F486279

General Info

Members Datasets Scaffolds Average Seq Length
939 422 1878 497

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100049579|Ga0068860_1000495793
Length 503
Sequence MATDTQSGAPAIAYPGGEPMEAIGAVTPLPPHVLCIFGATGDLARRKLLPGLLHLCQAGLMPEFRVVGISMEELSDAQFREFAAEACREFGHHEFDQEEWHDFAQRLSYLPVSEAPKALKGVVEATCEELGEETRLLHYLSVPPKAAGDVIELLGEAGLNERARVVMEKPFGTDLASAQRLNEMVHEVFREEQVFRIDHFLGKEAALNILALRFANGLFEPIWNRDHIDHIQIDVPETIGVGSRAGFYDQTGAYRDMVVTHLFQILAFVAMEPPTALAPEPITEEKNKVFRSLRPLDPEWVVRGQYEGYAEEVGVESSSTETFVALRNEIDNWRWSGVKFYLRTGKRMGEGGRIISIAFREPPQSMFPAHSRVGRYGPDHLTFDLDESSRVSLSFYGKRPGMGMVLDKASMQFSLDETAYRGETLEAYERLLRDAMAGDRTLFTTARDIERLWEISEPLLRDPAPVKPYPQGSWGPAEIGALIAPNSWRLPFARRWREHHVNP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
192 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
238 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
241 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
375 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
378 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
386 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
387 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
388 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
389 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
390 2643221711 Terrabacter sp. Root85 Isolate Unclassified
391 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
392 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
393 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
394 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
395 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
396 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
397 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
398 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
399 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
400 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
401 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
402 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
403 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
404 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
405 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
406 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
407 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
408 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
409 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
410 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
411 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
412 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
413 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
414 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
415 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
416 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
417 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
418 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
419 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
420 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
421 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
422 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0.11
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 11.93
Rhizosphere 72.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100049579 3300005843 Bacteria 3998
2 JGI24741J21665_1004231 3300001915 Bacteria 3224
3 JGI24740J21852_10012686 3300001979 Bacteria 3170
4 JGI24739J22299_10007492 3300001989 Bacteria 4092
5 JGI24737J22298_10014225 3300001990 Bacteria 2584
6 JGI24735J21928_10014328 3300002067 Bacteria 2484
7 JGI24750J21931_1003282 3300002070 Bacteria 1941
8 JGI24745J21846_1001386 3300002073 Bacteria 2342
9 JGI24744J21845_10002686 3300002077 Bacteria 3628
10 JGI24033J26618_1000922 3300002155 Bacteria 2828
11 JGI24751J29686_10002325 3300002459 Bacteria 3839
12 JGI24751J29686_10006759 3300002459 Bacteria 2338
13 JGI25406J46586_10005948 3300003203 Bacteria 5644
14 JGI25407J50210_10000047 3300003373 Bacteria 13908
15 JGI25407J50210_10011902 3300003373 Bacteria 2228
16 Ga0055540_1000065 3300003792 Bacteria 126812
17 Ga0055540_1001113 3300003792 Bacteria 16948
18 Ga0055540_1001796 3300003792 Bacteria 12202
19 Ga0055540_1003135 3300003792 Bacteria 8186
20 Ga0070658_10077740 3300005327 Bacteria 2723
21 Ga0070658_10093759 3300005327 Bacteria 2476
22 Ga0070676_10008718 3300005328 Bacteria 5471
23 Ga0070683_100000527 3300005329 Bacteria 26899
24 Ga0070683_100079610 3300005329 Bacteria 3066
25 Ga0070683_100207572 3300005329 Bacteria 1860
26 Ga0070690_100021595 3300005330 Bacteria 3932
27 Ga0070670_100105668 3300005331 Bacteria 2426
28 Ga0068869_100014020 3300005334 Bacteria 5347
29 Ga0070666_10055053 3300005335 Bacteria 2684
30 Ga0070682_100001211 3300005337 Bacteria 14715
31 Ga0070682_100006610 3300005337 Bacteria 6504
32 Ga0070682_100090917 3300005337 Bacteria 1997
33 Ga0068868_100019969 3300005338 Bacteria 5026
34 Ga0068868_100048728 3300005338 Bacteria 3324
35 Ga0068868_100177504 3300005338 Bacteria 1766
36 Ga0070689_100016786 3300005340 Bacteria 5364
37 Ga0070661_100000110 3300005344 Bacteria 68106
38 Ga0070661_100013458 3300005344 Bacteria 5742
39 Ga0070661_100071708 3300005344 Bacteria 2549
40 Ga0070661_100129182 3300005344 Bacteria 1897
41 Ga0070692_10012228 3300005345 Bacteria 3965
42 Ga0070668_100001430 3300005347 Bacteria 17221
43 Ga0070668_100002698 3300005347 Bacteria 13056
44 Ga0070668_100007667 3300005347 Bacteria 8011
45 Ga0070668_100028160 3300005347 Bacteria 4266
46 Ga0070668_100028625 3300005347 Bacteria 4229
47 Ga0070668_100045992 3300005347 Bacteria 3350
48 Ga0070668_100063880 3300005347 Bacteria 2853
49 Ga0070668_100106218 3300005347 Bacteria 2230
50 Ga0070669_100016048 3300005353 Bacteria 5344
51 Ga0070671_100002337 3300005355 Bacteria 14646
52 Ga0070674_100000153 3300005356 Bacteria 32199
53 Ga0070688_100000053 3300005365 Bacteria 55064
54 Ga0070659_100000013 3300005366 Bacteria 178795
55 Ga0070659_100016187 3300005366 Bacteria 5595
56 Ga0070667_100000840 3300005367 Bacteria 28497
57 Ga0070667_100008468 3300005367 Bacteria 8529
58 Ga0070667_100028629 3300005367 Bacteria 4639
59 Ga0070667_100053878 3300005367 Bacteria 3395
60 Ga0070714_100011637 3300005435 Bacteria 6986
61 Ga0070714_100149830 3300005435 Bacteria 2101
62 Ga0070713_100133350 3300005436 Bacteria 2192
63 Ga0070710_10001412 3300005437 Bacteria 11329
64 Ga0070710_10012538 3300005437 Bacteria 4212
65 Ga0070701_10022358 3300005438 Bacteria 3031
66 Ga0070711_100000205 3300005439 Bacteria 31303
67 Ga0070711_100010610 3300005439 Bacteria 5707
68 Ga0070705_100018204 3300005440 Bacteria 3678
69 Ga0070694_100048154 3300005444 Bacteria 2867
70 Ga0070663_100031238 3300005455 Bacteria 3659
71 Ga0070663_100083040 3300005455 Bacteria 2358
72 Ga0070678_100004645 3300005456 Bacteria 7810
73 Ga0070678_100021506 3300005456 Bacteria 4255
74 Ga0070662_100020708 3300005457 Bacteria 4484
75 Ga0070662_100096833 3300005457 Bacteria 2226
76 Ga0070662_100124614 3300005457 Bacteria 1979
77 Ga0070681_10043343 3300005458 Bacteria 4508
78 Ga0068867_100006760 3300005459 Bacteria 8108
79 Ga0068867_100026849 3300005459 Bacteria 4136
80 Ga0068867_100156717 3300005459 Bacteria 1793
81 Ga0070685_10000086 3300005466 Bacteria 57017
82 Ga0070685_10014773 3300005466 Bacteria 4139
83 Ga0070685_10033305 3300005466 Bacteria 2893
84 Ga0070707_100165503 3300005468 Bacteria 2155
85 Ga0070679_100002668 3300005530 Bacteria 16241
86 Ga0068853_100033816 3300005539 Bacteria 4337
87 Ga0068853_100071658 3300005539 Bacteria 3018
88 Ga0068853_100149071 3300005539 Bacteria 2104
89 Ga0070686_100048679 3300005544 Bacteria 2686
90 Ga0070696_100034595 3300005546 Bacteria 3476
91 Ga0070696_100166725 3300005546 Bacteria 1626
92 Ga0070693_100019527 3300005547 Bacteria 3555
93 Ga0070665_100004960 3300005548 Bacteria 13801
94 Ga0070665_100032045 3300005548 Bacteria 5291
95 Ga0070665_100043787 3300005548 Bacteria 4497
96 Ga0070665_100075978 3300005548 Bacteria 3366
97 Ga0070704_100000289 3300005549 Bacteria 22086
98 Ga0070704_100064102 3300005549 Bacteria 2640
99 Ga0068857_100084732 3300005577 Bacteria 2832
100 Ga0068854_100025337 3300005578 Bacteria 4069
101 Ga0068856_100001228 3300005614 Bacteria 26877
102 Ga0070702_100029922 3300005615 Bacteria 2966
103 Ga0070702_100031581 3300005615 Bacteria 2899
104 Ga0068852_100059236 3300005616 Bacteria 3320
105 Ga0068859_100002544 3300005617 Bacteria 18515
106 Ga0068859_100023558 3300005617 Bacteria 6178
107 Ga0068859_100107717 3300005617 Bacteria 2847
108 Ga0068866_10001088 3300005718 Bacteria 11980
109 Ga0068861_100002774 3300005719 Bacteria 11496
110 Ga0068863_100000373 3300005841 Bacteria 45591
111 Ga0068863_100024127 3300005841 Bacteria 5802
112 Ga0068863_100093058 3300005841 Bacteria 2861
113 Ga0068858_100003979 3300005842 Bacteria 14586
114 Ga0068858_100046913 3300005842 Bacteria 4005
115 Ga0068858_100058513 3300005842 Bacteria 3564
116 Ga0068860_100000011 3300005843 Bacteria 328172
117 Ga0068860_100033567 3300005843 Bacteria 4923
118 Ga0068860_100107761 3300005843 Bacteria 2662
119 Ga0068862_100000139 3300005844 Bacteria 82475
120 Ga0068862_100000366 3300005844 Bacteria 49032
121 Ga0068862_100005265 3300005844 Bacteria 10850
122 Ga0068862_100021554 3300005844 Bacteria 5385
123 Ga0068862_100129428 3300005844 Bacteria 2231
124 Ga0081455_10000106 3300005937 Bacteria 93286
125 Ga0081455_10002738 3300005937 Bacteria 20795
126 Ga0081455_10027460 3300005937 Bacteria 5216
127 Ga0081455_10037772 3300005937 Bacteria 4282
128 Ga0081455_10084826 3300005937 Bacteria 2584
129 Ga0081538_10000763 3300005981 Bacteria 35158
130 Ga0081538_10000973 3300005981 Bacteria 30622
131 Ga0081540_1000046 3300005983 Bacteria 131375
132 Ga0081540_1011454 3300005983 Bacteria 5924
133 Ga0081540_1013115 3300005983 Bacteria 5411
134 Ga0081539_10000236 3300005985 Bacteria 129646
135 Ga0081539_10001074 3300005985 Bacteria 49797
136 Ga0081539_10001710 3300005985 Bacteria 35211
137 Ga0081539_10004566 3300005985 Bacteria 15131
138 Ga0081539_10010378 3300005985 Bacteria 7574
139 Ga0070717_10000059 3300006028 Bacteria 92958
140 Ga0070717_10118149 3300006028 Bacteria 2269
141 Ga0075365_10000193 3300006038 Bacteria 20067
142 Ga0075365_10000898 3300006038 Bacteria 12474
143 Ga0075365_10009502 3300006038 Bacteria 5595
144 Ga0075363_100000427 3300006048 Bacteria 13107
145 Ga0075363_100002846 3300006048 Bacteria 7200
146 Ga0075363_100016916 3300006048 Bacteria 3608
147 Ga0075363_100040584 3300006048 Bacteria 2453
148 Ga0075364_10000577 3300006051 Bacteria 18886
149 Ga0075364_10000892 3300006051 Bacteria 15760
150 Ga0075364_10001241 3300006051 Bacteria 13684
151 Ga0075364_10003280 3300006051 Bacteria 9173
152 Ga0075364_10052920 3300006051 Bacteria 2654
153 Ga0075364_10062082 3300006051 Bacteria 2452
154 Ga0075364_10105557 3300006051 Bacteria 1877
155 Ga0075432_10000398 3300006058 Bacteria 12679
156 Ga0070716_100019063 3300006173 Bacteria 3582
157 Ga0070716_100025057 3300006173 Bacteria 3178
158 Ga0070712_100021922 3300006175 Bacteria 4200
159 Ga0075367_10016382 3300006178 Bacteria 4047
160 Ga0075369_10002193 3300006186 Bacteria 6904
161 Ga0075369_10011109 3300006186 Bacteria 3533
162 Ga0075369_10014500 3300006186 Bacteria 3149
163 Ga0075369_10046765 3300006186 Bacteria 1864
164 Ga0075370_10007355 3300006353 Bacteria 5605
165 Ga0075370_10009536 3300006353 Bacteria 5046
166 Ga0075370_10038551 3300006353 Bacteria 2689
167 Ga0075428_100016930 3300006844 Bacteria 8050
168 Ga0075428_100020281 3300006844 Bacteria 7362
169 Ga0075431_100012901 3300006847 Bacteria 8434
170 Ga0075431_100019604 3300006847 Bacteria 6899
171 Ga0075431_100034685 3300006847 Bacteria 5198
172 Ga0075433_10001708 3300006852 Bacteria 16382
173 Ga0075433_10070863 3300006852 Bacteria 3064
174 Ga0075434_100004328 3300006871 Bacteria 12772
175 Ga0075434_100004603 3300006871 Bacteria 12453
176 Ga0075434_100019309 3300006871 Bacteria 6595
177 Ga0075429_100003236 3300006880 Bacteria 13858
178 Ga0068865_100014483 3300006881 Bacteria 5011
179 Ga0068865_100049452 3300006881 Bacteria 2898
180 Ga0068865_100103041 3300006881 Bacteria 2092
181 Ga0075436_100002186 3300006914 Bacteria 13483
182 Ga0075436_100059928 3300006914 Bacteria 2629
183 Ga0097620_100002544 3300006931 Bacteria 18515
184 Ga0097620_100023557 3300006931 Bacteria 6178
185 Ga0097620_100107709 3300006931 Bacteria 2847
186 Ga0075435_100000562 3300007076 Bacteria 22817
187 Ga0075435_100061086 3300007076 Bacteria 3057
188 Ga0105251_10053118 3300009011 Bacteria 1927
189 Ga0111539_10001351 3300009094 Bacteria 32652
190 Ga0111539_10010304 3300009094 Bacteria 11767
191 Ga0111539_10017096 3300009094 Bacteria 8978
192 Ga0111539_10072393 3300009094 Bacteria 4064
193 Ga0105245_10004802 3300009098 Bacteria 11924
194 Ga0105245_10015520 3300009098 Bacteria 6642
195 Ga0105245_10018530 3300009098 Bacteria 6088
196 Ga0105245_10027146 3300009098 Bacteria 5044
197 Ga0105245_10072901 3300009098 Bacteria 3121
198 Ga0105245_10093030 3300009098 Bacteria 2778
199 Ga0105247_10000067 3300009101 Bacteria 118585
200 Ga0114129_10018395 3300009147 Bacteria 9952
201 Ga0114129_10085188 3300009147 Bacteria 4384
202 Ga0105243_10003878 3300009148 Bacteria 11951
203 Ga0105243_10027691 3300009148 Bacteria 4345
204 Ga0105243_10029456 3300009148 Bacteria 4222
205 Ga0105243_10049144 3300009148 Bacteria 3327
206 Ga0105241_10015475 3300009174 Bacteria 5588
207 Ga0105242_10000052 3300009176 Bacteria 79244
208 Ga0105242_10003061 3300009176 Bacteria 13067
209 Ga0105248_10000040 3300009177 Bacteria 172452
210 Ga0105248_10007307 3300009177 Bacteria 12120
211 Ga0105248_10046307 3300009177 Bacteria 4874
212 Ga0105248_10174132 3300009177 Bacteria 2426
213 Ga0105248_10256461 3300009177 Bacteria 1969
214 Ga0105237_10016854 3300009545 Bacteria 7582
215 Ga0105237_10051342 3300009545 Bacteria 4142
216 Ga0105237_10137143 3300009545 Bacteria 2441
217 Ga0105237_10164528 3300009545 Bacteria 2217
218 Ga0105237_10264593 3300009545 Bacteria 1722
219 Ga0105238_10192262 3300009551 Bacteria 2017
220 Ga0105249_10000001 3300009553 Bacteria 504948
221 Ga0105249_10000916 3300009553 Bacteria 26081
222 Ga0105249_10013603 3300009553 Bacteria 7186
223 Ga0105249_10020446 3300009553 Bacteria 5917
224 Ga0105239_10033519 3300010375 Bacteria 5639
225 Ga0105239_10046182 3300010375 Bacteria 4772
226 Ga0105239_10090887 3300010375 Bacteria 3368
227 Ga0105239_10108668 3300010375 Bacteria 3073
228 Ga0105246_10051975 3300011119 Bacteria 2815
229 Ga0105246_10072007 3300011119 Bacteria 2435
230 Ga0105246_10082776 3300011119 Bacteria 2291
231 Ga0157371_10002739 3300013102 Bacteria 16585
232 Ga0157369_10106863 3300013105 Bacteria 2978
233 Ga0157374_10033593 3300013296 Bacteria 4681
234 Ga0157374_10228830 3300013296 Bacteria 1826
235 Ga0157374_10233194 3300013296 Bacteria 1808
236 Ga0157378_10012869 3300013297 Bacteria 7324
237 Ga0157378_10104429 3300013297 Bacteria 2590
238 Ga0163162_10009929 3300013306 Bacteria 9260
239 Ga0163162_10029767 3300013306 Bacteria 5404
240 Ga0163162_10072586 3300013306 Bacteria 3497
241 Ga0163162_10074024 3300013306 Bacteria 3464
242 Ga0163162_10079151 3300013306 Bacteria 3353
243 Ga0163162_10097729 3300013306 Bacteria 3025
244 Ga0163162_10134826 3300013306 Bacteria 2580
245 Ga0163162_10348824 3300013306 Bacteria 1613
246 Ga0157372_10000284 3300013307 Bacteria 56386
247 Ga0157372_10005924 3300013307 Bacteria 13002
248 Ga0157372_10064155 3300013307 Bacteria 4121
249 Ga0157372_10168658 3300013307 Bacteria 2532
250 Ga0157375_10000945 3300013308 Bacteria 25164
251 Ga0157375_10005034 3300013308 Bacteria 11478
252 Ga0157375_10072195 3300013308 Bacteria 3467
253 Ga0157380_10000186 3300014326 Bacteria 35981
254 Ga0157380_10003827 3300014326 Bacteria 10365
255 Ga0157380_10074409 3300014326 Bacteria 2757
256 Ga0157377_10080449 3300014745 Bacteria 1903
257 Ga0157379_10025482 3300014968 Bacteria 5254
258 Ga0157376_10055880 3300014969 Bacteria 3295
259 Ga0163161_10005342 3300017792 Bacteria 8929
260 Ga0206353_10643868 3300020082 Bacteria 4538
261 Ga0213876_10001770 3300021384 Bacteria 13089
262 Ga0213876_10015187 3300021384 Bacteria 4079
263 Ga0213875_10007089 3300021388 Bacteria 5825
264 Ga0209673_1008850 3300025273 Bacteria 4433
265 Ga0209051_1000042 3300025303 Bacteria 308486
266 Ga0209051_1001272 3300025303 Bacteria 22502
267 Ga0209051_1003310 3300025303 Bacteria 10672
268 Ga0209051_1003693 3300025303 Bacteria 9880
269 Ga0207692_10016442 3300025898 Bacteria 3277
270 Ga0207692_10017629 3300025898 Bacteria 3188
271 Ga0207642_10000670 3300025899 Bacteria 10550
272 Ga0207642_10013194 3300025899 Bacteria 3008
273 Ga0207710_10000094 3300025900 Bacteria 118590
274 Ga0207688_10001311 3300025901 Bacteria 12918
275 Ga0207688_10001662 3300025901 Bacteria 11760
276 Ga0207688_10009551 3300025901 Bacteria 5280
277 Ga0207688_10015696 3300025901 Bacteria 4108
278 Ga0207688_10060428 3300025901 Bacteria 2135
279 Ga0207680_10004733 3300025903 Bacteria 6475
280 Ga0207680_10046470 3300025903 Bacteria 2566
281 Ga0207647_10016099 3300025904 Bacteria 5108
282 Ga0207647_10023770 3300025904 Bacteria 4049
283 Ga0207647_10027662 3300025904 Bacteria 3694
284 Ga0207647_10053948 3300025904 Bacteria 2474
285 Ga0207699_10006259 3300025906 Bacteria 5749
286 Ga0207645_10058212 3300025907 Bacteria 2467
287 Ga0207643_10023963 3300025908 Bacteria 3368
288 Ga0207705_10025934 3300025909 Bacteria 4183
289 Ga0207705_10040140 3300025909 Bacteria 3355
290 Ga0207707_10031607 3300025912 Bacteria 4632
291 Ga0207671_10009287 3300025914 Bacteria 8236
292 Ga0207671_10077218 3300025914 Bacteria 2493
293 Ga0207671_10087953 3300025914 Bacteria 2337
294 Ga0207693_10003676 3300025915 Bacteria 13100
295 Ga0207693_10012194 3300025915 Bacteria 6943
296 Ga0207693_10019923 3300025915 Bacteria 5335
297 Ga0207693_10043212 3300025915 Bacteria 3546
298 Ga0207663_10007388 3300025916 Bacteria 5695
299 Ga0207663_10054819 3300025916 Bacteria 2498
300 Ga0207662_10005997 3300025918 Bacteria 6529
301 Ga0207657_10023952 3300025919 Bacteria 5668
302 Ga0207657_10138233 3300025919 Bacteria 1992
303 Ga0207649_10000015 3300025920 Bacteria 245662
304 Ga0207649_10006432 3300025920 Bacteria 6380
305 Ga0207652_10009781 3300025921 Bacteria 7717
306 Ga0207652_10157724 3300025921 Bacteria 2033
307 Ga0207681_10002134 3300025923 Bacteria 12626
308 Ga0207659_10000707 3300025926 Bacteria 19793
309 Ga0207687_10002110 3300025927 Bacteria 13589
310 Ga0207687_10007569 3300025927 Bacteria 7143
311 Ga0207687_10024556 3300025927 Bacteria 4028
312 Ga0207687_10026230 3300025927 Bacteria 3900
313 Ga0207687_10119107 3300025927 Bacteria 1972
314 Ga0207700_10000003 3300025928 Bacteria 500797
315 Ga0207664_10008731 3300025929 Bacteria 7084
316 Ga0207644_10083867 3300025931 Bacteria 2361
317 Ga0207690_10000075 3300025932 Bacteria 85885
318 Ga0207690_10006804 3300025932 Bacteria 6781
319 Ga0207690_10032483 3300025932 Bacteria 3349
320 Ga0207706_10012125 3300025933 Bacteria 7850
321 Ga0207706_10017268 3300025933 Bacteria 6503
322 Ga0207706_10117753 3300025933 Bacteria 2336
323 Ga0207686_10000119 3300025934 Bacteria 64297
324 Ga0207686_10034284 3300025934 Bacteria 3037
325 Ga0207709_10013184 3300025935 Bacteria 4559
326 Ga0207709_10036710 3300025935 Bacteria 2906
327 Ga0207669_10030356 3300025937 Bacteria 3003
328 Ga0207669_10070907 3300025937 Bacteria 2187
329 Ga0207704_10008206 3300025938 Bacteria 4977
330 Ga0207704_10024642 3300025938 Bacteria 3267
331 Ga0207704_10025069 3300025938 Bacteria 3248
332 Ga0207665_10009146 3300025939 Bacteria 6503
333 Ga0207711_10000011 3300025941 Bacteria 518817
334 Ga0207711_10000419 3300025941 Bacteria 44875
335 Ga0207711_10007828 3300025941 Bacteria 8931
336 Ga0207711_10015373 3300025941 Bacteria 6352
337 Ga0207689_10006344 3300025942 Bacteria 10474
338 Ga0207689_10010392 3300025942 Bacteria 8018
339 Ga0207689_10028771 3300025942 Bacteria 4647
340 Ga0207689_10043062 3300025942 Bacteria 3732
341 Ga0207661_10000438 3300025944 Bacteria 26840
342 Ga0207661_10001594 3300025944 Bacteria 15404
343 Ga0207661_10179866 3300025944 Bacteria 1847
344 Ga0207679_10006499 3300025945 Bacteria 7388
345 Ga0207712_10000006 3300025961 Bacteria 573204
346 Ga0207712_10000994 3300025961 Bacteria 20219
347 Ga0207712_10027061 3300025961 Bacteria 3826
348 Ga0207712_10043652 3300025961 Bacteria 3094
349 Ga0207712_10082501 3300025961 Bacteria 2344
350 Ga0207712_10088424 3300025961 Bacteria 2275
351 Ga0207668_10000972 3300025972 Bacteria 17220
352 Ga0207668_10004404 3300025972 Bacteria 8272
353 Ga0207668_10069075 3300025972 Bacteria 2514
354 Ga0207668_10119262 3300025972 Bacteria 1994
355 Ga0207658_10000513 3300025986 Bacteria 35348
356 Ga0207658_10001083 3300025986 Bacteria 22062
357 Ga0207658_10004107 3300025986 Bacteria 10155
358 Ga0207658_10011128 3300025986 Bacteria 6127
359 Ga0207677_10017030 3300026023 Bacteria 4320
360 Ga0207677_10068318 3300026023 Bacteria 2493
361 Ga0207677_10083694 3300026023 Bacteria 2297
362 Ga0207703_10008803 3300026035 Bacteria 7958
363 Ga0207639_10042649 3300026041 Bacteria 3401
364 Ga0207639_10042898 3300026041 Bacteria 3393
365 Ga0207678_10018936 3300026067 Bacteria 6050
366 Ga0207678_10036639 3300026067 Bacteria 4270
367 Ga0207678_10042158 3300026067 Bacteria 3956
368 Ga0207678_10058204 3300026067 Bacteria 3325
369 Ga0207678_10181705 3300026067 Bacteria 1796
370 Ga0207708_10009808 3300026075 Bacteria 7106
371 Ga0207702_10000419 3300026078 Bacteria 48574
372 Ga0207702_10100883 3300026078 Bacteria 2548
373 Ga0207702_10111204 3300026078 Bacteria 2436
374 Ga0207641_10000489 3300026088 Bacteria 44684
375 Ga0207641_10022045 3300026088 Bacteria 5238
376 Ga0207648_10006599 3300026089 Bacteria 11521
377 Ga0207676_10003416 3300026095 Bacteria 11230
378 Ga0207674_10029086 3300026116 Bacteria 5824
379 Ga0207674_10036548 3300026116 Bacteria 5115
380 Ga0207675_100000896 3300026118 Bacteria 29755
381 Ga0207675_100002895 3300026118 Bacteria 16878
382 Ga0207675_100018303 3300026118 Bacteria 6532
383 Ga0207675_100055105 3300026118 Bacteria 3709
384 Ga0207683_10003700 3300026121 Bacteria 13285
385 Ga0207683_10012181 3300026121 Bacteria 7341
386 Ga0207683_10097115 3300026121 Bacteria 2627
387 Ga0207698_10000015 3300026142 Bacteria 207368
388 Ga0207698_10096122 3300026142 Bacteria 2441
389 Ga0207428_10001010 3300027907 Bacteria 31237
390 Ga0207428_10011064 3300027907 Bacteria 8017
391 Ga0207428_10036585 3300027907 Bacteria 4003
392 Ga0207428_10108580 3300027907 Bacteria 2137
393 Ga0207428_10113006 3300027907 Bacteria 2088
394 Ga0268266_10000485 3300028379 Bacteria 57051
395 Ga0268266_10001186 3300028379 Bacteria 32148
396 Ga0268266_10016797 3300028379 Bacteria 6257
397 Ga0268266_10031366 3300028379 Bacteria 4512
398 Ga0268266_10121722 3300028379 Bacteria 2322
399 Ga0268265_10000032 3300028380 Bacteria 225953
400 Ga0268265_10003823 3300028380 Bacteria 10667
401 Ga0268265_10039720 3300028380 Bacteria 3470
402 Ga0268265_10128307 3300028380 Bacteria 2103
403 Ga0268265_10186493 3300028380 Bacteria 1787
404 Ga0268265_10219233 3300028380 Bacteria 1663
405 Ga0268264_10000026 3300028381 Bacteria 459088
406 Ga0268264_10081582 3300028381 Bacteria 2764
407 Ga0268264_10287849 3300028381 Bacteria 1542
408 Ga0265337_1000012 3300028556 Bacteria 85395
409 Ga0265326_10000007 3300028558 Bacteria 223057
410 Ga0265319_1001040 3300028563 Bacteria 17346
411 Ga0265334_10000094 3300028573 Bacteria 63340
412 Ga0265322_10000001 3300028654 Bacteria 543854
413 Ga0265336_10004740 3300028666 Bacteria 5100
414 Ga0265336_10008731 3300028666 Bacteria 3536
415 Ga0265338_10003073 3300028800 Bacteria 23964
416 Ga0265338_10039663 3300028800 Bacteria 4438
417 Ga0265324_10001935 3300029957 Bacteria 11108
418 Ga0265324_10011287 3300029957 Bacteria 3409
419 Ga0265332_10009702 3300031238 Bacteria 4295
420 Ga0265328_10000659 3300031239 Bacteria 16018
421 Ga0265320_10000002 3300031240 Bacteria 542875
422 Ga0265329_10002237 3300031242 Bacteria 8915
423 Ga0265331_10000919 3300031250 Bacteria 23588
424 Ga0265327_10000011 3300031251 Bacteria 543807
425 Ga0265327_10000626 3300031251 Bacteria 58052
426 Ga0265327_10017384 3300031251 Bacteria 4515
427 Ga0265327_10067674 3300031251 Bacteria 1798
428 Ga0307513_10004621 3300031456 Bacteria 18332
429 Ga0307408_100009103 3300031548 Bacteria 6550
430 Ga0316575_10000856 3300031665 Bacteria 9329
431 Ga0316579_10000197 3300031691 Bacteria 17803
432 Ga0265314_10000224 3300031711 Bacteria 84325
433 Ga0265314_10087093 3300031711 Bacteria 2043
434 Ga0316576_10000472 3300031727 Bacteria 18887
435 Ga0316576_10071005 3300031727 Bacteria 2568
436 Ga0316578_10002095 3300031728 Bacteria 8556
437 Ga0316578_10029750 3300031728 Bacteria 3101
438 Ga0307405_10012822 3300031731 Bacteria 4453
439 Ga0307405_10021001 3300031731 Bacteria 3662
440 Ga0307413_10003082 3300031824 Bacteria 6931
441 Ga0307413_10008230 3300031824 Bacteria 4908
442 Ga0307413_10013804 3300031824 Bacteria 4078
443 Ga0307410_10048177 3300031852 Bacteria 2852
444 Ga0326468_10000144 3300031889 Bacteria 6750
445 Ga0307406_10000212 3300031901 Bacteria 35056
446 Ga0307406_10003159 3300031901 Bacteria 8964
447 Ga0307406_10008888 3300031901 Bacteria 5614
448 Ga0307407_10011467 3300031903 Bacteria 4219
449 Ga0307407_10023004 3300031903 Bacteria 3244
450 Ga0307412_10020831 3300031911 Bacteria 3997
451 Ga0307409_100000273 3300031995 Bacteria 20946
452 Ga0307409_100039242 3300031995 Bacteria 3511
453 Ga0307409_100069954 3300031995 Bacteria 2783
454 Ga0307409_100114239 3300031995 Bacteria 2271
455 Ga0307416_100024902 3300032002 Bacteria 4377
456 Ga0307416_100100022 3300032002 Bacteria 2520
457 Ga0307416_100333315 3300032002 Bacteria 1526
458 Ga0307414_10043440 3300032004 Bacteria 3061
459 Ga0307414_10060645 3300032004 Bacteria 2676
460 Ga0307414_10065657 3300032004 Bacteria 2590
461 Ga0307411_10030039 3300032005 Bacteria 3327
462 Ga0307411_10066141 3300032005 Bacteria 2427
463 Ga0307411_10089911 3300032005 Bacteria 2140
464 Ga0307411_10116855 3300032005 Bacteria 1921
465 Ga0307415_100002934 3300032126 Bacteria 8555
466 Ga0307415_100014609 3300032126 Bacteria 4623
467 Ga0307507_10116584 3300033179 Bacteria 2157
468 Ga0373926_0018656 3300035083 Bacteria 2388
469 Ga0373940_0015452 3300035088 Bacteria 1878
470 Ga0373923_0025185 3300035111 Bacteria 2356
471 Ga0373936_0038871 3300035113 Bacteria 1903
472 Ga0373945_0034978 3300035116 Bacteria 1793
473 Ga0373943_0019111 3300035170 Bacteria 3150
474 Ga0373946_0027023 3300035171 Bacteria 2267
475 Ga0373962_0012023 3300035242 Bacteria 2177
476 Ga0316574_0021377 3300035398 Bacteria 3841
477 Ga0316574_0050231 3300035398 Bacteria 2595
478 Ga0316574_0059543 3300035398 Bacteria 2395
479 Ga0373931_0011804 3300035691 Bacteria 4223
480 Ga0373931_0049431 3300035691 Bacteria 2233
481 Ga0373935_0012382 3300035692 Bacteria 5132
482 Ga0373927_0058976 3300035695 Bacteria 2482
483 Ga0373947_0025273 3300035725 Bacteria 3463
484 Ga0373937_0012589 3300036401 Bacteria 7444
485 Ga0316582_0000099 3300036647 Bacteria 23809
486 Ga0316584_0011486 3300036712 Bacteria 6224
487 Ga0316584_0017792 3300036712 Bacteria 5117
488 Ga0316584_0032919 3300036712 Bacteria 3837
489 Ga0373925_0114583 3300037068 Bacteria 2086
490 Ga0395899_0031667 3300037312 Bacteria 3974
491 Ga0395900_0008269 3300037418 Bacteria 10715
492 Ga0395900_0113694 3300037418 Bacteria 2778
493 Ga0395898_0005178 3300037466 Bacteria 14109
494 Ga0395898_0006290 3300037466 Bacteria 12693
495 Ga0395898_0011426 3300037466 Bacteria 9222
496 Ga0395898_0048546 3300037466 Bacteria 4162
497 Ga0395905_0004214 3300037471 Bacteria 15037
498 Ga0395905_0041668 3300037471 Bacteria 4309
499 Ga0395905_0053436 3300037471 Bacteria 3781
500 Ga0395905_0123278 3300037471 Bacteria 2437
501 Ga0436364_0908867 3300037853 Bacteria 5649
502 Ga0436364_1011521 3300037853 Bacteria 14844
503 Ga0436364_1192519 3300037853 Bacteria 17220
504 Ga0436364_1442254 3300037853 Bacteria 7087
505 Ga0395901_0003473 3300038443 Bacteria 15871
506 Ga0395901_0012501 3300038443 Bacteria 8614
507 Ga0395901_0045998 3300038443 Bacteria 4531
508 Ga0395901_0074150 3300038443 Bacteria 3550
509 Ga0395901_0170831 3300038443 Bacteria 2281
510 Ga0242420_004140 3300038996 Bacteria 2180
511 Ga0436365_0064899 3300039437 Bacteria 12232
512 Ga0436365_0641890 3300039437 Bacteria 23847
513 Ga0436365_1856170 3300039437 Bacteria 22649
514 Ga0436362_1177671 3300039453 Bacteria 2709
515 Ga0439466_0001181 3300041411 Bacteria 10165
516 Ga0439466_0006248 3300041411 Bacteria 4533
517 Ga0439466_0010202 3300041411 Bacteria 3493
518 Ga0439465_0001503 3300041413 Bacteria 7562
519 Ga0439465_0026450 3300041413 Bacteria 1835
520 Ga0451833_0918545 3300041491 Bacteria 4797
521 Ga0451837_0394872 3300041494 Bacteria 1923
522 Ga0439450_001482 3300042008 Bacteria 3454
523 Ga0439463_003079 3300042016 Bacteria 4234
524 Ga0439459_0009821 3300042438 Bacteria 1658
525 Ga0439464_0014935 3300042439 Bacteria 2093
526 Ga0439440_0003643 3300042993 Bacteria 2986
527 Ga0466972_0007601 3300044658 Bacteria 5442
528 Ga0466972_0013868 3300044658 Bacteria 4045
529 Ga0466965_0005448 3300044683 Bacteria 5735
530 Ga0466966_0016384 3300044684 Bacteria 4898
531 Ga0466966_0031501 3300044684 Bacteria 3438
532 Ga0466966_0033360 3300044684 Bacteria 3334
533 Ga0466961_0008896 3300044693 Bacteria 6404
534 Ga0466961_0057918 3300044693 Bacteria 2465
535 Ga0466963_0003743 3300044694 Bacteria 8759
536 Ga0466968_0001398 3300044735 Bacteria 8636
537 Ga0466970_0009706 3300044765 Bacteria 4869
538 Ga0466970_0025734 3300044765 Bacteria 3082
539 Ga0466970_0030982 3300044765 Bacteria 2823
540 Ga0466970_0032132 3300044765 Bacteria 2773
541 Ga0466957_0008957 3300044842 Bacteria 5705
542 Ga0466957_0037436 3300044842 Bacteria 2921
543 Ga0466957_0058481 3300044842 Bacteria 2362
544 Ga0466960_0006440 3300044901 Bacteria 4710
545 Ga0466960_0010724 3300044901 Bacteria 3812
546 Ga0466960_0081961 3300044901 Bacteria 1628
547 Ga0466959_0063426 3300045049 Bacteria 2683
548 Ga0466959_0105976 3300045049 Bacteria 2010
549 Ga0466958_0001373 3300045836 Bacteria 11504
550 Ga0466958_0067657 3300045836 Bacteria 2182
551 Ga0466958_0075000 3300045836 Bacteria 2074
552 Ga0466958_0075647 3300045836 Bacteria 2066
553 Ga0466967_0010537 3300045976 Bacteria 6942
554 Ga0466967_0038601 3300045976 Bacteria 4097
555 Ga0466967_0043750 3300045976 Bacteria 3879
556 Ga0466967_0047433 3300045976 Bacteria 3745
557 Ga0466967_0088839 3300045976 Bacteria 2805
558 Ga0466967_0090174 3300045976 Bacteria 2785
559 Ga0466967_0096159 3300045976 Bacteria 2701
560 Ga0495592_0057277 3300046454 Bacteria 2877
561 Ga0495629_0000899 3300046459 Bacteria 23864
562 Ga0495629_0051881 3300046459 Bacteria 2870
563 Ga0495638_0019649 3300046460 Bacteria 4468
564 Ga0495641_0027036 3300046461 Bacteria 2794
565 Ga0495641_0040289 3300046461 Bacteria 2173
566 Ga0495651_0004912 3300046462 Bacteria 10227
567 Ga0495651_0070075 3300046462 Bacteria 2669
568 Ga0495653_0049986 3300046463 Bacteria 3217
569 Ga0495662_0040659 3300046476 Bacteria 2245
570 Ga0495664_0041217 3300046477 Bacteria 2731
571 Ga0495594_0000012 3300046499 Bacteria 105133
572 Ga0495608_0016334 3300046511 Bacteria 5136
573 Ga0495620_0036222 3300046515 Bacteria 2209
574 Ga0495630_0001450 3300046517 Bacteria 16430
575 Ga0495630_0089710 3300046517 Bacteria 2322
576 Ga0495637_0043437 3300046520 Bacteria 1918
577 Ga0495652_0032691 3300046529 Bacteria 4547
578 Ga0495665_0041579 3300046531 Bacteria 2447
579 Ga0495622_0000076 3300046557 Bacteria 86777
580 Ga0495667_0001386 3300046559 Bacteria 15954
581 Ga0495668_0099388 3300046616 Bacteria 1592
582 Ga0495611_0028032 3300046648 Bacteria 2466
583 Ga0495635_0035246 3300046663 Bacteria 3470
584 Ga0495661_0081058 3300046665 Bacteria 1871
585 Ga0495588_0000247 3300046674 Bacteria 45295
586 Ga0495657_0099895 3300046675 Bacteria 1850
587 Ga0495599_0032632 3300046678 Bacteria 3269
588 Ga0495647_0000307 3300046681 Bacteria 13755
589 Ga0495647_0040683 3300046681 Bacteria 1767
590 Ga0495613_0000132 3300046689 Bacteria 74233
591 Ga0495624_0000196 3300046690 Bacteria 46319
592 Ga0495624_0041006 3300046690 Bacteria 2963
593 Ga0495671_0054600 3300046692 Bacteria 1980
594 Ga0495649_0090744 3300046694 Bacteria 1629
595 Ga0495589_0059270 3300046794 Bacteria 1882
596 Ga0495600_0010574 3300046809 Bacteria 5730
597 Ga0495581_0078165 3300047315 Bacteria 1915
598 Ga0495604_0000448 3300047317 Bacteria 36537
599 Ga0495672_0008631 3300047320 Bacteria 7495
600 Ga0495676_0045128 3300047321 Bacteria 3590
601 Ga0495680_0012579 3300047322 Bacteria 7437
602 Ga0495680_0079033 3300047322 Bacteria 2488
603 Ga0495680_0165455 3300047322 Bacteria 1604
604 Ga0495675_0109406 3300047444 Bacteria 1726
605 Ga0495677_0019440 3300047445 Bacteria 2463
606 Ga0495673_0016778 3300047469 Bacteria 3734
607 Ga0495684_0107659 3300047471 Bacteria 2105
608 Ga0495686_0085374 3300047472 Bacteria 1922
609 Ga0495593_0053739 3300047673 Bacteria 2125
610 Ga0495602_0034328 3300048088 Bacteria 4747
611 Ga0495626_0044170 3300048091 Bacteria 2087
612 Ga0496100_0000115 3300048903 Bacteria 45942
613 Ga0496100_0000248 3300048903 Bacteria 28219
614 Ga0496100_0002933 3300048903 Bacteria 8767
615 Ga0496100_0016650 3300048903 Bacteria 4322
616 Ga0496100_0041825 3300048903 Bacteria 2924
617 Ga0496100_0073614 3300048903 Bacteria 2287
618 Ga0496101_0000031 3300048904 Bacteria 195195
619 Ga0496101_0000262 3300048904 Bacteria 37343
620 Ga0496101_0001407 3300048904 Bacteria 14398
621 Ga0496101_0010040 3300048904 Bacteria 6238
622 Ga0496101_0012992 3300048904 Bacteria 5570
623 Ga0496101_0027119 3300048904 Bacteria 3986
624 Ga0496101_0044251 3300048904 Bacteria 3185
625 Ga0496102_0000011 3300048905 Bacteria 321716
626 Ga0496102_0000129 3300048905 Bacteria 104478
627 Ga0496102_0000427 3300048905 Bacteria 48669
628 Ga0496102_0000473 3300048905 Bacteria 44556
629 Ga0496102_0002046 3300048905 Bacteria 17412
630 Ga0496102_0002055 3300048905 Bacteria 17349
631 Ga0496102_0006363 3300048905 Bacteria 10069
632 Ga0496102_0011131 3300048905 Bacteria 7747
633 Ga0496102_0011180 3300048905 Bacteria 7730
634 Ga0496102_0051271 3300048905 Bacteria 3759
635 Ga0496102_0073611 3300048905 Bacteria 3139
636 Ga0496102_0096456 3300048905 Bacteria 2741
637 Ga0496102_0101390 3300048905 Bacteria 2674
638 Ga0496102_0174137 3300048905 Bacteria 2026
639 Ga0496102_0236043 3300048905 Bacteria 1724
640 Ga0496103_0000087 3300048906 Bacteria 104566
641 Ga0496103_0000124 3300048906 Bacteria 83703
642 Ga0496103_0000228 3300048906 Bacteria 54634
643 Ga0496103_0000577 3300048906 Bacteria 28994
644 Ga0496103_0000826 3300048906 Bacteria 22737
645 Ga0496103_0004385 3300048906 Bacteria 8563
646 Ga0496103_0009160 3300048906 Bacteria 5862
647 Ga0496103_0013663 3300048906 Bacteria 4817
648 Ga0496103_0020956 3300048906 Bacteria 3930
649 Ga0496103_0063027 3300048906 Bacteria 2308
650 Ga0496103_0074754 3300048906 Bacteria 2124
651 Ga0496104_0000004 3300048907 Bacteria 641830
652 Ga0496104_0001982 3300048907 Bacteria 17745
653 Ga0496104_0004190 3300048907 Bacteria 12525
654 Ga0496104_0012997 3300048907 Bacteria 7494
655 Ga0496104_0017430 3300048907 Bacteria 6539
656 Ga0496104_0047233 3300048907 Bacteria 4058
657 Ga0496104_0058256 3300048907 Bacteria 3656
658 Ga0496104_0199897 3300048907 Bacteria 1911
659 Ga0496105_0000001 3300048908 Bacteria 1328178
660 Ga0496105_0004544 3300048908 Bacteria 10454
661 Ga0496105_0004639 3300048908 Bacteria 10358
662 Ga0496105_0011165 3300048908 Bacteria 7085
663 Ga0496105_0029867 3300048908 Bacteria 4463
664 Ga0496105_0071975 3300048908 Bacteria 2857
665 Ga0496105_0087370 3300048908 Bacteria 2576
666 Ga0496106_0003914 3300048909 Bacteria 11116
667 Ga0496106_0008140 3300048909 Bacteria 7744
668 Ga0496106_0008855 3300048909 Bacteria 7439
669 Ga0496106_0056607 3300048909 Bacteria 2964
670 Ga0496106_0132073 3300048909 Bacteria 1959
671 Ga0496107_0006162 3300048910 Bacteria 8238
672 Ga0496107_0033034 3300048910 Bacteria 3701
673 Ga0496107_0056099 3300048910 Bacteria 2846
674 Ga0496107_0079709 3300048910 Bacteria 2387
675 Ga0496107_0082343 3300048910 Bacteria 2347
676 Ga0496107_0092966 3300048910 Bacteria 2205
677 Ga0496108_0000005 3300048911 Bacteria 535059
678 Ga0496108_0002448 3300048911 Bacteria 14844
679 Ga0496108_0002714 3300048911 Bacteria 14144
680 Ga0496108_0013790 3300048911 Bacteria 6592
681 Ga0496108_0015909 3300048911 Bacteria 6132
682 Ga0496108_0176697 3300048911 Bacteria 1848
683 Ga0496109_0000002 3300048912 Bacteria 443393
684 Ga0496109_0000882 3300048912 Bacteria 25056
685 Ga0496109_0002062 3300048912 Bacteria 16675
686 Ga0496109_0029930 3300048912 Bacteria 4880
687 Ga0496109_0041287 3300048912 Bacteria 4179
688 Ga0496109_0042404 3300048912 Bacteria 4121
689 Ga0496109_0061436 3300048912 Bacteria 3435
690 Ga0496109_0095485 3300048912 Bacteria 2753
691 Ga0496109_0153541 3300048912 Bacteria 2156
692 Ga0496109_0160547 3300048912 Bacteria 2106
693 Ga0496110_0000185 3300048913 Bacteria 39094
694 Ga0496110_0000649 3300048913 Bacteria 23779
695 Ga0496110_0022898 3300048913 Bacteria 5309
696 Ga0496110_0041812 3300048913 Bacteria 4001
697 Ga0496110_0046947 3300048913 Bacteria 3779
698 Ga0496111_0000119 3300048914 Bacteria 34223
699 Ga0496111_0002441 3300048914 Bacteria 11230
700 Ga0496111_0024253 3300048914 Bacteria 4268
701 Ga0496111_0086151 3300048914 Bacteria 2298
702 Ga0496112_0001010 3300048915 Bacteria 20632
703 Ga0496112_0002266 3300048915 Bacteria 15385
704 Ga0496112_0016420 3300048915 Bacteria 6935
705 Ga0496112_0032910 3300048915 Bacteria 5035
706 Ga0496112_0057285 3300048915 Bacteria 3836
707 Ga0496112_0086219 3300048915 Bacteria 3107
708 Ga0496113_0000017 3300048916 Bacteria 74327
709 Ga0496114_0000153 3300048917 Bacteria 50028
710 Ga0496114_0000178 3300048917 Bacteria 45143
711 Ga0496114_0004178 3300048917 Bacteria 11181
712 Ga0496114_0008010 3300048917 Bacteria 8360
713 Ga0496114_0015102 3300048917 Bacteria 6209
714 Ga0496114_0018264 3300048917 Bacteria 5668
715 Ga0496114_0028182 3300048917 Bacteria 4606
716 Ga0496114_0049855 3300048917 Bacteria 3484
717 Ga0496114_0065222 3300048917 Bacteria 3051
718 Ga0496114_0074918 3300048917 Bacteria 2850
719 Ga0496114_0131567 3300048917 Bacteria 2161
720 Ga0496114_0146011 3300048917 Bacteria 2050
721 Ga0496115_0004346 3300048918 Bacteria 10254
722 Ga0496115_0061463 3300048918 Bacteria 3028
723 Ga0496115_0093219 3300048918 Bacteria 2462
724 Ga0496116_0000297 3300048919 Bacteria 83713
725 Ga0496116_0005593 3300048919 Bacteria 11581
726 Ga0496116_0076529 3300048919 Bacteria 2095
727 Ga0496117_0000039 3300048920 Bacteria 322143
728 Ga0496117_0001007 3300048920 Bacteria 43130
729 Ga0496118_0000035 3300048921 Bacteria 322143
730 Ga0496118_0000857 3300048921 Bacteria 48262
731 Ga0496118_0001227 3300048921 Bacteria 39393
732 Ga0496118_0001272 3300048921 Bacteria 38676
733 Ga0496119_0000286 3300048922 Bacteria 70906
734 Ga0496119_0001211 3300048922 Bacteria 32228
735 Ga0496119_0006092 3300048922 Bacteria 11298
736 Ga0496119_0013479 3300048922 Bacteria 6505
737 Ga0496120_0001566 3300048923 Bacteria 26762
738 Ga0496120_0032496 3300048923 Bacteria 3146
739 Ga0496121_0000014 3300048924 Bacteria 609379
740 Ga0496121_0000425 3300048924 Bacteria 82887
741 Ga0496121_0001945 3300048924 Bacteria 32921
742 Ga0496121_0033354 3300048924 Bacteria 4660
743 Ga0496122_0000132 3300048925 Bacteria 172228
744 Ga0496122_0021059 3300048925 Bacteria 5856
745 Ga0496123_0006535 3300048926 Bacteria 11261
746 Ga0496123_0009503 3300048926 Bacteria 8750
747 Ga0496123_0031449 3300048926 Bacteria 3861
748 Ga0496124_0000106 3300048927 Bacteria 172511
749 Ga0496124_0049234 3300048927 Bacteria 3595
750 Ga0496124_0119605 3300048927 Bacteria 2107
751 Ga0496125_0000014 3300048928 Bacteria 610124
752 Ga0496125_0005528 3300048928 Bacteria 13995
753 Ga0496126_0000017 3300048929 Bacteria 610676
754 Ga0496126_0000666 3300048929 Bacteria 63592
755 Ga0496126_0002345 3300048929 Bacteria 25883
756 Ga0496126_0002811 3300048929 Bacteria 22838
757 Ga0496126_0030074 3300048929 Bacteria 5152
758 Ga0496126_0127491 3300048929 Bacteria 2202
759 Ga0496126_0132159 3300048929 Bacteria 2156
760 Ga0501031_0000115 3300049568 Bacteria 43139
761 Ga0501031_0000689 3300049568 Bacteria 20159
762 Ga0501032_0000052 3300049569 Bacteria 101001
763 Ga0501032_0003025 3300049569 Bacteria 13037
764 Ga0501033_0003226 3300049570 Bacteria 13490
765 Ga0501033_0081573 3300049570 Bacteria 2372
766 Ga0501034_0003913 3300049571 Bacteria 16733
767 Ga0501034_0007479 3300049571 Bacteria 11623
768 Ga0501034_0007562 3300049571 Bacteria 11562
769 Ga0501034_0009939 3300049571 Bacteria 9944
770 Ga0501034_0018093 3300049571 Bacteria 7231
771 Ga0501034_0042719 3300049571 Bacteria 4589
772 Ga0501034_0077054 3300049571 Bacteria 3340
773 Ga0501036_0000061 3300049572 Bacteria 71856
774 Ga0501036_0007304 3300049572 Bacteria 9001
775 Ga0501036_0007724 3300049572 Bacteria 8787
776 Ga0501037_0000046 3300049573 Bacteria 116524
777 Ga0501037_0000759 3300049573 Bacteria 24321
778 Ga0501037_0009351 3300049573 Bacteria 7195
779 Ga0501037_0032693 3300049573 Bacteria 3843
780 Ga0501038_0000068 3300049574 Bacteria 84886
781 Ga0501038_0001047 3300049574 Bacteria 24924
782 Ga0501038_0037505 3300049574 Bacteria 4249
783 Ga0501039_0000292 3300049575 Bacteria 35532
784 Ga0501039_0007114 3300049575 Bacteria 8525
785 Ga0501039_0015833 3300049575 Bacteria 5774
786 Ga0501039_0017339 3300049575 Bacteria 5525
787 Ga0501039_0089429 3300049575 Bacteria 2400
788 Ga0501039_0125632 3300049575 Bacteria 2012
789 Ga0501041_0018231 3300049577 Bacteria 4180
790 Ga0501041_0089571 3300049577 Bacteria 1899
791 Ga0501042_0083451 3300049578 Bacteria 2291
792 Ga0501043_0000340 3300049579 Bacteria 42317
793 Ga0501043_0006218 3300049579 Bacteria 9591
794 Ga0501043_0012119 3300049579 Bacteria 6741
795 Ga0501043_0019541 3300049579 Bacteria 5317
796 Ga0501043_0119895 3300049579 Bacteria 2063
797 Ga0501046_0000102 3300049580 Bacteria 89938
798 Ga0501046_0000695 3300049580 Bacteria 32596
799 Ga0501046_0013449 3300049580 Bacteria 6928
800 Ga0501047_0001039 3300049581 Bacteria 27771
801 Ga0501047_0005250 3300049581 Bacteria 12168
802 Ga0501047_0006620 3300049581 Bacteria 10899
803 Ga0501048_0000006 3300049582 Bacteria 93252
804 Ga0501048_0001635 3300049582 Bacteria 17071
805 Ga0501048_0086500 3300049582 Bacteria 2211
806 Ga0501067_0001571 3300049583 Bacteria 12490
807 Ga0501067_0008217 3300049583 Bacteria 5795
808 Ga0501068_0014755 3300049584 Bacteria 4471
809 Ga0501068_0021950 3300049584 Bacteria 3731
810 Ga0501069_0005606 3300049585 Bacteria 6529
811 Ga0501069_0052816 3300049585 Bacteria 2264
812 Ga0501070_0000139 3300049586 Bacteria 65962
813 Ga0501070_0001449 3300049586 Bacteria 21219
814 Ga0501071_0028813 3300049587 Bacteria 3915
815 Ga0501071_0048989 3300049587 Bacteria 3040
816 Ga0501072_0001960 3300049588 Bacteria 15333
817 Ga0501072_0005664 3300049588 Bacteria 9511
818 Ga0501074_0000256 3300049590 Bacteria 30065
819 Ga0501074_0007580 3300049590 Bacteria 7853
820 Ga0501075_0013424 3300049591 Bacteria 5844
821 Ga0501076_0001319 3300049592 Bacteria 16559
822 Ga0501076_0124969 3300049592 Bacteria 2084
823 Ga0501077_0002277 3300049593 Bacteria 11562
824 Ga0501079_0003278 3300049741 Bacteria 11859
825 Ga0501080_0000051 3300049742 Bacteria 75804
826 Ga0501081_0007069 3300049743 Bacteria 7297
827 Ga0501081_0009280 3300049743 Bacteria 6408
828 Ga0501083_0002108 3300049744 Bacteria 13653
829 Ga0501035_0000321 3300049822 Bacteria 55455
830 Ga0501035_0021506 3300049822 Bacteria 5930
831 Ga0501035_0137976 3300049822 Bacteria 2122
832 Ga0501044_0000137 3300049823 Bacteria 89352
833 Ga0501044_0014259 3300049823 Bacteria 8582
834 Ga0501044_0093370 3300049823 Bacteria 3034
835 Ga0501044_0098533 3300049823 Bacteria 2943
836 Ga0501045_0000759 3300049824 Bacteria 20665
837 Ga0501045_0004172 3300049824 Bacteria 9983
838 nmdc:mga03n38_2544_c1 3300050490 Bacteria 5659
839 nmdc:mga03n38_2774_c1 3300050490 Bacteria 5501
840 nmdc:mga03n38_43742_c1 3300050490 Bacteria 1964
841 nmdc:mga00v17_1112_c1 3300050491 Bacteria 14123
842 nmdc:mga00v17_1395_c1 3300050491 Bacteria 11472
843 nmdc:mga00v17_18036_c1 3300050491 Bacteria 4006
844 nmdc:mga00v17_21287_c1 3300050491 Bacteria 3726
845 nmdc:mga00v17_26340_c1 3300050491 Bacteria 3387
846 nmdc:mga00v17_55615_c1 3300050491 Bacteria 2417
847 nmdc:mga0yw44_17378_c1 3300050492 Bacteria 3913
848 nmdc:mga0yw44_1762_c1 3300050492 Bacteria 8818
849 nmdc:mga0yw44_3292_c1 3300050492 Bacteria 7141
850 nmdc:mga0yw44_34620_c1 3300050492 Bacteria 2960
851 nmdc:mga0yw44_4326_c1 3300050492 Bacteria 6486
852 nmdc:mga0yw44_4737_c1 3300050492 Bacteria 6300
853 nmdc:mga06z11_10749_c1 3300050494 Bacteria 3915
854 nmdc:mga04h51_21315_c1 3300050495 Bacteria 1948
855 nmdc:mga07m45_23424_c1 3300050496 Bacteria 3375
856 nmdc:mga07m45_41212_c1 3300050496 Bacteria 2585
857 nmdc:mga07m45_6183_c1 3300050496 Bacteria 6039
858 nmdc:mga07m45_8326_c1 3300050496 Bacteria 5326
859 nmdc:mga05p37_22514_c1 3300050507 Bacteria 7642
860 nmdc:mga05p37_60697_c1 3300050507 Bacteria 4655
861 nmdc:mga09592_105574_c1 3300050508 Bacteria 2415
862 nmdc:mga06r32_166033_c1 3300050510 Bacteria 2190
863 nmdc:mga06r32_181758_c1 3300050510 Bacteria 2089
864 nmdc:mga06r32_25842_c1 3300050510 Bacteria 5466
865 nmdc:mga06r32_36408_c1 3300050510 Bacteria 4649
866 nmdc:mga06r32_6628_c1 3300050510 Bacteria 10407
867 nmdc:mga08y16_101120_c1 3300050511 Bacteria 3001
868 nmdc:mga08y16_132329_c1 3300050511 Bacteria 2593
869 nmdc:mga08y16_6449_c1 3300050511 Bacteria 12306
870 nmdc:mga08y16_7008_c1 3300050511 Bacteria 11820
871 nmdc:mga08y16_80980_c1 3300050511 Bacteria 3386
872 nmdc:mga0n895_70602_c1 3300050512 Bacteria 3462
873 nmdc:mga0n895_74334_c1 3300050512 Bacteria 3376
874 nmdc:mga0n895_8375_c1 3300050512 Bacteria 8950
875 nmdc:mga0rr50_1370_c1 3300050513 Bacteria 13349
876 nmdc:mga0rr50_42753_c1 3300050513 Bacteria 3311
877 nmdc:mga08x19_1536_c1 3300050514 Bacteria 14321
878 nmdc:mga08x19_51315_c1 3300050514 Bacteria 2649
879 nmdc:mga0a205_34993_c1 3300050515 Bacteria 4823
880 nmdc:mga0a205_783_c2 3300050515 Bacteria 17242
881 nmdc:mga0sz30_1720_c1 3300050516 Bacteria 7765
882 nmdc:mga0sz30_31391_c1 3300050516 Bacteria 2198
883 nmdc:mga0sz30_9291_c1 3300050516 Bacteria 3167
884 Ga0495601_0000029 3300053077 Bacteria 111437
885 Ga0500610_0001987 3300053079 Bacteria 7296
886 Ga0495655_0000010 3300053083 Bacteria 125615
887 Ga0500641_0000526 3300053096 Bacteria 13777
888 Ga0500641_0004436 3300053096 Bacteria 4963
889 Ga0500562_001179 3300053108 Bacteria 6445
890 Ga0500628_000024 3300053129 Bacteria 64538
891 Ga0500568_0000039 3300053139 Bacteria 134018
892 Ga0500616_0000535 3300053153 Bacteria 47523
893 Ga0500616_0002876 3300053153 Bacteria 13812
894 Ga0500616_0007902 3300053153 Bacteria 6684
895 Ga0500616_0038579 3300053153 Bacteria 2580
896 Ga0500645_000063 3300053730 Bacteria 85018
897 Ga0501084_0001328 3300054114 Bacteria 19507
898 Ga0501084_0116680 3300054114 Bacteria 2244
899 Ga0501082_0003048 3300060353 Bacteria 14621
900 Ga0501082_0065353 3300060353 Bacteria 3133
901 Ga0466962_0014986 3300061719 Bacteria 3736
902 2643851843 2643221567 Bacteria 4163945
903 2644137568 2643221624 Bacteria 4384879
904 2644456039 2643221681 Bacteria 3707866
905 2644491205 2643221687 Bacteria 6500351
906 2644538700 2643221697 Bacteria 3575694
907 2644609989 2643221711 Bacteria 4865335
908 2644636617 2643221715 Bacteria 6671032
909 2645720701 2643221961 Bacteria 3919167
910 2645723719 2643221962 Bacteria 3874254
911 2731909430 2731639228 Bacteria 4187555
912 2738666841 2738541264 Bacteria 5935393
913 2739145685 2738541356 Bacteria 5935017
914 2774395152 2773857762 Bacteria 5971770
915 2799186767 2799112218 Bacteria 4315149
916 2809194013 2808606439 Bacteria 5952208
917 2812348750 2811994878 Bacteria 5992952
918 2816427141 2816332119 Bacteria 8120218
919 2852643855 2852643534 Bacteria 3013378
920 2870782933 2870782633 Bacteria 9624083
921 2883825819 2883821847 Bacteria 5121194
922 2891973486 2891968417 Bacteria 5821697
923 2902797317 2902792274 Bacteria 7270173
924 2902814579 2902810491 Bacteria 6794147
925 2902843024 2902837492 Bacteria 6697721
926 2904769979 2904765812 Bacteria 5369154
927 2904771171 2904770941 Bacteria 5580202
928 2908815215 2908811453 Bacteria 5478616
929 2919423334 2919420072 Bacteria 5390363
930 2919435942 2919432681 Bacteria 5390474
931 2919448712 2919446982 Bacteria 3994487
932 2929218388 2929212328 Bacteria 7708288
933 2939585034 2939582691 Bacteria 7088898
934 2966923363 2966921586 Bacteria 3092803
935 2974318556 2974315732 Bacteria 4602776
936 2984526767 2984523437 Bacteria 4508481
937 2984578042 2984576629 Bacteria 4248407
938 2984593939 2984592036 Bacteria 3670284
939 2990257556 2990256926 Bacteria 4252839
940 Ga0068860_100049579
941 JGI24741J21665_1004231
942 JGI24740J21852_10012686
943 JGI24739J22299_10007492
944 JGI24737J22298_10014225
945 JGI24735J21928_10014328
946 JGI24750J21931_1003282
947 JGI24745J21846_1001386
948 JGI24744J21845_10002686
949 JGI24033J26618_1000922
950 JGI24751J29686_10002325
951 JGI24751J29686_10006759
952 JGI25406J46586_10005948
953 JGI25407J50210_10000047
954 JGI25407J50210_10011902
955 Ga0055540_1000065
956 Ga0055540_1001113
957 Ga0055540_1001796
958 Ga0055540_1003135
959 Ga0070658_10077740
960 Ga0070658_10093759
961 Ga0070676_10008718
962 Ga0070683_100000527
963 Ga0070683_100079610
964 Ga0070683_100207572
965 Ga0070690_100021595
966 Ga0070670_100105668
967 Ga0068869_100014020
968 Ga0070666_10055053
969 Ga0070682_100001211
970 Ga0070682_100006610
971 Ga0070682_100090917
972 Ga0068868_100019969
973 Ga0068868_100048728
974 Ga0068868_100177504
975 Ga0070689_100016786
976 Ga0070661_100000110
977 Ga0070661_100013458
978 Ga0070661_100071708
979 Ga0070661_100129182
980 Ga0070692_10012228
981 Ga0070668_100001430
982 Ga0070668_100002698
983 Ga0070668_100007667
984 Ga0070668_100028160
985 Ga0070668_100028625
986 Ga0070668_100045992
987 Ga0070668_100063880
988 Ga0070668_100106218
989 Ga0070669_100016048
990 Ga0070671_100002337
991 Ga0070674_100000153
992 Ga0070688_100000053
993 Ga0070659_100000013
994 Ga0070659_100016187
995 Ga0070667_100000840
996 Ga0070667_100008468
997 Ga0070667_100028629
998 Ga0070667_100053878
999 Ga0070714_100011637
1000 Ga0070714_100149830
1001 Ga0070713_100133350
1002 Ga0070710_10001412
1003 Ga0070710_10012538
1004 Ga0070701_10022358
1005 Ga0070711_100000205
1006 Ga0070711_100010610
1007 Ga0070705_100018204
1008 Ga0070694_100048154
1009 Ga0070663_100031238
1010 Ga0070663_100083040
1011 Ga0070678_100004645
1012 Ga0070678_100021506
1013 Ga0070662_100020708
1014 Ga0070662_100096833
1015 Ga0070662_100124614
1016 Ga0070681_10043343
1017 Ga0068867_100006760
1018 Ga0068867_100026849
1019 Ga0068867_100156717
1020 Ga0070685_10000086
1021 Ga0070685_10014773
1022 Ga0070685_10033305
1023 Ga0070707_100165503
1024 Ga0070679_100002668
1025 Ga0068853_100033816
1026 Ga0068853_100071658
1027 Ga0068853_100149071
1028 Ga0070686_100048679
1029 Ga0070696_100034595
1030 Ga0070696_100166725
1031 Ga0070693_100019527
1032 Ga0070665_100004960
1033 Ga0070665_100032045
1034 Ga0070665_100043787
1035 Ga0070665_100075978
1036 Ga0070704_100000289
1037 Ga0070704_100064102
1038 Ga0068857_100084732
1039 Ga0068854_100025337
1040 Ga0068856_100001228
1041 Ga0070702_100029922
1042 Ga0070702_100031581
1043 Ga0068852_100059236
1044 Ga0068859_100002544
1045 Ga0068859_100023558
1046 Ga0068859_100107717
1047 Ga0068866_10001088
1048 Ga0068861_100002774
1049 Ga0068863_100000373
1050 Ga0068863_100024127
1051 Ga0068863_100093058
1052 Ga0068858_100003979
1053 Ga0068858_100046913
1054 Ga0068858_100058513
1055 Ga0068860_100000011
1056 Ga0068860_100033567
1057 Ga0068860_100107761
1058 Ga0068862_100000139
1059 Ga0068862_100000366
1060 Ga0068862_100005265
1061 Ga0068862_100021554
1062 Ga0068862_100129428
1063 Ga0081455_10000106
1064 Ga0081455_10002738
1065 Ga0081455_10027460
1066 Ga0081455_10037772
1067 Ga0081455_10084826
1068 Ga0081538_10000763
1069 Ga0081538_10000973
1070 Ga0081540_1000046
1071 Ga0081540_1011454
1072 Ga0081540_1013115
1073 Ga0081539_10000236
1074 Ga0081539_10001074
1075 Ga0081539_10001710
1076 Ga0081539_10004566
1077 Ga0081539_10010378
1078 Ga0070717_10000059
1079 Ga0070717_10118149
1080 Ga0075365_10000193
1081 Ga0075365_10000898
1082 Ga0075365_10009502
1083 Ga0075363_100000427
1084 Ga0075363_100002846
1085 Ga0075363_100016916
1086 Ga0075363_100040584
1087 Ga0075364_10000577
1088 Ga0075364_10000892
1089 Ga0075364_10001241
1090 Ga0075364_10003280
1091 Ga0075364_10052920
1092 Ga0075364_10062082
1093 Ga0075364_10105557
1094 Ga0075432_10000398
1095 Ga0070716_100019063
1096 Ga0070716_100025057
1097 Ga0070712_100021922
1098 Ga0075367_10016382
1099 Ga0075369_10002193
1100 Ga0075369_10011109
1101 Ga0075369_10014500
1102 Ga0075369_10046765
1103 Ga0075370_10007355
1104 Ga0075370_10009536
1105 Ga0075370_10038551
1106 Ga0075428_100016930
1107 Ga0075428_100020281
1108 Ga0075431_100012901
1109 Ga0075431_100019604
1110 Ga0075431_100034685
1111 Ga0075433_10001708
1112 Ga0075433_10070863
1113 Ga0075434_100004328
1114 Ga0075434_100004603
1115 Ga0075434_100019309
1116 Ga0075429_100003236
1117 Ga0068865_100014483
1118 Ga0068865_100049452
1119 Ga0068865_100103041
1120 Ga0075436_100002186
1121 Ga0075436_100059928
1122 Ga0097620_100002544
1123 Ga0097620_100023557
1124 Ga0097620_100107709
1125 Ga0075435_100000562
1126 Ga0075435_100061086
1127 Ga0105251_10053118
1128 Ga0111539_10001351
1129 Ga0111539_10010304
1130 Ga0111539_10017096
1131 Ga0111539_10072393
1132 Ga0105245_10004802
1133 Ga0105245_10015520
1134 Ga0105245_10018530
1135 Ga0105245_10027146
1136 Ga0105245_10072901
1137 Ga0105245_10093030
1138 Ga0105247_10000067
1139 Ga0114129_10018395
1140 Ga0114129_10085188
1141 Ga0105243_10003878
1142 Ga0105243_10027691
1143 Ga0105243_10029456
1144 Ga0105243_10049144
1145 Ga0105241_10015475
1146 Ga0105242_10000052
1147 Ga0105242_10003061
1148 Ga0105248_10000040
1149 Ga0105248_10007307
1150 Ga0105248_10046307
1151 Ga0105248_10174132
1152 Ga0105248_10256461
1153 Ga0105237_10016854
1154 Ga0105237_10051342
1155 Ga0105237_10137143
1156 Ga0105237_10164528
1157 Ga0105237_10264593
1158 Ga0105238_10192262
1159 Ga0105249_10000001
1160 Ga0105249_10000916
1161 Ga0105249_10013603
1162 Ga0105249_10020446
1163 Ga0105239_10033519
1164 Ga0105239_10046182
1165 Ga0105239_10090887
1166 Ga0105239_10108668
1167 Ga0105246_10051975
1168 Ga0105246_10072007
1169 Ga0105246_10082776
1170 Ga0157371_10002739
1171 Ga0157369_10106863
1172 Ga0157374_10033593
1173 Ga0157374_10228830
1174 Ga0157374_10233194
1175 Ga0157378_10012869
1176 Ga0157378_10104429
1177 Ga0163162_10009929
1178 Ga0163162_10029767
1179 Ga0163162_10072586
1180 Ga0163162_10074024
1181 Ga0163162_10079151
1182 Ga0163162_10097729
1183 Ga0163162_10134826
1184 Ga0163162_10348824
1185 Ga0157372_10000284
1186 Ga0157372_10005924
1187 Ga0157372_10064155
1188 Ga0157372_10168658
1189 Ga0157375_10000945
1190 Ga0157375_10005034
1191 Ga0157375_10072195
1192 Ga0157380_10000186
1193 Ga0157380_10003827
1194 Ga0157380_10074409
1195 Ga0157377_10080449
1196 Ga0157379_10025482
1197 Ga0157376_10055880
1198 Ga0163161_10005342
1199 Ga0206353_10643868
1200 Ga0213876_10001770
1201 Ga0213876_10015187
1202 Ga0213875_10007089
1203 Ga0209673_1008850
1204 Ga0209051_1000042
1205 Ga0209051_1001272
1206 Ga0209051_1003310
1207 Ga0209051_1003693
1208 Ga0207692_10016442
1209 Ga0207692_10017629
1210 Ga0207642_10000670
1211 Ga0207642_10013194
1212 Ga0207710_10000094
1213 Ga0207688_10001311
1214 Ga0207688_10001662
1215 Ga0207688_10009551
1216 Ga0207688_10015696
1217 Ga0207688_10060428
1218 Ga0207680_10004733
1219 Ga0207680_10046470
1220 Ga0207647_10016099
1221 Ga0207647_10023770
1222 Ga0207647_10027662
1223 Ga0207647_10053948
1224 Ga0207699_10006259
1225 Ga0207645_10058212
1226 Ga0207643_10023963
1227 Ga0207705_10025934
1228 Ga0207705_10040140
1229 Ga0207707_10031607
1230 Ga0207671_10009287
1231 Ga0207671_10077218
1232 Ga0207671_10087953
1233 Ga0207693_10003676
1234 Ga0207693_10012194
1235 Ga0207693_10019923
1236 Ga0207693_10043212
1237 Ga0207663_10007388
1238 Ga0207663_10054819
1239 Ga0207662_10005997
1240 Ga0207657_10023952
1241 Ga0207657_10138233
1242 Ga0207649_10000015
1243 Ga0207649_10006432
1244 Ga0207652_10009781
1245 Ga0207652_10157724
1246 Ga0207681_10002134
1247 Ga0207659_10000707
1248 Ga0207687_10002110
1249 Ga0207687_10007569
1250 Ga0207687_10024556
1251 Ga0207687_10026230
1252 Ga0207687_10119107
1253 Ga0207700_10000003
1254 Ga0207664_10008731
1255 Ga0207644_10083867
1256 Ga0207690_10000075
1257 Ga0207690_10006804
1258 Ga0207690_10032483
1259 Ga0207706_10012125
1260 Ga0207706_10017268
1261 Ga0207706_10117753
1262 Ga0207686_10000119
1263 Ga0207686_10034284
1264 Ga0207709_10013184
1265 Ga0207709_10036710
1266 Ga0207669_10030356
1267 Ga0207669_10070907
1268 Ga0207704_10008206
1269 Ga0207704_10024642
1270 Ga0207704_10025069
1271 Ga0207665_10009146
1272 Ga0207711_10000011
1273 Ga0207711_10000419
1274 Ga0207711_10007828
1275 Ga0207711_10015373
1276 Ga0207689_10006344
1277 Ga0207689_10010392
1278 Ga0207689_10028771
1279 Ga0207689_10043062
1280 Ga0207661_10000438
1281 Ga0207661_10001594
1282 Ga0207661_10179866
1283 Ga0207679_10006499
1284 Ga0207712_10000006
1285 Ga0207712_10000994
1286 Ga0207712_10027061
1287 Ga0207712_10043652
1288 Ga0207712_10082501
1289 Ga0207712_10088424
1290 Ga0207668_10000972
1291 Ga0207668_10004404
1292 Ga0207668_10069075
1293 Ga0207668_10119262
1294 Ga0207658_10000513
1295 Ga0207658_10001083
1296 Ga0207658_10004107
1297 Ga0207658_10011128
1298 Ga0207677_10017030
1299 Ga0207677_10068318
1300 Ga0207677_10083694
1301 Ga0207703_10008803
1302 Ga0207639_10042649
1303 Ga0207639_10042898
1304 Ga0207678_10018936
1305 Ga0207678_10036639
1306 Ga0207678_10042158
1307 Ga0207678_10058204
1308 Ga0207678_10181705
1309 Ga0207708_10009808
1310 Ga0207702_10000419
1311 Ga0207702_10100883
1312 Ga0207702_10111204
1313 Ga0207641_10000489
1314 Ga0207641_10022045
1315 Ga0207648_10006599
1316 Ga0207676_10003416
1317 Ga0207674_10029086
1318 Ga0207674_10036548
1319 Ga0207675_100000896
1320 Ga0207675_100002895
1321 Ga0207675_100018303
1322 Ga0207675_100055105
1323 Ga0207683_10003700
1324 Ga0207683_10012181
1325 Ga0207683_10097115
1326 Ga0207698_10000015
1327 Ga0207698_10096122
1328 Ga0207428_10001010
1329 Ga0207428_10011064
1330 Ga0207428_10036585
1331 Ga0207428_10108580
1332 Ga0207428_10113006
1333 Ga0268266_10000485
1334 Ga0268266_10001186
1335 Ga0268266_10016797
1336 Ga0268266_10031366
1337 Ga0268266_10121722
1338 Ga0268265_10000032
1339 Ga0268265_10003823
1340 Ga0268265_10039720
1341 Ga0268265_10128307
1342 Ga0268265_10186493
1343 Ga0268265_10219233
1344 Ga0268264_10000026
1345 Ga0268264_10081582
1346 Ga0268264_10287849
1347 Ga0265337_1000012
1348 Ga0265326_10000007
1349 Ga0265319_1001040
1350 Ga0265334_10000094
1351 Ga0265322_10000001
1352 Ga0265336_10004740
1353 Ga0265336_10008731
1354 Ga0265338_10003073
1355 Ga0265338_10039663
1356 Ga0265324_10001935
1357 Ga0265324_10011287
1358 Ga0265332_10009702
1359 Ga0265328_10000659
1360 Ga0265320_10000002
1361 Ga0265329_10002237
1362 Ga0265331_10000919
1363 Ga0265327_10000011
1364 Ga0265327_10000626
1365 Ga0265327_10017384
1366 Ga0265327_10067674
1367 Ga0307513_10004621
1368 Ga0307408_100009103
1369 Ga0316575_10000856
1370 Ga0316579_10000197
1371 Ga0265314_10000224
1372 Ga0265314_10087093
1373 Ga0316576_10000472
1374 Ga0316576_10071005
1375 Ga0316578_10002095
1376 Ga0316578_10029750
1377 Ga0307405_10012822
1378 Ga0307405_10021001
1379 Ga0307413_10003082
1380 Ga0307413_10008230
1381 Ga0307413_10013804
1382 Ga0307410_10048177
1383 Ga0326468_10000144
1384 Ga0307406_10000212
1385 Ga0307406_10003159
1386 Ga0307406_10008888
1387 Ga0307407_10011467
1388 Ga0307407_10023004
1389 Ga0307412_10020831
1390 Ga0307409_100000273
1391 Ga0307409_100039242
1392 Ga0307409_100069954
1393 Ga0307409_100114239
1394 Ga0307416_100024902
1395 Ga0307416_100100022
1396 Ga0307416_100333315
1397 Ga0307414_10043440
1398 Ga0307414_10060645
1399 Ga0307414_10065657
1400 Ga0307411_10030039
1401 Ga0307411_10066141
1402 Ga0307411_10089911
1403 Ga0307411_10116855
1404 Ga0307415_100002934
1405 Ga0307415_100014609
1406 Ga0307507_10116584
1407 Ga0373926_0018656
1408 Ga0373940_0015452
1409 Ga0373923_0025185
1410 Ga0373936_0038871
1411 Ga0373945_0034978
1412 Ga0373943_0019111
1413 Ga0373946_0027023
1414 Ga0373962_0012023
1415 Ga0316574_0021377
1416 Ga0316574_0050231
1417 Ga0316574_0059543
1418 Ga0373931_0011804
1419 Ga0373931_0049431
1420 Ga0373935_0012382
1421 Ga0373927_0058976
1422 Ga0373947_0025273
1423 Ga0373937_0012589
1424 Ga0316582_0000099
1425 Ga0316584_0011486
1426 Ga0316584_0017792
1427 Ga0316584_0032919
1428 Ga0373925_0114583
1429 Ga0395899_0031667
1430 Ga0395900_0008269
1431 Ga0395900_0113694
1432 Ga0395898_0005178
1433 Ga0395898_0006290
1434 Ga0395898_0011426
1435 Ga0395898_0048546
1436 Ga0395905_0004214
1437 Ga0395905_0041668
1438 Ga0395905_0053436
1439 Ga0395905_0123278
1440 Ga0436364_0908867
1441 Ga0436364_1011521
1442 Ga0436364_1192519
1443 Ga0436364_1442254
1444 Ga0395901_0003473
1445 Ga0395901_0012501
1446 Ga0395901_0045998
1447 Ga0395901_0074150
1448 Ga0395901_0170831
1449 Ga0242420_004140
1450 Ga0436365_0064899
1451 Ga0436365_0641890
1452 Ga0436365_1856170
1453 Ga0436362_1177671
1454 Ga0439466_0001181
1455 Ga0439466_0006248
1456 Ga0439466_0010202
1457 Ga0439465_0001503
1458 Ga0439465_0026450
1459 Ga0451833_0918545
1460 Ga0451837_0394872
1461 Ga0439450_001482
1462 Ga0439463_003079
1463 Ga0439459_0009821
1464 Ga0439464_0014935
1465 Ga0439440_0003643
1466 Ga0466972_0007601
1467 Ga0466972_0013868
1468 Ga0466965_0005448
1469 Ga0466966_0016384
1470 Ga0466966_0031501
1471 Ga0466966_0033360
1472 Ga0466961_0008896
1473 Ga0466961_0057918
1474 Ga0466963_0003743
1475 Ga0466968_0001398
1476 Ga0466970_0009706
1477 Ga0466970_0025734
1478 Ga0466970_0030982
1479 Ga0466970_0032132
1480 Ga0466957_0008957
1481 Ga0466957_0037436
1482 Ga0466957_0058481
1483 Ga0466960_0006440
1484 Ga0466960_0010724
1485 Ga0466960_0081961
1486 Ga0466959_0063426
1487 Ga0466959_0105976
1488 Ga0466958_0001373
1489 Ga0466958_0067657
1490 Ga0466958_0075000
1491 Ga0466958_0075647
1492 Ga0466967_0010537
1493 Ga0466967_0038601
1494 Ga0466967_0043750
1495 Ga0466967_0047433
1496 Ga0466967_0088839
1497 Ga0466967_0090174
1498 Ga0466967_0096159
1499 Ga0495592_0057277
1500 Ga0495629_0000899
1501 Ga0495629_0051881
1502 Ga0495638_0019649
1503 Ga0495641_0027036
1504 Ga0495641_0040289
1505 Ga0495651_0004912
1506 Ga0495651_0070075
1507 Ga0495653_0049986
1508 Ga0495662_0040659
1509 Ga0495664_0041217
1510 Ga0495594_0000012
1511 Ga0495608_0016334
1512 Ga0495620_0036222
1513 Ga0495630_0001450
1514 Ga0495630_0089710
1515 Ga0495637_0043437
1516 Ga0495652_0032691
1517 Ga0495665_0041579
1518 Ga0495622_0000076
1519 Ga0495667_0001386
1520 Ga0495668_0099388
1521 Ga0495611_0028032
1522 Ga0495635_0035246
1523 Ga0495661_0081058
1524 Ga0495588_0000247
1525 Ga0495657_0099895
1526 Ga0495599_0032632
1527 Ga0495647_0000307
1528 Ga0495647_0040683
1529 Ga0495613_0000132
1530 Ga0495624_0000196
1531 Ga0495624_0041006
1532 Ga0495671_0054600
1533 Ga0495649_0090744
1534 Ga0495589_0059270
1535 Ga0495600_0010574
1536 Ga0495581_0078165
1537 Ga0495604_0000448
1538 Ga0495672_0008631
1539 Ga0495676_0045128
1540 Ga0495680_0012579
1541 Ga0495680_0079033
1542 Ga0495680_0165455
1543 Ga0495675_0109406
1544 Ga0495677_0019440
1545 Ga0495673_0016778
1546 Ga0495684_0107659
1547 Ga0495686_0085374
1548 Ga0495593_0053739
1549 Ga0495602_0034328
1550 Ga0495626_0044170
1551 Ga0496100_0000115
1552 Ga0496100_0000248
1553 Ga0496100_0002933
1554 Ga0496100_0016650
1555 Ga0496100_0041825
1556 Ga0496100_0073614
1557 Ga0496101_0000031
1558 Ga0496101_0000262
1559 Ga0496101_0001407
1560 Ga0496101_0010040
1561 Ga0496101_0012992
1562 Ga0496101_0027119
1563 Ga0496101_0044251
1564 Ga0496102_0000011
1565 Ga0496102_0000129
1566 Ga0496102_0000427
1567 Ga0496102_0000473
1568 Ga0496102_0002046
1569 Ga0496102_0002055
1570 Ga0496102_0006363
1571 Ga0496102_0011131
1572 Ga0496102_0011180
1573 Ga0496102_0051271
1574 Ga0496102_0073611
1575 Ga0496102_0096456
1576 Ga0496102_0101390
1577 Ga0496102_0174137
1578 Ga0496102_0236043
1579 Ga0496103_0000087
1580 Ga0496103_0000124
1581 Ga0496103_0000228
1582 Ga0496103_0000577
1583 Ga0496103_0000826
1584 Ga0496103_0004385
1585 Ga0496103_0009160
1586 Ga0496103_0013663
1587 Ga0496103_0020956
1588 Ga0496103_0063027
1589 Ga0496103_0074754
1590 Ga0496104_0000004
1591 Ga0496104_0001982
1592 Ga0496104_0004190
1593 Ga0496104_0012997
1594 Ga0496104_0017430
1595 Ga0496104_0047233
1596 Ga0496104_0058256
1597 Ga0496104_0199897
1598 Ga0496105_0000001
1599 Ga0496105_0004544
1600 Ga0496105_0004639
1601 Ga0496105_0011165
1602 Ga0496105_0029867
1603 Ga0496105_0071975
1604 Ga0496105_0087370
1605 Ga0496106_0003914
1606 Ga0496106_0008140
1607 Ga0496106_0008855
1608 Ga0496106_0056607
1609 Ga0496106_0132073
1610 Ga0496107_0006162
1611 Ga0496107_0033034
1612 Ga0496107_0056099
1613 Ga0496107_0079709
1614 Ga0496107_0082343
1615 Ga0496107_0092966
1616 Ga0496108_0000005
1617 Ga0496108_0002448
1618 Ga0496108_0002714
1619 Ga0496108_0013790
1620 Ga0496108_0015909
1621 Ga0496108_0176697
1622 Ga0496109_0000002
1623 Ga0496109_0000882
1624 Ga0496109_0002062
1625 Ga0496109_0029930
1626 Ga0496109_0041287
1627 Ga0496109_0042404
1628 Ga0496109_0061436
1629 Ga0496109_0095485
1630 Ga0496109_0153541
1631 Ga0496109_0160547
1632 Ga0496110_0000185
1633 Ga0496110_0000649
1634 Ga0496110_0022898
1635 Ga0496110_0041812
1636 Ga0496110_0046947
1637 Ga0496111_0000119
1638 Ga0496111_0002441
1639 Ga0496111_0024253
1640 Ga0496111_0086151
1641 Ga0496112_0001010
1642 Ga0496112_0002266
1643 Ga0496112_0016420
1644 Ga0496112_0032910
1645 Ga0496112_0057285
1646 Ga0496112_0086219
1647 Ga0496113_0000017
1648 Ga0496114_0000153
1649 Ga0496114_0000178
1650 Ga0496114_0004178
1651 Ga0496114_0008010
1652 Ga0496114_0015102
1653 Ga0496114_0018264
1654 Ga0496114_0028182
1655 Ga0496114_0049855
1656 Ga0496114_0065222
1657 Ga0496114_0074918
1658 Ga0496114_0131567
1659 Ga0496114_0146011
1660 Ga0496115_0004346
1661 Ga0496115_0061463
1662 Ga0496115_0093219
1663 Ga0496116_0000297
1664 Ga0496116_0005593
1665 Ga0496116_0076529
1666 Ga0496117_0000039
1667 Ga0496117_0001007
1668 Ga0496118_0000035
1669 Ga0496118_0000857
1670 Ga0496118_0001227
1671 Ga0496118_0001272
1672 Ga0496119_0000286
1673 Ga0496119_0001211
1674 Ga0496119_0006092
1675 Ga0496119_0013479
1676 Ga0496120_0001566
1677 Ga0496120_0032496
1678 Ga0496121_0000014
1679 Ga0496121_0000425
1680 Ga0496121_0001945
1681 Ga0496121_0033354
1682 Ga0496122_0000132
1683 Ga0496122_0021059
1684 Ga0496123_0006535
1685 Ga0496123_0009503
1686 Ga0496123_0031449
1687 Ga0496124_0000106
1688 Ga0496124_0049234
1689 Ga0496124_0119605
1690 Ga0496125_0000014
1691 Ga0496125_0005528
1692 Ga0496126_0000017
1693 Ga0496126_0000666
1694 Ga0496126_0002345
1695 Ga0496126_0002811
1696 Ga0496126_0030074
1697 Ga0496126_0127491
1698 Ga0496126_0132159
1699 Ga0501031_0000115
1700 Ga0501031_0000689
1701 Ga0501032_0000052
1702 Ga0501032_0003025
1703 Ga0501033_0003226
1704 Ga0501033_0081573
1705 Ga0501034_0003913
1706 Ga0501034_0007479
1707 Ga0501034_0007562
1708 Ga0501034_0009939
1709 Ga0501034_0018093
1710 Ga0501034_0042719
1711 Ga0501034_0077054
1712 Ga0501036_0000061
1713 Ga0501036_0007304
1714 Ga0501036_0007724
1715 Ga0501037_0000046
1716 Ga0501037_0000759
1717 Ga0501037_0009351
1718 Ga0501037_0032693
1719 Ga0501038_0000068
1720 Ga0501038_0001047
1721 Ga0501038_0037505
1722 Ga0501039_0000292
1723 Ga0501039_0007114
1724 Ga0501039_0015833
1725 Ga0501039_0017339
1726 Ga0501039_0089429
1727 Ga0501039_0125632
1728 Ga0501041_0018231
1729 Ga0501041_0089571
1730 Ga0501042_0083451
1731 Ga0501043_0000340
1732 Ga0501043_0006218
1733 Ga0501043_0012119
1734 Ga0501043_0019541
1735 Ga0501043_0119895
1736 Ga0501046_0000102
1737 Ga0501046_0000695
1738 Ga0501046_0013449
1739 Ga0501047_0001039
1740 Ga0501047_0005250
1741 Ga0501047_0006620
1742 Ga0501048_0000006
1743 Ga0501048_0001635
1744 Ga0501048_0086500
1745 Ga0501067_0001571
1746 Ga0501067_0008217
1747 Ga0501068_0014755
1748 Ga0501068_0021950
1749 Ga0501069_0005606
1750 Ga0501069_0052816
1751 Ga0501070_0000139
1752 Ga0501070_0001449
1753 Ga0501071_0028813
1754 Ga0501071_0048989
1755 Ga0501072_0001960
1756 Ga0501072_0005664
1757 Ga0501074_0000256
1758 Ga0501074_0007580
1759 Ga0501075_0013424
1760 Ga0501076_0001319
1761 Ga0501076_0124969
1762 Ga0501077_0002277
1763 Ga0501079_0003278
1764 Ga0501080_0000051
1765 Ga0501081_0007069
1766 Ga0501081_0009280
1767 Ga0501083_0002108
1768 Ga0501035_0000321
1769 Ga0501035_0021506
1770 Ga0501035_0137976
1771 Ga0501044_0000137
1772 Ga0501044_0014259
1773 Ga0501044_0093370
1774 Ga0501044_0098533
1775 Ga0501045_0000759
1776 Ga0501045_0004172
1777 nmdc:mga03n38_2544_c1
1778 nmdc:mga03n38_2774_c1
1779 nmdc:mga03n38_43742_c1
1780 nmdc:mga00v17_1112_c1
1781 nmdc:mga00v17_1395_c1
1782 nmdc:mga00v17_18036_c1
1783 nmdc:mga00v17_21287_c1
1784 nmdc:mga00v17_26340_c1
1785 nmdc:mga00v17_55615_c1
1786 nmdc:mga0yw44_17378_c1
1787 nmdc:mga0yw44_1762_c1
1788 nmdc:mga0yw44_3292_c1
1789 nmdc:mga0yw44_34620_c1
1790 nmdc:mga0yw44_4326_c1
1791 nmdc:mga0yw44_4737_c1
1792 nmdc:mga06z11_10749_c1
1793 nmdc:mga04h51_21315_c1
1794 nmdc:mga07m45_23424_c1
1795 nmdc:mga07m45_41212_c1
1796 nmdc:mga07m45_6183_c1
1797 nmdc:mga07m45_8326_c1
1798 nmdc:mga05p37_22514_c1
1799 nmdc:mga05p37_60697_c1
1800 nmdc:mga09592_105574_c1
1801 nmdc:mga06r32_166033_c1
1802 nmdc:mga06r32_181758_c1
1803 nmdc:mga06r32_25842_c1
1804 nmdc:mga06r32_36408_c1
1805 nmdc:mga06r32_6628_c1
1806 nmdc:mga08y16_101120_c1
1807 nmdc:mga08y16_132329_c1
1808 nmdc:mga08y16_6449_c1
1809 nmdc:mga08y16_7008_c1
1810 nmdc:mga08y16_80980_c1
1811 nmdc:mga0n895_70602_c1
1812 nmdc:mga0n895_74334_c1
1813 nmdc:mga0n895_8375_c1
1814 nmdc:mga0rr50_1370_c1
1815 nmdc:mga0rr50_42753_c1
1816 nmdc:mga08x19_1536_c1
1817 nmdc:mga08x19_51315_c1
1818 nmdc:mga0a205_34993_c1
1819 nmdc:mga0a205_783_c2
1820 nmdc:mga0sz30_1720_c1
1821 nmdc:mga0sz30_31391_c1
1822 nmdc:mga0sz30_9291_c1
1823 Ga0495601_0000029
1824 Ga0500610_0001987
1825 Ga0495655_0000010
1826 Ga0500641_0000526
1827 Ga0500641_0004436
1828 Ga0500562_001179
1829 Ga0500628_000024
1830 Ga0500568_0000039
1831 Ga0500616_0000535
1832 Ga0500616_0002876
1833 Ga0500616_0007902
1834 Ga0500616_0038579
1835 Ga0500645_000063
1836 Ga0501084_0001328
1837 Ga0501084_0116680
1838 Ga0501082_0003048
1839 Ga0501082_0065353
1840 Ga0466962_0014986
1841 2643851843
1842 2644137568
1843 2644456039
1844 2644491205
1845 2644538700
1846 2644609989
1847 2644636617
1848 2645720701
1849 2645723719
1850 2731909430
1851 2738666841
1852 2739145685
1853 2774395152
1854 2799186767
1855 2809194013
1856 2812348750
1857 2816427141
1858 2852643855
1859 2870782933
1860 2883825819
1861 2891973486
1862 2902797317
1863 2902814579
1864 2902843024
1865 2904769979
1866 2904771171
1867 2908815215
1868 2919423334
1869 2919435942
1870 2919448712
1871 2929218388
1872 2939585034
1873 2966923363
1874 2974318556
1875 2984526767
1876 2984578042
1877 2984593939
1878 2990257556

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

210

497

0.94

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

35

208

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8797 27 499
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8704 27 499
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8639 27 500
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8612 27 499
5aq1-assembly1.cif.gz_B trypanosoma cruzi glucose-6-phosphate dehydrogenase in complex with g6p and nadph 0.8549 25 499
ID Description Score Start End Superfamily
af_A0A0R0IPN1_4_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8784 124 208 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8663 33 207 3.40.50.720
4lgvC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8654 211 500 3.30.360.10
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8602 27 204 3.40.50.720
af_Q10M94_152_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8568 28 204 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9758 28 197 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9737 245 359 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A0R3WUZ6-F1-model_v4 glucose-6-phosphate dehydrogenase (NADP(+)) (EC 1.1.1.49) 0.9698 226 355 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-T1B9F9-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9615 216 372 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A2M7FSM5-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9545 232 372 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map