Bacteria 1246
308 Ga0163162_10011614 3300013306 Bacteria 8587
309 Ga0163162_10087519 3300013306 Bacteria 3194
310 Ga0163162_10341842 3300013306 Bacteria 1629
311 Ga0157372_10195872 3300013307 Bacteria 2341
312 Ga0157372_10249843 3300013307 Bacteria 2059
313 Ga0157372_10611866 3300013307 Bacteria 1270
314 Ga0157372_10618363 3300013307 Bacteria 1262
315 Ga0157372_10721470 3300013307 Bacteria 1159
316 Ga0157372_11798275 3300013307 Bacteria 705
317 Ga0157375_10008586 3300013308 Bacteria 8945
318 Ga0157375_10330690 3300013308 Bacteria 1689
319 Ga0157375_10657776 3300013308 Bacteria 1204
320 Ga0163163_10063140 3300014325 Bacteria 3672
321 Ga0163163_10260337 3300014325 Bacteria 1786
322 Ga0163163_10842531 3300014325 Bacteria 980
323 Ga0163163_12583151 3300014325 Unclassified 565
324 Ga0157380_10003889 3300014326 Bacteria 10302
325 Ga0157380_10113220 3300014326 Bacteria 2284
326 Ga0157380_11219269 3300014326 Bacteria 797
327 Ga0157377_10000317 3300014745 Bacteria 22023
328 Ga0157379_10000067 3300014968 Bacteria 66051
329 Ga0157379_10018396 3300014968 Bacteria 6160
330 Ga0157379_10516277 3300014968 Bacteria 1108
331 Ga0157376_10005894 3300014969 Bacteria 8601
332 Ga0157376_11634894 3300014969 Bacteria 679
333 Ga0163161_10000693 3300017792 Bacteria 26852
334 Ga0163161_10126818 3300017792 Bacteria 1922
335 Ga0163161_11175856 3300017792 Bacteria 662
336 Ga0206356_10272352 3300020070 Bacteria 918
337 Ga0206356_11494623 3300020070 Bacteria 1061
338 Ga0213876_10013750 3300021384 Bacteria 4289
339 Ga0207666_1000681 3300025271 Bacteria 4075
340 Ga0207666_1001215 3300025271 Bacteria 3027
341 Ga0207673_1001404 3300025290 Bacteria 2624
342 Ga0207697_10016607 3300025315 Bacteria 3031
343 Ga0207697_10119883 3300025315 Bacteria 1131
344 Ga0207653_10003762 3300025885 Bacteria 4774
345 Ga0207653_10074057 3300025885 Bacteria 1168
346 Ga0207682_10000264 3300025893 Bacteria 23612
347 Ga0207692_10002735 3300025898 Bacteria 6804
348 Ga0207642_10000834 3300025899 Bacteria 9610
349 Ga0207642_10300214 3300025899 Bacteria 931
350 Ga0207710_10005159 3300025900 Bacteria 5644
351 Ga0207710_10025358 3300025900 Bacteria 2558
352 Ga0207710_10087483 3300025900 Bacteria 1453
353 Ga0207710_10379584 3300025900 Bacteria 723
354 Ga0207688_10015833 3300025901 Bacteria 4091
355 Ga0207688_10062252 3300025901 Bacteria 2103
356 Ga0207680_10013218 3300025903 Bacteria 4233
357 Ga0207647_10041608 3300025904 Bacteria 2888
358 Ga0207685_10004366 3300025905 Bacteria 3586
359 Ga0207685_10043609 3300025905 Bacteria 1691
360 Ga0207699_10040119 3300025906 Bacteria 2696
361 Ga0207699_10128144 3300025906 Bacteria 1651
362 Ga0207699_10173029 3300025906 Bacteria 1446
363 Ga0207699_10513252 3300025906 Bacteria 866
364 Ga0207645_10000926 3300025907 Bacteria 24341
365 Ga0207645_10222865 3300025907 Bacteria 1243
366 Ga0207645_10451235 3300025907 Bacteria 868
367 Ga0207643_10000004 3300025908 Bacteria 187006
368 Ga0207705_11374108 3300025909 Bacteria 538
369 Ga0207684_10096691 3300025910 Bacteria 2521
370 Ga0207654_10000437 3300025911 Bacteria 23909
371 Ga0207654_10872418 3300025911 Unclassified 652
372 Ga0207707_10004519 3300025912 Bacteria 12230
373 Ga0207707_10060140 3300025912 Bacteria 3305
374 Ga0207707_11118437 3300025912 Bacteria 641
375 Ga0207671_10010091 3300025914 Bacteria 7829
376 Ga0207671_10283607 3300025914 Bacteria 1307
377 Ga0207693_10001239 3300025915 Bacteria 22700
378 Ga0207693_10006137 3300025915 Bacteria 9961
379 Ga0207693_10013383 3300025915 Bacteria 6614
380 Ga0207693_10064686 3300025915 Bacteria 2865
381 Ga0207693_10335098 3300025915 Bacteria 1184
382 Ga0207663_10019511 3300025916 Bacteria 3822
383 Ga0207663_10022853 3300025916 Bacteria 3580
384 Ga0207663_10071352 3300025916 Bacteria 2241
385 Ga0207663_11144628 3300025916 Bacteria 626
386 Ga0207660_10004154 3300025917 Bacteria 9422
387 Ga0207660_10015766 3300025917 Bacteria 4994
388 Ga0207660_10028341 3300025917 Bacteria 3830
389 Ga0207660_10140445 3300025917 Bacteria 1846
390 Ga0207660_11010526 3300025917 Bacteria 678
391 Ga0207662_10032660 3300025918 Bacteria 3031
392 Ga0207662_10328773 3300025918 Bacteria 1022
393 Ga0207662_10381012 3300025918 Bacteria 953
394 Ga0207657_10052397 3300025919 Bacteria 3541
395 Ga0207657_10054228 3300025919 Bacteria 3468
396 Ga0207657_10077345 3300025919 Bacteria 2804
397 Ga0207657_10643333 3300025919 Bacteria 826
398 Ga0207649_10000090 3300025920 Bacteria 75387
399 Ga0207652_10001397 3300025921 Bacteria 21434
400 Ga0207652_10004018 3300025921 Bacteria 12012
401 Ga0207652_10068573 3300025921 Bacteria 3078
402 Ga0207652_10250845 3300025921 Bacteria 1596
403 Ga0207652_10424313 3300025921 Bacteria 1199
404 Ga0207652_10613162 3300025921 Bacteria 975
405 Ga0207681_10001592 3300025923 Bacteria 14608
406 Ga0207694_11216550 3300025924 Bacteria 637
407 Ga0207650_10007098 3300025925 Bacteria 7630
408 Ga0207659_10000038 3300025926 Bacteria 93848
409 Ga0207687_10000445 3300025927 Bacteria 28075
410 Ga0207687_10017603 3300025927 Bacteria 4707
411 Ga0207700_10003402 3300025928 Bacteria 9241
412 Ga0207700_10085958 3300025928 Bacteria 2470
413 Ga0207700_10099918 3300025928 Bacteria 2311
414 Ga0207664_10608410 3300025929 Bacteria 981
415 Ga0207644_10000816 3300025931 Bacteria 19791
416 Ga0207644_10514398 3300025931 Bacteria 988
417 Ga0207690_10000440 3300025932 Bacteria 26959
418 Ga0207690_10082283 3300025932 Bacteria 2251
419 Ga0207690_10144572 3300025932 Bacteria 1757
420 Ga0207690_10244781 3300025932 Bacteria 1383
421 Ga0207690_10440704 3300025932 Bacteria 1045
422 Ga0207706_10008938 3300025933 Bacteria 9223
423 Ga0207706_10055499 3300025933 Bacteria 3493
424 Ga0207706_10059966 3300025933 Bacteria 3351
425 Ga0207686_10000433 3300025934 Bacteria 28288
426 Ga0207686_10369100 3300025934 Bacteria 1085
427 Ga0207709_10000494 3300025935 Bacteria 35647
428 Ga0207709_10021426 3300025935 Bacteria 3659
429 Ga0207709_10184343 3300025935 Bacteria 1477
430 Ga0207670_10001363 3300025936 Bacteria 12858
431 Ga0207670_10139679 3300025936 Bacteria 1785
432 Ga0207670_10512922 3300025936 Bacteria 975
433 Ga0207670_11006992 3300025936 Bacteria 701
434 Ga0207669_10000063 3300025937 Bacteria 53494
435 Ga0207669_10109699 3300025937 Bacteria 1846
436 Ga0207669_10455866 3300025937 Bacteria 1014
437 Ga0207704_10001268 3300025938 Bacteria 11299
438 Ga0207665_10003373 3300025939 Bacteria 10695
439 Ga0207665_10028918 3300025939 Bacteria 3664
440 Ga0207665_10030904 3300025939 Bacteria 3541
441 Ga0207665_10108301 3300025939 Bacteria 1949
442 Ga0207691_10000981 3300025940 Bacteria 28361
443 Ga0207691_10517083 3300025940 Bacteria 1013
444 Ga0207711_10000792 3300025941 Bacteria 31089
445 Ga0207711_10012513 3300025941 Bacteria 7052
446 Ga0207711_10075463 3300025941 Bacteria 2934
447 Ga0207689_10002635 3300025942 Bacteria 16609
448 Ga0207689_10247590 3300025942 Bacteria 1474
449 Ga0207689_10419153 3300025942 Bacteria 1117
450 Ga0207661_10000531 3300025944 Bacteria 24434
451 Ga0207661_10284230 3300025944 Bacteria 1479
452 Ga0207661_10473035 3300025944 Bacteria 1143
453 Ga0207679_10001109 3300025945 Bacteria 17141
454 Ga0207679_10054930 3300025945 Bacteria 2934
455 Ga0207679_10231357 3300025945 Bacteria 1561
456 Ga0207679_10526080 3300025945 Bacteria 1058
457 Ga0207667_10022580 3300025949 Bacteria 6945
458 Ga0207667_10554214 3300025949 Bacteria 1162
459 Ga0207651_10000379 3300025960 Bacteria 18945
460 Ga0207651_10565668 3300025960 Bacteria 990
461 Ga0207712_10000717 3300025961 Bacteria 25585
462 Ga0207712_10339234 3300025961 Bacteria 1246
463 Ga0207712_10659694 3300025961 Bacteria 910
464 Ga0207668_10000429 3300025972 Bacteria 26510
465 Ga0207668_10016879 3300025972 Bacteria 4567
466 Ga0207640_10000516 3300025981 Bacteria 23270
467 Ga0207658_10020967 3300025986 Bacteria 4530
468 Ga0207658_10079727 3300025986 Bacteria 2506
469 Ga0207658_10436337 3300025986 Bacteria 1157
470 Ga0207677_10001164 3300026023 Bacteria 14343
471 Ga0207677_10217318 3300026023 Bacteria 1530
472 Ga0207703_10007685 3300026035 Bacteria 8544
473 Ga0207703_10074671 3300026035 Bacteria 2808
474 Ga0207703_10140580 3300026035 Bacteria 2095
475 Ga0207703_10456481 3300026035 Bacteria 1194
476 Ga0207639_10003596 3300026041 Bacteria 10414
477 Ga0207639_10292101 3300026041 Bacteria 1438
478 Ga0207639_10346725 3300026041 Bacteria 1325
479 Ga0207678_10002770 3300026067 Bacteria 15870
480 Ga0207678_10026091 3300026067 Bacteria 5097
481 Ga0207678_10140321 3300026067 Bacteria 2062
482 Ga0207708_10055110 3300026075 Bacteria 3031
483 Ga0207708_10055122 3300026075 Bacteria 3031
484 Ga0207702_10003627 3300026078 Bacteria 14009
485 Ga0207702_10230482 3300026078 Bacteria 1731
486 Ga0207702_10430426 3300026078 Bacteria 1277
487 Ga0207702_11190156 3300026078 Unclassified 756
488 Ga0207641_10003728 3300026088 Bacteria 13402
489 Ga0207641_10046965 3300026088 Bacteria 3640
490 Ga0207641_10535008 3300026088 Bacteria 1141
491 Ga0207648_10013027 3300026089 Bacteria 7756
492 Ga0207648_10412631 3300026089 Bacteria 1225
493 Ga0207648_10648804 3300026089 Bacteria 975
494 Ga0207676_10000583 3300026095 Bacteria 30033
495 Ga0207676_10078337 3300026095 Bacteria 2677
496 Ga0207676_10295329 3300026095 Bacteria 1477
497 Ga0207674_10028860 3300026116 Bacteria 5849
498 Ga0207674_10409594 3300026116 Bacteria 1310
499 Ga0207675_100036186 3300026118 Bacteria 4605
500 Ga0207675_100429521 3300026118 Bacteria 1306
501 Ga0207683_10000138 3300026121 Bacteria 60113
502 Ga0207683_10025410 3300026121 Bacteria 5109
503 Ga0207683_10228463 3300026121 Bacteria 1697
504 Ga0207698_10005821 3300026142 Bacteria 7655
505 Ga0207698_10649640 3300026142 Bacteria 1045
506 Ga0209973_1012711 3300027252 Bacteria 1027
507 Ga0209967_1001718 3300027364 Bacteria 2816
508 Ga0209995_1003384 3300027471 Bacteria 2540
509 Ga0209968_1009407 3300027526 Bacteria 1496
510 Ga0210002_1000870 3300027617 Bacteria 4142
511 Ga0210002_1023208 3300027617 Bacteria 1008
512 Ga0209983_1005120 3300027665 Bacteria 2729
513 Ga0209971_1014116 3300027682 Bacteria 1892
514 Ga0209971_1057654 3300027682 Bacteria 939
515 Ga0209966_1003383 3300027695 Bacteria 2682
516 Ga0209966_1013394 3300027695 Bacteria 1518
517 Ga0209998_10007335 3300027717 Bacteria 2288
518 Ga0209998_10008256 3300027717 Bacteria 2159
519 Ga0209974_10006454 3300027876 Bacteria 4094
520 Ga0209974_10063771 3300027876 Bacteria 1250
521 Ga0207428_10001759 3300027907 Bacteria 22205
522 Ga0207428_10023515 3300027907 Bacteria 5182
523 Ga0207428_10194065 3300027907 Bacteria 1530
524 Ga0268266_10062397 3300028379 Bacteria 3216
525 Ga0268265_10002569 3300028380 Bacteria 13569
526 Ga0268265_10551182 3300028380 Bacteria 1094
527 Ga0268264_10002097 3300028381 Bacteria 17812
528 Ga0268264_10271581 3300028381 Bacteria 1584
529 Ga0268264_10529914 3300028381 Bacteria 1153
530 Ga0268264_10715518 3300028381 Bacteria 995
531 Ga0268264_11680334 3300028381 Bacteria 645
532 Ga0268264_12150210 3300028381 Unclassified 566
533 Ga0265337_1001017 3300028556 Bacteria 14559
534 Ga0265338_10184604 3300028800 Bacteria 1586
535 Ga0265338_10328354 3300028800 Bacteria 1105
536 Ga0265338_10444083 3300028800 Bacteria 919
537 Ga0265330_10009166 3300031235 Bacteria 4716
538 Ga0265332_10168956 3300031238 Bacteria 913
539 Ga0265332_10170392 3300031238 Bacteria 909
540 Ga0265325_10000019 3300031241 Bacteria 125265
541 Ga0265325_10004257 3300031241 Bacteria 9079
542 Ga0265325_10043241 3300031241 Bacteria 2351
543 Ga0265340_10055326 3300031247 Bacteria 1911
544 Ga0265340_10122121 3300031247 Bacteria 1198
545 Ga0265339_10001671 3300031249 Bacteria 16385
546 Ga0265339_10019397 3300031249 Bacteria 3992
547 Ga0265316_10016529 3300031344 Bacteria 6395
548 Ga0307408_100939644 3300031548 Bacteria 794
549 Ga0265313_10001789 3300031595 Bacteria 19628
550 Ga0265313_10004986 3300031595 Bacteria 9932
551 Ga0265313_10023160 3300031595 Bacteria 3351
552 Ga0265313_10024803 3300031595 Bacteria 3193
553 Ga0316575_10096374 3300031665 Bacteria 1201
554 Ga0316579_10030720 3300031691 Bacteria 2456
555 Ga0265314_10000577 3300031711 Bacteria 46408
556 Ga0265314_10028869 3300031711 Bacteria 4129
557 Ga0265342_10000211 3300031712 Bacteria 65440
558 Ga0307406_10525537 3300031901 Bacteria 964
559 Ga0307414_11928885 3300032004 Bacteria 551
560 Ga0307411_10340846 3300032005 Bacteria 1218
561 Ga0307415_100792740 3300032126 Bacteria 864
562 Ga0316583_10002625 3300032133 Bacteria 6274
563 Ga0373930_0000568 3300034816 Bacteria 5085
564 Ga0373930_0180071 3300034816 Bacteria 542
565 Ga0373948_0000092 3300034817 Bacteria 9192
566 Ga0373950_0008904 3300034818 Bacteria 1590
567 Ga0373958_0000576 3300034819 Bacteria 4549
568 Ga0373958_0018463 3300034819 Bacteria 1264
569 Ga0373959_0000576 3300034820 Bacteria 6439
570 Ga0373959_0018902 3300034820 Bacteria 1300
571 Ga0373938_0008030 3300034957 Bacteria 1876
572 Ga0373926_0010362 3300035083 Bacteria 3123
573 Ga0373928_0000100 3300035084 Bacteria 15370
574 Ga0373928_0010483 3300035084 Bacteria 1821
575 Ga0373934_0015086 3300035086 Bacteria 2930
576 Ga0373940_0000073 3300035088 Bacteria 11686
577 Ga0373940_0039370 3300035088 Bacteria 1293
578 Ga0373944_0008786 3300035089 Bacteria 2730
579 Ga0373949_0007976 3300035090 Bacteria 2318
580 Ga0373951_0000189 3300035091 Bacteria 22384
581 Ga0373951_0053331 3300035091 Bacteria 999
582 Ga0373952_0002023 3300035092 Bacteria 3660
583 Ga0373952_0003463 3300035092 Bacteria 2848
584 Ga0373932_0001729 3300035112 Bacteria 5928
585 Ga0373932_0041963 3300035112 Bacteria 1325
586 Ga0373939_0002882 3300035114 Bacteria 4043
587 Ga0373939_0023616 3300035114 Bacteria 1705
588 Ga0373939_0025973 3300035114 Bacteria 1646
589 Ga0373939_0128354 3300035114 Bacteria 902
590 Ga0373941_0000363 3300035115 Bacteria 8980
591 Ga0373941_0068324 3300035115 Bacteria 1173
592 Ga0373945_0023425 3300035116 Bacteria 2132
593 Ga0373953_0014530 3300035117 Bacteria 2834
594 Ga0373953_0025742 3300035117 Bacteria 2250
595 Ga0373953_0034276 3300035117 Bacteria 1989
596 Ga0373954_0009564 3300035118 Bacteria 4266
597 Ga0373954_0036308 3300035118 Bacteria 2287
598 Ga0373954_0057838 3300035118 Bacteria 1826
599 Ga0373956_0016343 3300035119 Bacteria 3116
600 Ga0373956_0026913 3300035119 Bacteria 2493
601 Ga0373956_0034039 3300035119 Bacteria 2243
602 Ga0373956_0340127 3300035119 Bacteria 715
603 Ga0373957_0013580 3300035120 Bacteria 2766
604 Ga0373957_0049474 3300035120 Bacteria 1604
605 Ga0373960_0005418 3300035121 Bacteria 2955
606 Ga0373960_0037620 3300035121 Bacteria 1383
607 Ga0373943_0011131 3300035170 Bacteria 4044
608 Ga0373946_0051342 3300035171 Bacteria 1725
609 Ga0373955_0000249 3300035172 Bacteria 22417
610 Ga0373955_0002898 3300035172 Bacteria 7524
611 Ga0373955_0022122 3300035172 Bacteria 3221
612 Ga0373955_0026958 3300035172 Bacteria 2965
613 Ga0373955_0106574 3300035172 Bacteria 1616
614 Ga0373942_0001810 3300035207 Bacteria 5406
615 Ga0373942_0049618 3300035207 Bacteria 1172
616 Ga0373961_0000633 3300035241 Bacteria 12709
617 Ga0373961_0078130 3300035241 Bacteria 1036
618 Ga0373961_0130379 3300035241 Bacteria 841
619 Ga0373962_0000689 3300035242 Bacteria 7635
620 Ga0373962_0004675 3300035242 Bacteria 3305
621 Ga0373924_0009601 3300035410 Bacteria 3551
622 Ga0373924_0053480 3300035410 Bacteria 1677
623 Ga0373931_0002415 3300035691 Bacteria 8264
624 Ga0373931_0023900 3300035691 Bacteria 3089
625 Ga0373931_0193365 3300035691 Bacteria 1212
626 Ga0373935_0141903 3300035692 Bacteria 1623
627 Ga0373935_0261213 3300035692 Bacteria 1214
628 Ga0373935_0430927 3300035692 Bacteria 950
629 Ga0373927_0871100 3300035695 Unclassified 594
630 Ga0373933_0002548 3300035724 Bacteria 10223
631 Ga0373933_0015532 3300035724 Bacteria 4246
632 Ga0373933_0029959 3300035724 Bacteria 3149
633 Ga0373937_0003343 3300036401 Bacteria 13462
634 Ga0373937_0005946 3300036401 Bacteria 10502
635 Ga0373937_0006652 3300036401 Bacteria 9974
636 Ga0373937_0032148 3300036401 Bacteria 4758
637 Ga0373937_0375534 3300036401 Bacteria 1348
638 Ga0316582_0522086 3300036647 Bacteria 818
639 Ga0373925_0010323 3300037068 Bacteria 6776
640 Ga0373925_0291256 3300037068 Bacteria 1316
641 Ga0395899_0023868 3300037312 Bacteria 4627
642 Ga0395899_0548684 3300037312 Unclassified 743
643 Ga0395900_0025072 3300037418 Bacteria 6104
644 Ga0395900_0030088 3300037418 Bacteria 5573
645 Ga0395900_0032733 3300037418 Bacteria 5347
646 Ga0395900_0067088 3300037418 Bacteria 3686
647 Ga0395900_0557877 3300037418 Bacteria 1089
648 Ga0395898_0012791 3300037466 Bacteria 8664
649 Ga0395898_0044840 3300037466 Bacteria 4349
650 Ga0395898_0064147 3300037466 Bacteria 3563
651 Ga0395898_0096286 3300037466 Bacteria 2843
652 Ga0395901_0052189 3300038443 Bacteria 4250
653 Ga0395901_0062934 3300038443 Bacteria 3861
654 Ga0395901_0079781 3300038443 Bacteria 3417
655 Ga0242419_001940 3300038698 Bacteria 1319
656 Ga0242420_017826 3300038996 Bacteria 1245
657 Ga0436365_0121354 3300039437 Bacteria 2188
658 Ga0436365_0240412 3300039437 Bacteria 11459
659 Ga0436362_1251783 3300039453 Bacteria 1180
660 Ga0439441_008331 3300042001 Bacteria 1691
661 Ga0439448_0015191 3300042005 Bacteria 2330
662 Ga0439455_0010382 3300042012 Bacteria 2047
663 Ga0439463_008538 3300042016 Bacteria 2525
664 Ga0439458_0181699 3300042157 Bacteria 571
665 Ga0439460_0007591 3300042461 Bacteria 2718
666 Ga0450916_069745 3300042530 Bacteria 585
667 Ga0466966_0196236 3300044684 Bacteria 1222
668 Ga0466961_0193538 3300044693 Bacteria 1260
669 Ga0466961_0283374 3300044693 Bacteria 1014
670 Ga0466963_0815007 3300044694 Bacteria 658
671 Ga0466963_0935382 3300044694 Bacteria 611
672 Ga0453684_0081063 3300044712 Bacteria 4049
673 Ga0466971_0098808 3300044719 Bacteria 1340
674 Ga0466959_0051788 3300045049 Bacteria 3009
675 Ga0451576_0023984 3300045051 Bacteria 6594
676 Ga0451576_0843923 3300045051 Bacteria 962
677 Ga0466958_0145501 3300045836 Bacteria 1493
678 Ga0466958_0802816 3300045836 Bacteria 614
679 Ga0466967_0040855 3300045976 Bacteria 3995
680 Ga0466967_0348804 3300045976 Bacteria 1432
681 Ga0495592_0000604 3300046454 Bacteria 25327
682 Ga0495629_0167300 3300046459 Bacteria 1526
683 Ga0495629_0435814 3300046459 Bacteria 888
684 Ga0495641_0040433 3300046461 Bacteria 2168
685 Ga0495651_0006587 3300046462 Bacteria 8867
686 Ga0495651_0557123 3300046462 Bacteria 727
687 Ga0495653_0004982 3300046463 Bacteria 10779
688 Ga0495653_0198794 3300046463 Bacteria 1362
689 Ga0495653_0776423 3300046463 Bacteria 577
690 Ga0495580_0271808 3300046472 Bacteria 1157
691 Ga0495582_0052609 3300046473 Bacteria 2245
692 Ga0495639_0106598 3300046475 Bacteria 1327
693 Ga0495664_0009456 3300046477 Bacteria 5455
694 Ga0495664_0058441 3300046477 Bacteria 2294
695 Ga0495664_0302996 3300046477 Bacteria 964
696 Ga0495608_0011300 3300046511 Bacteria 6215
697 Ga0495618_0008660 3300046514 Bacteria 6149
698 Ga0495618_0056738 3300046514 Bacteria 2479
699 Ga0495618_0079083 3300046514 Bacteria 2097
700 Ga0495618_0144176 3300046514 Bacteria 1523
701 Ga0495628_0076911 3300046516 Bacteria 2597
702 Ga0495628_0295278 3300046516 Bacteria 1200
703 Ga0495630_0165508 3300046517 Bacteria 1684
704 Ga0495630_0532319 3300046517 Bacteria 901
705 Ga0495666_0167768 3300046526 Bacteria 1016
706 Ga0495652_0011134 3300046529 Bacteria 8150
707 Ga0495652_0081886 3300046529 Bacteria 2661
708 Ga0495652_0408858 3300046529 Bacteria 959
709 Ga0495652_0463006 3300046529 Bacteria 885
710 Ga0495665_0047369 3300046531 Bacteria 2280
711 Ga0495640_0063961 3300046533 Bacteria 2489
712 Ga0495640_0395095 3300046533 Bacteria 849
713 Ga0495640_0424261 3300046533 Bacteria 814
714 Ga0495640_0756063 3300046533 Bacteria 581
715 Ga0495586_0007329 3300046535 Bacteria 5888
716 Ga0495586_0698286 3300046535 Bacteria 586
717 Ga0495587_0003722 3300046536 Bacteria 10121
718 Ga0495587_0031441 3300046536 Bacteria 3214
719 Ga0495587_0351648 3300046536 Bacteria 821
720 Ga0495645_0002643 3300046543 Bacteria 12188
721 Ga0495645_0005135 3300046543 Bacteria 8967
722 Ga0495645_0686841 3300046543 Bacteria 622
723 Ga0495667_0014666 3300046559 Bacteria 5295
724 Ga0495667_0015973 3300046559 Bacteria 5073
725 Ga0495667_0646138 3300046559 Bacteria 657
726 Ga0495634_0081330 3300046642 Bacteria 2118
727 Ga0495634_0330982 3300046642 Bacteria 915
728 Ga0495635_0014791 3300046663 Bacteria 5459
729 Ga0495635_0148863 3300046663 Bacteria 1593
730 Ga0495635_0238116 3300046663 Bacteria 1228
731 Ga0495657_0266273 3300046675 Bacteria 1028
732 Ga0495657_0325479 3300046675 Bacteria 913
733 Ga0495599_0006067 3300046678 Bacteria 7271
734 Ga0495623_0005084 3300046679 Bacteria 8628
735 Ga0495646_0001510 3300046680 Bacteria 13865
736 Ga0495646_0181357 3300046680 Bacteria 1155
737 Ga0495669_0108929 3300046684 Bacteria 1292
738 Ga0495613_0175258 3300046689 Bacteria 1520
739 Ga0495613_0380363 3300046689 Bacteria 965
740 Ga0495624_0150794 3300046690 Bacteria 1422
741 Ga0495624_0487288 3300046690 Bacteria 738
742 Ga0495600_0002242 3300046809 Bacteria 11012
743 Ga0495600_0007130 3300046809 Bacteria 6830
744 Ga0495600_0407634 3300046809 Bacteria 845
745 Ga0495600_0516478 3300046809 Bacteria 733
746 Ga0495581_0379853 3300047315 Bacteria 824
747 Ga0495581_0411699 3300047315 Bacteria 788
748 Ga0495604_0000807 3300047317 Bacteria 26338
749 Ga0495604_0018346 3300047317 Bacteria 5603
750 Ga0495604_0032681 3300047317 Bacteria 4123
751 Ga0495674_0060527 3300047319 Bacteria 3303
752 Ga0495674_0109001 3300047319 Bacteria 2349
753 Ga0495674_0531030 3300047319 Bacteria 938
754 Ga0495676_0283497 3300047321 Bacteria 1121
755 Ga0495676_0547610 3300047321 Bacteria 756
756 Ga0495680_0026918 3300047322 Bacteria 4733
757 Ga0495680_0038199 3300047322 Bacteria 3839
758 Ga0495680_0100807 3300047322 Bacteria 2151
759 Ga0495680_0106631 3300047322 Bacteria 2082
760 Ga0495680_0330292 3300047322 Bacteria 1065
761 Ga0495675_0000700 3300047444 Bacteria 20964
762 Ga0495675_0010767 3300047444 Bacteria 5729
763 Ga0495675_0433279 3300047444 Bacteria 763
764 Ga0495684_0255811 3300047471 Bacteria 1272
765 Ga0495593_0056182 3300047673 Bacteria 2070
766 Ga0495593_0200878 3300047673 Bacteria 1002
767 Ga0495602_0001773 3300048088 Bacteria 21601
768 Ga0495602_0012708 3300048088 Bacteria 8637
769 Ga0495602_0054174 3300048088 Bacteria 3544
770 Ga0495614_0430706 3300048089 Bacteria 622
771 Ga0496100_0000839 3300048903 Bacteria 14752
772 Ga0496100_0161943 3300048903 Bacteria 1604
773 Ga0496100_0170130 3300048903 Bacteria 1568
774 Ga0496100_0971509 3300048903 Bacteria 668
775 Ga0496101_0000633 3300048904 Bacteria 21327
776 Ga0496101_0004102 3300048904 Bacteria 9113
777 Ga0496101_0192773 3300048904 Bacteria 1573
778 Ga0496101_0279530 3300048904 Bacteria 1304
779 Ga0496101_0949479 3300048904 Bacteria 676
780 Ga0496102_0002481 3300048905 Bacteria 15749
781 Ga0496102_0128171 3300048905 Bacteria 2373
782 Ga0496102_0149712 3300048905 Bacteria 2192
783 Ga0496102_0488791 3300048905 Bacteria 1152
784 Ga0496102_1178696 3300048905 Bacteria 685
785 Ga0496103_0000717 3300048906 Bacteria 24507
786 Ga0496103_0009959 3300048906 Bacteria 5621
787 Ga0496103_0632701 3300048906 Bacteria 680
788 Ga0496104_0013489 3300048907 Bacteria 7362
789 Ga0496104_0081209 3300048907 Bacteria 3091
790 Ga0496104_0330060 3300048907 Bacteria 1438
791 Ga0496104_0425177 3300048907 Bacteria 1240
792 Ga0496105_0000950 3300048908 Bacteria 19841
793 Ga0496105_0080899 3300048908 Bacteria 2683
794 Ga0496105_0140839 3300048908 Bacteria 1985
795 Ga0496106_0002354 3300048909 Bacteria 14076
796 Ga0496106_0103947 3300048909 Bacteria 2205
797 Ga0496106_0140922 3300048909 Bacteria 1896
798 Ga0496106_0243951 3300048909 Bacteria 1435
799 Ga0496107_0001263 3300048910 Bacteria 15487
800 Ga0496107_0010575 3300048910 Bacteria 6416
801 Ga0496107_0076401 3300048910 Bacteria 2439
802 Ga0496107_0081726 3300048910 Bacteria 2356
803 Ga0496107_0133211 3300048910 Bacteria 1835
804 Ga0496108_0005842 3300048911 Bacteria 9975
805 Ga0496108_0014469 3300048911 Bacteria 6442
806 Ga0496108_0045694 3300048911 Bacteria 3658
807 Ga0496108_0072423 3300048911 Bacteria 2908
808 Ga0496108_0615737 3300048911 Bacteria 945
809 Ga0496108_0844072 3300048911 Bacteria 788
810 Ga0496109_0002017 3300048912 Bacteria 16843
811 Ga0496109_0064505 3300048912 Bacteria 3352
812 Ga0496109_0264743 3300048912 Bacteria 1619
813 Ga0496109_0420494 3300048912 Bacteria 1262
814 Ga0496109_0797386 3300048912 Bacteria 882
815 Ga0496110_0062959 3300048913 Bacteria 3277
816 Ga0496110_0824306 3300048913 Bacteria 832
817 Ga0496111_0047606 3300048914 Bacteria 3088
818 Ga0496111_0126152 3300048914 Bacteria 1892
819 Ga0496112_0011955 3300048915 Bacteria 7955
820 Ga0496112_0063884 3300048915 Bacteria 3631
821 Ga0496112_0182295 3300048915 Bacteria 2063
822 Ga0496112_0381482 3300048915 Bacteria 1350
823 Ga0496113_0002233 3300048916 Bacteria 11186
824 Ga0496113_0029827 3300048916 Bacteria 3943
825 Ga0496113_0182856 3300048916 Bacteria 1662
826 Ga0496114_0068146 3300048917 Bacteria 2987
827 Ga0496114_0316138 3300048917 Bacteria 1379
828 Ga0496115_0013377 3300048918 Bacteria 6207
829 Ga0496115_0173982 3300048918 Bacteria 1780
830 Ga0496115_0259085 3300048918 Bacteria 1430
831 Ga0501031_0001817 3300049568 Bacteria 13417
832 Ga0501032_0014494 3300049569 Bacteria 5582
833 Ga0501032_0138065 3300049569 Bacteria 1606
834 Ga0501033_0014506 3300049570 Bacteria 5982
835 Ga0501033_0069790 3300049570 Bacteria 2582
836 Ga0501033_0491419 3300049570 Bacteria 850
837 Ga0501034_0021775 3300049571 Bacteria 6531
838 Ga0501034_0068635 3300049571 Bacteria 3555
839 Ga0501034_0311509 3300049571 Bacteria 1508
840 Ga0501034_0357091 3300049571 Bacteria 1389
841 Ga0501034_1010191 3300049571 Bacteria 715
842 Ga0501036_0019391 3300049572 Bacteria 5709
843 Ga0501036_0202693 3300049572 Bacteria 1668
844 Ga0501036_0386489 3300049572 Bacteria 1168
845 Ga0501037_0665499 3300049573 Bacteria 695
846 Ga0501038_0101807 3300049574 Bacteria 2391
847 Ga0501038_0105053 3300049574 Bacteria 2346
848 Ga0501039_0363704 3300049575 Bacteria 1137
849 Ga0501043_0218212 3300049579 Bacteria 1476
850 Ga0501043_0498564 3300049579 Bacteria 910
851 Ga0501043_0588455 3300049579 Bacteria 823
852 Ga0501046_0173852 3300049580 Bacteria 1615
853 Ga0501047_0043849 3300049581 Bacteria 4320
854 Ga0501047_0534888 3300049581 Bacteria 997
855 Ga0501047_0736179 3300049581 Bacteria 802
856 Ga0501047_1307430 3300049581 Archaea 539
857 Ga0501048_0049894 3300049582 Bacteria 2982
858 Ga0501048_1339513 3300049582 Bacteria 515
859 Ga0501069_0522343 3300049585 Bacteria 709
860 Ga0501069_0870878 3300049585 Bacteria 547
861 Ga0501070_0106381 3300049586 Bacteria 2319
862 Ga0501070_0124351 3300049586 Bacteria 2132
863 Ga0501070_0478792 3300049586 Bacteria 1001
864 Ga0501070_0582403 3300049586 Bacteria 893
865 Ga0501071_0109523 3300049587 Bacteria 2040
866 Ga0501071_0576804 3300049587 Bacteria 864
867 Ga0501071_0757097 3300049587 Bacteria 748
868 Ga0501071_0975056 3300049587 Bacteria 655
869 Ga0501072_0114497 3300049588 Bacteria 2147
870 Ga0501072_0367395 3300049588 Bacteria 1142
871 Ga0501073_0028170 3300049589 Bacteria 4014
872 Ga0501074_0264212 3300049590 Bacteria 1223
873 Ga0501076_0022574 3300049592 Bacteria 4838
874 Ga0501077_0461930 3300049593 Bacteria 813
875 Ga0501077_0669517 3300049593 Bacteria 667
876 Ga0501079_1245584 3300049741 Bacteria 586
877 Ga0501083_0015623 3300049744 Bacteria 5315
878 Ga0501083_0185831 3300049744 Bacteria 1357
879 Ga0501083_0642080 3300049744 Bacteria 690
880 Ga0501035_0021027 3300049822 Bacteria 5998
881 Ga0501035_0078558 3300049822 Bacteria 2915
882 Ga0501044_0023194 3300049823 Bacteria 6604
883 Ga0501044_0058854 3300049823 Bacteria 3939
884 Ga0501044_0131262 3300049823 Bacteria 2499
885 Ga0501044_0151201 3300049823 Bacteria 2303
886 Ga0501044_0220640 3300049823 Bacteria 1846
887 Ga0501044_0927325 3300049823 Unclassified 745
888 Ga0501044_1363734 3300049823 Bacteria 575
889 nmdc:mga06z11_2876_c1 3300050494 Bacteria 6617
890 nmdc:mga06z11_307728_c1 3300050494 Bacteria 943
891 nmdc:mga06z11_928495_c1 3300050494 Unclassified 530
892 nmdc:mga07m45_166240_c1 3300050496 Bacteria 1281
893 nmdc:mga07m45_16715_c1 3300050496 Bacteria 3929
894 nmdc:mga07m45_71480_c1 3300050496 Bacteria 1974
895 nmdc:mga09592_489504_c1 3300050508 Bacteria 1059
896 nmdc:mga08y16_22355_c1 3300050511 Bacteria 6675
897 nmdc:mga08y16_22831_c1 3300050511 Bacteria 6603
898 nmdc:mga0n895_5206_c1 3300050512 Bacteria 10827
899 nmdc:mga0n895_754317_c1 3300050512 Bacteria 966
900 nmdc:mga0n895_999538_c1 3300050512 Bacteria 818
901 nmdc:mga0rr50_158506_c1 3300050513 Bacteria 1835
902 nmdc:mga0rr50_223325_c1 3300050513 Bacteria 983
903 nmdc:mga0rr50_312938_c1 3300050513 Bacteria 1315
904 nmdc:mga08x19_54072_c1 3300050514 Bacteria 2584
905 nmdc:mga0a205_13129_c1 3300050515 Bacteria 7693
906 nmdc:mga0a205_98453_c1 3300050515 Bacteria 2823
907 Ga0495601_0000233 3300053077 Bacteria 29812
908 Ga0495601_0006401 3300053077 Bacteria 6886
909 Ga0495601_0034773 3300053077 Bacteria 3144
910 Ga0495601_0037667 3300053077 Bacteria 3023
911 Ga0495601_0238201 3300053077 Bacteria 1188
912 Ga0495601_0255778 3300053077 Bacteria 1143
913 Ga0495612_0000533 3300053078 Bacteria 15307
914 Ga0495612_0016648 3300053078 Bacteria 2946
915 Ga0495612_0035482 3300053078 Bacteria 2021
916 Ga0495595_0000360 3300053084 Bacteria 17303
917 Ga0495595_0008907 3300053084 Bacteria 4135
918 Ga0495595_0011483 3300053084 Bacteria 3703
919 Ga0495595_0066145 3300053084 Bacteria 1701
920 Ga0495619_0001179 3300053085 Bacteria 17221
921 Ga0495619_0002698 3300053085 Bacteria 11606
922 Ga0495619_0007775 3300053085 Bacteria 6786
923 Ga0495619_0033967 3300053085 Bacteria 3314
924 Ga0495619_0119157 3300053085 Bacteria 1809
925 Ga0495619_0291014 3300053085 Bacteria 1131
926 Ga0500643_005032 3300053087 Bacteria 5790
927 Ga0500643_125844 3300053087 Unclassified 690
928 Ga0500644_0001907 3300053088 Bacteria 5349
929 Ga0500651_0416824 3300053093 Bacteria 752
930 Ga0500641_0001278 3300053096 Bacteria 8932
931 Ga0500595_000003 3300053119 Bacteria 419332
932 Ga0500652_065133 3300053131 Bacteria 1505
933 Ga0500577_0228948 3300053142 Bacteria 806
934 Ga0500616_0000002 3300053153 Bacteria 1611257
935 Ga0500645_001358 3300053730 Bacteria 12602
936 Ga0501084_0554597 3300054114 Bacteria 971
937 Ga0501082_0044600 3300060353 Bacteria 3824
938 Ga0501082_0185934 3300060353 Bacteria 1808
939 Ga0530510_0753301 3300061734 Bacteria 743
940 Ga0070658_10011335
941 2214544922
942 ARcpr5oldR_c000056
943 ARSoilYngRDRAFT_c00038
944 ARcpr5yngRDRAFT_c000037
945 ARSoilOldRDRAFT_c000060
946 ARCol0oldRDRAFT_c00584
947 ARCol0yngRDRAFT_1000282
948 JGI24739J22299_10005110
949 JGI24737J22298_10010531
950 JGI24737J22298_10018489
951 JGI24750J21931_1000905
952 JGI24748J21848_1000368
953 JGI24738J21930_10000907
954 JGI24744J21845_10000074
955 JGI24035J26624_1000024
956 JGI24035J26624_1000069
957 JGI24742J22300_10001012
958 JGI24751J29686_10005292
959 JGI25405J52794_10146540
960 Ga0065717_1001986
961 Ga0065704_10075779
962 Ga0065712_10009656
963 Ga0065712_10078326
964 Ga0065712_10080698
965 Ga0065715_10020644
966 Ga0070658_10445637
967 Ga0070676_10000085
968 Ga0070676_10164820
969 Ga0070683_100003426
970 Ga0070683_100010425
971 Ga0070683_100179463
972 Ga0070690_100023770
973 Ga0070690_100217662
974 Ga0070670_100045650
975 Ga0070677_10000381
976 Ga0068869_100000832
977 Ga0070666_10050801
978 Ga0070666_10154150
979 Ga0070680_100005059
980 Ga0070680_100008571
981 Ga0070680_100270099
982 Ga0070680_100865053
983 Ga0070682_100028237
984 Ga0070682_100031073
985 Ga0070682_100114322
986 Ga0068868_100000495
987 Ga0068868_100210301
988 Ga0070660_100007071
989 Ga0070660_100068323
990 Ga0070660_100068984
991 Ga0070660_100484773
992 Ga0070660_100939211
993 Ga0070689_100064034
994 Ga0070689_100297273
995 Ga0070691_10002861
996 Ga0070691_10101797
997 Ga0070687_100001770
998 Ga0070661_100000983
999 Ga0070692_10002229
1000 Ga0070668_100005583
1001 Ga0070668_100099878
1002 Ga0070669_100002421
1003 Ga0070675_100001045
1004 Ga0070671_100000386
1005 Ga0070671_100028690
1006 Ga0070671_100167936
1007 Ga0070671_100737816
1008 Ga0070674_100006162
1009 Ga0070674_100957957
1010 Ga0070673_100009652
1011 Ga0070688_100033469
1012 Ga0070688_100125808
1013 Ga0070688_100126315
1014 Ga0070659_100007775
1015 Ga0070659_100222970
1016 Ga0070667_100296318
1017 Ga0070667_100657925
1018 Ga0070703_10005487
1019 Ga0070709_10016725
1020 Ga0070709_10023290
1021 Ga0070709_10143939
1022 Ga0070709_10829887
1023 Ga0070709_11070810
1024 Ga0070714_100028926
1025 Ga0070714_100031838
1026 Ga0070714_100076629
1027 Ga0070714_100736146
1028 Ga0070713_100028382
1029 Ga0070713_100242511
1030 Ga0070713_100833977
1031 Ga0070713_100895097
1032 Ga0070710_10034212
1033 Ga0070710_10050952
1034 Ga0070701_10000908
1035 Ga0070711_100011651
1036 Ga0070711_100054215
1037 Ga0070711_100125077
1038 Ga0070711_100214232
1039 Ga0070711_100245600
1040 Ga0070711_101677175
1041 Ga0070705_100003404
1042 Ga0070705_100365850
1043 Ga0070705_100408374
1044 Ga0070700_100003334
1045 Ga0070700_101561241
1046 Ga0070694_100005587
1047 Ga0070708_100064337
1048 Ga0070663_100012099
1049 Ga0070663_100150828
1050 Ga0070663_100240197
1051 Ga0070663_100733134
1052 Ga0070678_100000260
1053 Ga0070678_100154027
1054 Ga0070678_100594102
1055 Ga0070662_100084360
1056 Ga0070662_100414481
1057 Ga0070662_100497392
1058 Ga0070681_10003989
1059 Ga0070681_10035093
1060 Ga0070681_10071454
1061 Ga0070681_10405100
1062 Ga0068867_100002696
1063 Ga0068867_100107284
1064 Ga0070685_10007108
1065 Ga0070685_10023063
1066 Ga0070685_10149156
1067 Ga0070707_100222997
1068 Ga0070698_100733499
1069 Ga0070699_100506441
1070 Ga0070679_100016998
1071 Ga0070679_100043302
1072 Ga0070679_100062508
1073 Ga0070679_100460335
1074 Ga0070679_100527303
1075 Ga0070679_100864914
1076 Ga0070684_100002858
1077 Ga0070684_100029407
1078 Ga0070684_101135567
1079 Ga0070684_101321803
1080 Ga0070684_101622635
1081 Ga0070697_100443608
1082 Ga0068853_100073074
1083 Ga0068853_100173730
1084 Ga0070672_100006644
1085 Ga0070686_100030263
1086 Ga0070686_100197802
1087 Ga0070695_100020350
1088 Ga0070695_100022315
1089 Ga0070696_100034090
1090 Ga0070696_100328134
1091 Ga0070696_101826230
1092 Ga0070693_100000947
1093 Ga0070693_100024354
1094 Ga0070693_100027275
1095 Ga0070665_100355973
1096 Ga0070665_100718134
1097 Ga0070704_100239051
1098 Ga0068855_100147058
1099 Ga0068855_100216080
1100 Ga0068855_100261759
1101 Ga0068855_100417287
1102 Ga0070664_100002866
1103 Ga0070664_100701938
1104 Ga0068857_100002854
1105 Ga0068857_100185441
1106 Ga0068854_100014002
1107 Ga0068854_100213516
1108 Ga0068854_100489761
1109 Ga0068856_100002432
1110 Ga0068856_100064883
1111 Ga0068856_100192582
1112 Ga0068856_100460879
1113 Ga0068856_100957560
1114 Ga0070702_100001455
1115 Ga0068852_100022111
1116 Ga0068852_100426174
1117 Ga0068852_100580087
1118 Ga0068859_100268285
1119 Ga0068859_100402635
1120 Ga0068864_100003611
1121 Ga0068866_10000364
1122 Ga0068866_11110913
1123 Ga0068861_100006781
1124 Ga0068861_100310779
1125 Ga0068851_10026178
1126 Ga0068851_10305352
1127 Ga0068870_10000015
1128 Ga0068863_100000278
1129 Ga0068863_100043782
1130 Ga0068858_100042094
1131 Ga0068858_100357013
1132 Ga0068860_100005473
1133 Ga0068860_100196722
1134 Ga0068860_100374697
1135 Ga0068860_100422597
1136 Ga0068860_100976067
1137 Ga0068862_100003784
1138 Ga0068862_100435980
1139 Ga0068862_101571878
1140 Ga0081455_10001601
1141 Ga0081455_10082066
1142 Ga0070717_10144648
1143 Ga0075432_10240718
1144 Ga0070715_10016578
1145 Ga0070716_100018193
1146 Ga0070716_100114391
1147 Ga0070716_100153419
1148 Ga0070712_100012900
1149 Ga0070712_100078211
1150 Ga0070712_100309321
1151 Ga0070712_100371284
1152 Ga0070712_100440913
1153 Ga0070712_100773489
1154 Ga0075367_10035568
1155 Ga0097621_100009409
1156 Ga0097621_100019613
1157 Ga0097621_100252555
1158 Ga0075370_10041043
1159 Ga0075370_10116379
1160 Ga0068871_100005915
1161 Ga0068871_100088803
1162 Ga0068871_100153104
1163 Ga0075433_10088886
1164 Ga0075434_100011707
1165 Ga0075429_100543689
1166 Ga0068865_100046627
1167 Ga0075436_100144184
1168 Ga0097620_100268300
1169 Ga0097620_100402642
1170 Ga0075435_100307280
1171 Ga0075435_100434709
1172 Ga0075435_100491581
1173 Ga0105251_10079855
1174 Ga0105251_10284245
1175 Ga0105244_10092970
1176 Ga0105250_10041851
1177 Ga0105250_10166071
1178 Ga0111539_10022188
1179 Ga0111539_10080457
1180 Ga0111539_10121090
1181 Ga0105245_10003800
1182 Ga0105245_10158044
1183 Ga0105245_11102628
1184 Ga0105245_11284263
1185 Ga0105245_12090982
1186 Ga0105247_10012563
1187 Ga0105247_10029045
1188 Ga0105247_10427843
1189 Ga0105247_10978299
1190 Ga0105243_10007557
1191 Ga0105243_10023375
1192 Ga0105243_10185610
1193 Ga0105241_10000982
1194 Ga0105241_10023898
1195 Ga0105241_10280611
1196 Ga0105241_10291363
1197 Ga0105242_10001299
1198 Ga0105242_10008924
1199 Ga0105242_10133517
1200 Ga0105248_10002736
1201 Ga0105248_10011811
1202 Ga0105248_10157656
1203 Ga0105248_10358083
1204 Ga0105237_10019497
1205 Ga0105237_10295171
1206 Ga0105237_10365882
1207 Ga0105237_10372078
1208 Ga0105237_11521316
1209 Ga0105238_10040330
1210 Ga0105238_10278821
1211 Ga0105238_10545414
1212 Ga0105249_10003014
1213 Ga0105249_10087070
1214 Ga0105249_10114678
1215 Ga0105249_10420896
1216 Ga0105249_10540713
1217 Ga0105239_10015884
1218 Ga0105239_10101705
1219 Ga0105239_10350876
1220 Ga0105239_10634999
1221 Ga0105246_10004947
1222 Ga0105246_10158676
1223 Ga0157328_1001908
1224 Ga0157346_1001147
1225 Ga0157343_1004982
1226 Ga0157322_1001471
1227 Ga0157347_1011258
1228 Ga0157342_1004570
1229 Ga0157315_1007302
1230 Ga0157373_10017859
1231 Ga0157373_10065620
1232 Ga0157373_10178233
1233 Ga0157373_10481740
1234 Ga0157371_10160695
1235 Ga0157371_10226602
1236 Ga0157370_10125769
1237 Ga0157370_10196656
1238 Ga0157369_10045190
1239 Ga0157369_10373571
1240 Ga0157369_11556141
1241 Ga0157374_10009129
1242 Ga0157374_10091222
1243 Ga0157374_10487326
1244 Ga0157378_10004364
1245 Ga0157378_10042070
1246 Ga0157378_10474274
1247 Ga0163162_10011614
1248 Ga0163162_10087519
1249 Ga0163162_10341842
1250 Ga0157372_10195872
1251 Ga0157372_10249843
1252 Ga0157372_10611866
1253 Ga0157372_10618363
1254 Ga0157372_10721470
1255 Ga0157372_11798275
1256 Ga0157375_10008586
1257 Ga0157375_10330690
1258 Ga0157375_10657776
1259 Ga0163163_10063140
1260 Ga0163163_10260337
1261 Ga0163163_10842531
1262 Ga0163163_12583151
1263 Ga0157380_10003889
1264 Ga0157380_10113220
1265 Ga0157380_11219269
1266 Ga0157377_10000317
1267 Ga0157379_10000067
1268 Ga0157379_10018396
1269 Ga0157379_10516277
1270 Ga0157376_10005894
1271 Ga0157376_11634894
1272 Ga0163161_10000693
1273 Ga0163161_10126818
1274 Ga0163161_11175856
1275 Ga0206356_10272352
1276 Ga0206356_11494623
1277 Ga0213876_10013750
1278 Ga0207666_1000681
1279 Ga0207666_1001215
1280 Ga0207673_1001404
1281 Ga0207697_10016607
1282 Ga0207697_10119883
1283 Ga0207653_10003762
1284 Ga0207653_10074057
1285 Ga0207682_10000264
1286 Ga0207692_10002735
1287 Ga0207642_10000834
1288 Ga0207642_10300214
1289 Ga0207710_10005159
1290 Ga0207710_10025358
1291 Ga0207710_10087483
1292 Ga0207710_10379584
1293 Ga0207688_10015833
1294 Ga0207688_10062252
1295 Ga0207680_10013218
1296 Ga0207647_10041608
1297 Ga0207685_10004366
1298 Ga0207685_10043609
1299 Ga0207699_10040119
1300 Ga0207699_10128144
1301 Ga0207699_10173029
1302 Ga0207699_10513252
1303 Ga0207645_10000926
1304 Ga0207645_10222865
1305 Ga0207645_10451235
1306 Ga0207643_10000004
1307 Ga0207705_11374108
1308 Ga0207684_10096691
1309 Ga0207654_10000437
1310 Ga0207654_10872418
1311 Ga0207707_10004519
1312 Ga0207707_10060140
1313 Ga0207707_11118437
1314 Ga0207671_10010091
1315 Ga0207671_10283607
1316 Ga0207693_10001239
1317 Ga0207693_10006137
1318 Ga0207693_10013383
1319 Ga0207693_10064686
1320 Ga0207693_10335098
1321 Ga0207663_10019511
1322 Ga0207663_10022853
1323 Ga0207663_10071352
1324 Ga0207663_11144628
1325 Ga0207660_10004154
1326 Ga0207660_10015766
1327 Ga0207660_10028341
1328 Ga0207660_10140445
1329 Ga0207660_11010526
1330 Ga0207662_10032660
1331 Ga0207662_10328773
1332 Ga0207662_10381012
1333 Ga0207657_10052397
1334 Ga0207657_10054228
1335 Ga0207657_10077345
1336 Ga0207657_10643333
1337 Ga0207649_10000090
1338 Ga0207652_10001397
1339 Ga0207652_10004018
1340 Ga0207652_10068573
1341 Ga0207652_10250845
1342 Ga0207652_10424313
1343 Ga0207652_10613162
1344 Ga0207681_10001592
1345 Ga0207694_11216550
1346 Ga0207650_10007098
1347 Ga0207659_10000038
1348 Ga0207687_10000445
1349 Ga0207687_10017603
1350 Ga0207700_10003402
1351 Ga0207700_10085958
1352 Ga0207700_10099918
1353 Ga0207664_10608410
1354 Ga0207644_10000816
1355 Ga0207644_10514398
1356 Ga0207690_10000440
1357 Ga0207690_10082283
1358 Ga0207690_10144572
1359 Ga0207690_10244781
1360 Ga0207690_10440704
1361 Ga0207706_10008938
1362 Ga0207706_10055499
1363 Ga0207706_10059966
1364 Ga0207686_10000433
1365 Ga0207686_10369100
1366 Ga0207709_10000494
1367 Ga0207709_10021426
1368 Ga0207709_10184343
1369 Ga0207670_10001363
1370 Ga0207670_10139679
1371 Ga0207670_10512922
1372 Ga0207670_11006992
1373 Ga0207669_10000063
1374 Ga0207669_10109699
1375 Ga0207669_10455866
1376 Ga0207704_10001268
1377 Ga0207665_10003373
1378 Ga0207665_10028918
1379 Ga0207665_10030904
1380 Ga0207665_10108301
1381 Ga0207691_10000981
1382 Ga0207691_10517083
1383 Ga0207711_10000792
1384 Ga0207711_10012513
1385 Ga0207711_10075463
1386 Ga0207689_10002635
1387 Ga0207689_10247590
1388 Ga0207689_10419153
1389 Ga0207661_10000531
1390 Ga0207661_10284230
1391 Ga0207661_10473035
1392 Ga0207679_10001109
1393 Ga0207679_10054930
1394 Ga0207679_10231357
1395 Ga0207679_10526080
1396 Ga0207667_10022580
1397 Ga0207667_10554214
1398 Ga0207651_10000379
1399 Ga0207651_10565668
1400 Ga0207712_10000717
1401 Ga0207712_10339234
1402 Ga0207712_10659694
1403 Ga0207668_10000429
1404 Ga0207668_10016879
1405 Ga0207640_10000516
1406 Ga0207658_10020967
1407 Ga0207658_10079727
1408 Ga0207658_10436337
1409 Ga0207677_10001164
1410 Ga0207677_10217318
1411 Ga0207703_10007685
1412 Ga0207703_10074671
1413 Ga0207703_10140580
1414 Ga0207703_10456481
1415 Ga0207639_10003596
1416 Ga0207639_10292101
1417 Ga0207639_10346725
1418 Ga0207678_10002770
1419 Ga0207678_10026091
1420 Ga0207678_10140321
1421 Ga0207708_10055110
1422 Ga0207708_10055122
1423 Ga0207702_10003627
1424 Ga0207702_10230482
1425 Ga0207702_10430426
1426 Ga0207702_11190156
1427 Ga0207641_10003728
1428 Ga0207641_10046965
1429 Ga0207641_10535008
1430 Ga0207648_10013027
1431 Ga0207648_10412631
1432 Ga0207648_10648804
1433 Ga0207676_10000583
1434 Ga0207676_10078337
1435 Ga0207676_10295329
1436 Ga0207674_10028860
1437 Ga0207674_10409594
1438 Ga0207675_100036186
1439 Ga0207675_100429521
1440 Ga0207683_10000138
1441 Ga0207683_10025410
1442 Ga0207683_10228463
1443 Ga0207698_10005821
1444 Ga0207698_10649640
1445 Ga0209973_1012711
1446 Ga0209967_1001718
1447 Ga0209995_1003384
1448 Ga0209968_1009407
1449 Ga0210002_1000870
1450 Ga0210002_1023208
1451 Ga0209983_1005120
1452 Ga0209971_1014116
1453 Ga0209971_1057654
1454 Ga0209966_1003383
1455 Ga0209966_1013394
1456 Ga0209998_10007335
1457 Ga0209998_10008256
1458 Ga0209974_10006454
1459 Ga0209974_10063771
1460 Ga0207428_10001759
1461 Ga0207428_10023515
1462 Ga0207428_10194065
1463 Ga0268266_10062397
1464 Ga0268265_10002569
1465 Ga0268265_10551182
1466 Ga0268264_10002097
1467 Ga0268264_10271581
1468 Ga0268264_10529914
1469 Ga0268264_10715518
1470 Ga0268264_11680334
1471 Ga0268264_12150210
1472 Ga0265337_1001017
1473 Ga0265338_10184604
1474 Ga0265338_10328354
1475 Ga0265338_10444083
1476 Ga0265330_10009166
1477 Ga0265332_10168956
1478 Ga0265332_10170392
1479 Ga0265325_10000019
1480 Ga0265325_10004257
1481 Ga0265325_10043241
1482 Ga0265340_10055326
1483 Ga0265340_10122121
1484 Ga0265339_10001671
1485 Ga0265339_10019397
1486 Ga0265316_10016529
1487 Ga0307408_100939644
1488 Ga0265313_10001789
1489 Ga0265313_10004986
1490 Ga0265313_10023160
1491 Ga0265313_10024803
1492 Ga0316575_10096374
1493 Ga0316579_10030720
1494 Ga0265314_10000577
1495 Ga0265314_10028869
1496 Ga0265342_10000211
1497 Ga0307406_10525537
1498 Ga0307414_11928885
1499 Ga0307411_10340846
1500 Ga0307415_100792740
1501 Ga0316583_10002625
1502 Ga0373930_0000568
1503 Ga0373930_0180071
1504 Ga0373948_0000092
1505 Ga0373950_0008904
1506 Ga0373958_0000576
1507 Ga0373958_0018463
1508 Ga0373959_0000576
1509 Ga0373959_0018902
1510 Ga0373938_0008030
1511 Ga0373926_0010362
1512 Ga0373928_0000100
1513 Ga0373928_0010483
1514 Ga0373934_0015086
1515 Ga0373940_0000073
1516 Ga0373940_0039370
1517 Ga0373944_0008786
1518 Ga0373949_0007976
1519 Ga0373951_0000189
1520 Ga0373951_0053331
1521 Ga0373952_0002023
1522 Ga0373952_0003463
1523 Ga0373932_0001729
1524 Ga0373932_0041963
1525 Ga0373939_0002882
1526 Ga0373939_0023616
1527 Ga0373939_0025973
1528 Ga0373939_0128354
1529 Ga0373941_0000363
1530 Ga0373941_0068324
1531 Ga0373945_0023425
1532 Ga0373953_0014530
1533 Ga0373953_0025742
1534 Ga0373953_0034276
1535 Ga0373954_0009564
1536 Ga0373954_0036308
1537 Ga0373954_0057838
1538 Ga0373956_0016343
1539 Ga0373956_0026913
1540 Ga0373956_0034039
1541 Ga0373956_0340127
1542 Ga0373957_0013580
1543 Ga0373957_0049474
1544 Ga0373960_0005418
1545 Ga0373960_0037620
1546 Ga0373943_0011131
1547 Ga0373946_0051342
1548 Ga0373955_0000249
1549 Ga0373955_0002898
1550 Ga0373955_0022122
1551 Ga0373955_0026958
1552 Ga0373955_0106574
1553 Ga0373942_0001810
1554 Ga0373942_0049618
1555 Ga0373961_0000633
1556 Ga0373961_0078130
1557 Ga0373961_0130379
1558 Ga0373962_0000689
1559 Ga0373962_0004675
1560 Ga0373924_0009601
1561 Ga0373924_0053480
1562 Ga0373931_0002415
1563 Ga0373931_0023900
1564 Ga0373931_0193365
1565 Ga0373935_0141903
1566 Ga0373935_0261213
1567 Ga0373935_0430927
1568 Ga0373927_0871100
1569 Ga0373933_0002548
1570 Ga0373933_0015532
1571 Ga0373933_0029959
1572 Ga0373937_0003343
1573 Ga0373937_0005946
1574 Ga0373937_0006652
1575 Ga0373937_0032148
1576 Ga0373937_0375534
1577 Ga0316582_0522086
1578 Ga0373925_0010323
1579 Ga0373925_0291256
1580 Ga0395899_0023868
1581 Ga0395899_0548684
1582 Ga0395900_0025072
1583 Ga0395900_0030088
1584 Ga0395900_0032733
1585 Ga0395900_0067088
1586 Ga0395900_0557877
1587 Ga0395898_0012791
1588 Ga0395898_0044840
1589 Ga0395898_0064147
1590 Ga0395898_0096286
1591 Ga0395901_0052189
1592 Ga0395901_0062934
1593 Ga0395901_0079781
1594 Ga0242419_001940
1595 Ga0242420_017826
1596 Ga0436365_0121354
1597 Ga0436365_0240412
1598 Ga0436362_1251783
1599 Ga0439441_008331
1600 Ga0439448_0015191
1601 Ga0439455_0010382
1602 Ga0439463_008538
1603 Ga0439458_0181699
1604 Ga0439460_0007591
1605 Ga0450916_069745
1606 Ga0466966_0196236
1607 Ga0466961_0193538
1608 Ga0466961_0283374
1609 Ga0466963_0815007
1610 Ga0466963_0935382
1611 Ga0453684_0081063
1612 Ga0466971_0098808
1613 Ga0466959_0051788
1614 Ga0451576_0023984
1615 Ga0451576_0843923
1616 Ga0466958_0145501
1617 Ga0466958_0802816
1618 Ga0466967_0040855
1619 Ga0466967_0348804
1620 Ga0495592_0000604
1621 Ga0495629_0167300
1622 Ga0495629_0435814
1623 Ga0495641_0040433
1624 Ga0495651_0006587
1625 Ga0495651_0557123
1626 Ga0495653_0004982
1627 Ga0495653_0198794
1628 Ga0495653_0776423
1629 Ga0495580_0271808
1630 Ga0495582_0052609
1631 Ga0495639_0106598
1632 Ga0495664_0009456
1633 Ga0495664_0058441
1634 Ga0495664_0302996
1635 Ga0495608_0011300
1636 Ga0495618_0008660
1637 Ga0495618_0056738
1638 Ga0495618_0079083
1639 Ga0495618_0144176
1640 Ga0495628_0076911
1641 Ga0495628_0295278
1642 Ga0495630_0165508
1643 Ga0495630_0532319
1644 Ga0495666_0167768
1645 Ga0495652_0011134
1646 Ga0495652_0081886
1647 Ga0495652_0408858
1648 Ga0495652_0463006
1649 Ga0495665_0047369
1650 Ga0495640_0063961
1651 Ga0495640_0395095
1652 Ga0495640_0424261
1653 Ga0495640_0756063
1654 Ga0495586_0007329
1655 Ga0495586_0698286
1656 Ga0495587_0003722
1657 Ga0495587_0031441
1658 Ga0495587_0351648
1659 Ga0495645_0002643
1660 Ga0495645_0005135
1661 Ga0495645_0686841
1662 Ga0495667_0014666
1663 Ga0495667_0015973
1664 Ga0495667_0646138
1665 Ga0495634_0081330
1666 Ga0495634_0330982
1667 Ga0495635_0014791
1668 Ga0495635_0148863
1669 Ga0495635_0238116
1670 Ga0495657_0266273
1671 Ga0495657_0325479
1672 Ga0495599_0006067
1673 Ga0495623_0005084
1674 Ga0495646_0001510
1675 Ga0495646_0181357
1676 Ga0495669_0108929
1677 Ga0495613_0175258
1678 Ga0495613_0380363
1679 Ga0495624_0150794
1680 Ga0495624_0487288
1681 Ga0495600_0002242
1682 Ga0495600_0007130
1683 Ga0495600_0407634
1684 Ga0495600_0516478
1685 Ga0495581_0379853
1686 Ga0495581_0411699
1687 Ga0495604_0000807
1688 Ga0495604_0018346
1689 Ga0495604_0032681
1690 Ga0495674_0060527
1691 Ga0495674_0109001
1692 Ga0495674_0531030
1693 Ga0495676_0283497
1694 Ga0495676_0547610
1695 Ga0495680_0026918
1696 Ga0495680_0038199
1697 Ga0495680_0100807
1698 Ga0495680_0106631
1699 Ga0495680_0330292
1700 Ga0495675_0000700
1701 Ga0495675_0010767
1702 Ga0495675_0433279
1703 Ga0495684_0255811
1704 Ga0495593_0056182
1705 Ga0495593_0200878
1706 Ga0495602_0001773
1707 Ga0495602_0012708
1708 Ga0495602_0054174
1709 Ga0495614_0430706
1710 Ga0496100_0000839
1711 Ga0496100_0161943
1712 Ga0496100_0170130
1713 Ga0496100_0971509
1714 Ga0496101_0000633
1715 Ga0496101_0004102
1716 Ga0496101_0192773
1717 Ga0496101_0279530
1718 Ga0496101_0949479
1719 Ga0496102_0002481
1720 Ga0496102_0128171
1721 Ga0496102_0149712
1722 Ga0496102_0488791
1723 Ga0496102_1178696
1724 Ga0496103_0000717
1725 Ga0496103_0009959
1726 Ga0496103_0632701
1727 Ga0496104_0013489
1728 Ga0496104_0081209
1729 Ga0496104_0330060
1730 Ga0496104_0425177
1731 Ga0496105_0000950
1732 Ga0496105_0080899
1733 Ga0496105_0140839
1734 Ga0496106_0002354
1735 Ga0496106_0103947
1736 Ga0496106_0140922
1737 Ga0496106_0243951
1738 Ga0496107_0001263
1739 Ga0496107_0010575
1740 Ga0496107_0076401
1741 Ga0496107_0081726
1742 Ga0496107_0133211
1743 Ga0496108_0005842
1744 Ga0496108_0014469
1745 Ga0496108_0045694
1746 Ga0496108_0072423
1747 Ga0496108_0615737
1748 Ga0496108_0844072
1749 Ga0496109_0002017
1750 Ga0496109_0064505
1751 Ga0496109_0264743
1752 Ga0496109_0420494
1753 Ga0496109_0797386
1754 Ga0496110_0062959
1755 Ga0496110_0824306
1756 Ga0496111_0047606
1757 Ga0496111_0126152
1758 Ga0496112_0011955
1759 Ga0496112_0063884
1760 Ga0496112_0182295
1761 Ga0496112_0381482
1762 Ga0496113_0002233
1763 Ga0496113_0029827
1764 Ga0496113_0182856
1765 Ga0496114_0068146
1766 Ga0496114_0316138
1767 Ga0496115_0013377
1768 Ga0496115_0173982
1769 Ga0496115_0259085
1770 Ga0501031_0001817
1771 Ga0501032_0014494
1772 Ga0501032_0138065
1773 Ga0501033_0014506
1774 Ga0501033_0069790
1775 Ga0501033_0491419
1776 Ga0501034_0021775
1777 Ga0501034_0068635
1778 Ga0501034_0311509
1779 Ga0501034_0357091
1780 Ga0501034_1010191
1781 Ga0501036_0019391
1782 Ga0501036_0202693
1783 Ga0501036_0386489
1784 Ga0501037_0665499
1785 Ga0501038_0101807
1786 Ga0501038_0105053
1787 Ga0501039_0363704
1788 Ga0501043_0218212
1789 Ga0501043_0498564
1790 Ga0501043_0588455
1791 Ga0501046_0173852
1792 Ga0501047_0043849
1793 Ga0501047_0534888
1794 Ga0501047_0736179
1795 Ga0501047_1307430
1796 Ga0501048_0049894
1797 Ga0501048_1339513
1798 Ga0501069_0522343
1799 Ga0501069_0870878
1800 Ga0501070_0106381
1801 Ga0501070_0124351
1802 Ga0501070_0478792
1803 Ga0501070_0582403
1804 Ga0501071_0109523
1805 Ga0501071_0576804
1806 Ga0501071_0757097
1807 Ga0501071_0975056
1808 Ga0501072_0114497
1809 Ga0501072_0367395
1810 Ga0501073_0028170
1811 Ga0501074_0264212
1812 Ga0501076_0022574
1813 Ga0501077_0461930
1814 Ga0501077_0669517
1815 Ga0501079_1245584
1816 Ga0501083_0015623
1817 Ga0501083_0185831
1818 Ga0501083_0642080
1819 Ga0501035_0021027
1820 Ga0501035_0078558
1821 Ga0501044_0023194
1822 Ga0501044_0058854
1823 Ga0501044_0131262
1824 Ga0501044_0151201
1825 Ga0501044_0220640
1826 Ga0501044_0927325
1827 Ga0501044_1363734
1828 nmdc:mga06z11_2876_c1
1829 nmdc:mga06z11_307728_c1
1830 nmdc:mga06z11_928495_c1
1831 nmdc:mga07m45_166240_c1
1832 nmdc:mga07m45_16715_c1
1833 nmdc:mga07m45_71480_c1
1834 nmdc:mga09592_489504_c1
1835 nmdc:mga08y16_22355_c1
1836 nmdc:mga08y16_22831_c1
1837 nmdc:mga0n895_5206_c1
1838 nmdc:mga0n895_754317_c1
1839 nmdc:mga0n895_999538_c1
1840 nmdc:mga0rr50_158506_c1
1841 nmdc:mga0rr50_223325_c1
1842 nmdc:mga0rr50_312938_c1
1843 nmdc:mga08x19_54072_c1
1844 nmdc:mga0a205_13129_c1
1845 nmdc:mga0a205_98453_c1
1846 Ga0495601_0000233
1847 Ga0495601_0006401
1848 Ga0495601_0034773
1849 Ga0495601_0037667
1850 Ga0495601_0238201
1851 Ga0495601_0255778
1852 Ga0495612_0000533
1853 Ga0495612_0016648
1854 Ga0495612_0035482
1855 Ga0495595_0000360
1856 Ga0495595_0008907
1857 Ga0495595_0011483
1858 Ga0495595_0066145
1859 Ga0495619_0001179
1860 Ga0495619_0002698
1861 Ga0495619_0007775
1862 Ga0495619_0033967
1863 Ga0495619_0119157
1864 Ga0495619_0291014
1865 Ga0500643_005032
1866 Ga0500643_125844
1867 Ga0500644_0001907
1868 Ga0500651_0416824
1869 Ga0500641_0001278
1870 Ga0500595_000003
1871 Ga0500652_065133
1872 Ga0500577_0228948
1873 Ga0500616_0000002
1874 Ga0500645_001358
1875 Ga0501084_0554597
1876 Ga0501082_0044600
1877 Ga0501082_0185934
1878 Ga0530510_0753301

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

9

145

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.9147 8 143
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.9002 8 143
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8989 10 147
2qdl-assembly1.cif.gz_A crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8936 10 140
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8819 10 144
ID Description Score Start End Superfamily
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8898 29 96 2.40.50.180
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8818 30 96 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8682 29 92 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8445 29 92 2.40.50.180
1b3qA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8157 30 95 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A327JSZ2-F1-model_v4 Chemotaxis protein CheW 0.9838 3 144 GO:0005829
GO:0006935
GO:0007165
AF-A0A212IYY1-F1-model_v4 CheW protein 0.9799 2 144 GO:0005829
GO:0006935
GO:0007165
AF-A0A522A6C7-F1-model_v4 Chemotaxis protein CheW 0.9785 13 145 GO:0005829
GO:0006935
GO:0007165
AF-A0A317FC28-F1-model_v4 Chemotaxis protein CheW 0.9783 1 145 GO:0005829
GO:0006935
GO:0007165
AF-A0A0P7VGF4-F1-model_v4 Chemotaxis signal relay system purine-binding protiein CheW 0.9766 5 144 GO:0005829
GO:0006935
GO:0007165

Map