F486279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 422 | 1878 | 497 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100049579|Ga0068860_1000495793 |
| Length | 503 |
| Sequence | MATDTQSGAPAIAYPGGEPMEAIGAVTPLPPHVLCIFGATGDLARRKLLPGLLHLCQAGLMPEFRVVGISMEELSDAQFREFAAEACREFGHHEFDQEEWHDFAQRLSYLPVSEAPKALKGVVEATCEELGEETRLLHYLSVPPKAAGDVIELLGEAGLNERARVVMEKPFGTDLASAQRLNEMVHEVFREEQVFRIDHFLGKEAALNILALRFANGLFEPIWNRDHIDHIQIDVPETIGVGSRAGFYDQTGAYRDMVVTHLFQILAFVAMEPPTALAPEPITEEKNKVFRSLRPLDPEWVVRGQYEGYAEEVGVESSSTETFVALRNEIDNWRWSGVKFYLRTGKRMGEGGRIISIAFREPPQSMFPAHSRVGRYGPDHLTFDLDESSRVSLSFYGKRPGMGMVLDKASMQFSLDETAYRGETLEAYERLLRDAMAGDRTLFTTARDIERLWEISEPLLRDPAPVKPYPQGSWGPAEIGALIAPNSWRLPFARRWREHHVNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 195 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 235 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 238 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 241 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 242 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 243 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 386 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 387 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 388 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 389 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 390 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 391 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 392 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 393 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 394 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 395 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 396 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 397 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 398 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 399 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 400 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 401 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 402 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 403 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 404 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 405 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 406 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 407 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 408 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 409 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 410 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 411 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 412 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 413 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 414 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 415 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 416 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 417 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 418 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 419 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 420 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 421 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 422 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 0.11 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 7.03 |
| Nodule | 0 |
| Rhizoplane | 11.93 |
| Rhizosphere | 72.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100049579 | 3300005843 | Bacteria | 3998 |
| 2 | JGI24741J21665_1004231 | 3300001915 | Bacteria | 3224 |
| 3 | JGI24740J21852_10012686 | 3300001979 | Bacteria | 3170 |
| 4 | JGI24739J22299_10007492 | 3300001989 | Bacteria | 4092 |
| 5 | JGI24737J22298_10014225 | 3300001990 | Bacteria | 2584 |
| 6 | JGI24735J21928_10014328 | 3300002067 | Bacteria | 2484 |
| 7 | JGI24750J21931_1003282 | 3300002070 | Bacteria | 1941 |
| 8 | JGI24745J21846_1001386 | 3300002073 | Bacteria | 2342 |
| 9 | JGI24744J21845_10002686 | 3300002077 | Bacteria | 3628 |
| 10 | JGI24033J26618_1000922 | 3300002155 | Bacteria | 2828 |
| 11 | JGI24751J29686_10002325 | 3300002459 | Bacteria | 3839 |
| 12 | JGI24751J29686_10006759 | 3300002459 | Bacteria | 2338 |
| 13 | JGI25406J46586_10005948 | 3300003203 | Bacteria | 5644 |
| 14 | JGI25407J50210_10000047 | 3300003373 | Bacteria | 13908 |
| 15 | JGI25407J50210_10011902 | 3300003373 | Bacteria | 2228 |
| 16 | Ga0055540_1000065 | 3300003792 | Bacteria | 126812 |
| 17 | Ga0055540_1001113 | 3300003792 | Bacteria | 16948 |
| 18 | Ga0055540_1001796 | 3300003792 | Bacteria | 12202 |
| 19 | Ga0055540_1003135 | 3300003792 | Bacteria | 8186 |
| 20 | Ga0070658_10077740 | 3300005327 | Bacteria | 2723 |
| 21 | Ga0070658_10093759 | 3300005327 | Bacteria | 2476 |
| 22 | Ga0070676_10008718 | 3300005328 | Bacteria | 5471 |
| 23 | Ga0070683_100000527 | 3300005329 | Bacteria | 26899 |
| 24 | Ga0070683_100079610 | 3300005329 | Bacteria | 3066 |
| 25 | Ga0070683_100207572 | 3300005329 | Bacteria | 1860 |
| 26 | Ga0070690_100021595 | 3300005330 | Bacteria | 3932 |
| 27 | Ga0070670_100105668 | 3300005331 | Bacteria | 2426 |
| 28 | Ga0068869_100014020 | 3300005334 | Bacteria | 5347 |
| 29 | Ga0070666_10055053 | 3300005335 | Bacteria | 2684 |
| 30 | Ga0070682_100001211 | 3300005337 | Bacteria | 14715 |
| 31 | Ga0070682_100006610 | 3300005337 | Bacteria | 6504 |
| 32 | Ga0070682_100090917 | 3300005337 | Bacteria | 1997 |
| 33 | Ga0068868_100019969 | 3300005338 | Bacteria | 5026 |
| 34 | Ga0068868_100048728 | 3300005338 | Bacteria | 3324 |
| 35 | Ga0068868_100177504 | 3300005338 | Bacteria | 1766 |
| 36 | Ga0070689_100016786 | 3300005340 | Bacteria | 5364 |
| 37 | Ga0070661_100000110 | 3300005344 | Bacteria | 68106 |
| 38 | Ga0070661_100013458 | 3300005344 | Bacteria | 5742 |
| 39 | Ga0070661_100071708 | 3300005344 | Bacteria | 2549 |
| 40 | Ga0070661_100129182 | 3300005344 | Bacteria | 1897 |
| 41 | Ga0070692_10012228 | 3300005345 | Bacteria | 3965 |
| 42 | Ga0070668_100001430 | 3300005347 | Bacteria | 17221 |
| 43 | Ga0070668_100002698 | 3300005347 | Bacteria | 13056 |
| 44 | Ga0070668_100007667 | 3300005347 | Bacteria | 8011 |
| 45 | Ga0070668_100028160 | 3300005347 | Bacteria | 4266 |
| 46 | Ga0070668_100028625 | 3300005347 | Bacteria | 4229 |
| 47 | Ga0070668_100045992 | 3300005347 | Bacteria | 3350 |
| 48 | Ga0070668_100063880 | 3300005347 | Bacteria | 2853 |
| 49 | Ga0070668_100106218 | 3300005347 | Bacteria | 2230 |
| 50 | Ga0070669_100016048 | 3300005353 | Bacteria | 5344 |
| 51 | Ga0070671_100002337 | 3300005355 | Bacteria | 14646 |
| 52 | Ga0070674_100000153 | 3300005356 | Bacteria | 32199 |
| 53 | Ga0070688_100000053 | 3300005365 | Bacteria | 55064 |
| 54 | Ga0070659_100000013 | 3300005366 | Bacteria | 178795 |
| 55 | Ga0070659_100016187 | 3300005366 | Bacteria | 5595 |
| 56 | Ga0070667_100000840 | 3300005367 | Bacteria | 28497 |
| 57 | Ga0070667_100008468 | 3300005367 | Bacteria | 8529 |
| 58 | Ga0070667_100028629 | 3300005367 | Bacteria | 4639 |
| 59 | Ga0070667_100053878 | 3300005367 | Bacteria | 3395 |
| 60 | Ga0070714_100011637 | 3300005435 | Bacteria | 6986 |
| 61 | Ga0070714_100149830 | 3300005435 | Bacteria | 2101 |
| 62 | Ga0070713_100133350 | 3300005436 | Bacteria | 2192 |
| 63 | Ga0070710_10001412 | 3300005437 | Bacteria | 11329 |
| 64 | Ga0070710_10012538 | 3300005437 | Bacteria | 4212 |
| 65 | Ga0070701_10022358 | 3300005438 | Bacteria | 3031 |
| 66 | Ga0070711_100000205 | 3300005439 | Bacteria | 31303 |
| 67 | Ga0070711_100010610 | 3300005439 | Bacteria | 5707 |
| 68 | Ga0070705_100018204 | 3300005440 | Bacteria | 3678 |
| 69 | Ga0070694_100048154 | 3300005444 | Bacteria | 2867 |
| 70 | Ga0070663_100031238 | 3300005455 | Bacteria | 3659 |
| 71 | Ga0070663_100083040 | 3300005455 | Bacteria | 2358 |
| 72 | Ga0070678_100004645 | 3300005456 | Bacteria | 7810 |
| 73 | Ga0070678_100021506 | 3300005456 | Bacteria | 4255 |
| 74 | Ga0070662_100020708 | 3300005457 | Bacteria | 4484 |
| 75 | Ga0070662_100096833 | 3300005457 | Bacteria | 2226 |
| 76 | Ga0070662_100124614 | 3300005457 | Bacteria | 1979 |
| 77 | Ga0070681_10043343 | 3300005458 | Bacteria | 4508 |
| 78 | Ga0068867_100006760 | 3300005459 | Bacteria | 8108 |
| 79 | Ga0068867_100026849 | 3300005459 | Bacteria | 4136 |
| 80 | Ga0068867_100156717 | 3300005459 | Bacteria | 1793 |
| 81 | Ga0070685_10000086 | 3300005466 | Bacteria | 57017 |
| 82 | Ga0070685_10014773 | 3300005466 | Bacteria | 4139 |
| 83 | Ga0070685_10033305 | 3300005466 | Bacteria | 2893 |
| 84 | Ga0070707_100165503 | 3300005468 | Bacteria | 2155 |
| 85 | Ga0070679_100002668 | 3300005530 | Bacteria | 16241 |
| 86 | Ga0068853_100033816 | 3300005539 | Bacteria | 4337 |
| 87 | Ga0068853_100071658 | 3300005539 | Bacteria | 3018 |
| 88 | Ga0068853_100149071 | 3300005539 | Bacteria | 2104 |
| 89 | Ga0070686_100048679 | 3300005544 | Bacteria | 2686 |
| 90 | Ga0070696_100034595 | 3300005546 | Bacteria | 3476 |
| 91 | Ga0070696_100166725 | 3300005546 | Bacteria | 1626 |
| 92 | Ga0070693_100019527 | 3300005547 | Bacteria | 3555 |
| 93 | Ga0070665_100004960 | 3300005548 | Bacteria | 13801 |
| 94 | Ga0070665_100032045 | 3300005548 | Bacteria | 5291 |
| 95 | Ga0070665_100043787 | 3300005548 | Bacteria | 4497 |
| 96 | Ga0070665_100075978 | 3300005548 | Bacteria | 3366 |
| 97 | Ga0070704_100000289 | 3300005549 | Bacteria | 22086 |
| 98 | Ga0070704_100064102 | 3300005549 | Bacteria | 2640 |
| 99 | Ga0068857_100084732 | 3300005577 | Bacteria | 2832 |
| 100 | Ga0068854_100025337 | 3300005578 | Bacteria | 4069 |
| 101 | Ga0068856_100001228 | 3300005614 | Bacteria | 26877 |
| 102 | Ga0070702_100029922 | 3300005615 | Bacteria | 2966 |
| 103 | Ga0070702_100031581 | 3300005615 | Bacteria | 2899 |
| 104 | Ga0068852_100059236 | 3300005616 | Bacteria | 3320 |
| 105 | Ga0068859_100002544 | 3300005617 | Bacteria | 18515 |
| 106 | Ga0068859_100023558 | 3300005617 | Bacteria | 6178 |
| 107 | Ga0068859_100107717 | 3300005617 | Bacteria | 2847 |
| 108 | Ga0068866_10001088 | 3300005718 | Bacteria | 11980 |
| 109 | Ga0068861_100002774 | 3300005719 | Bacteria | 11496 |
| 110 | Ga0068863_100000373 | 3300005841 | Bacteria | 45591 |
| 111 | Ga0068863_100024127 | 3300005841 | Bacteria | 5802 |
| 112 | Ga0068863_100093058 | 3300005841 | Bacteria | 2861 |
| 113 | Ga0068858_100003979 | 3300005842 | Bacteria | 14586 |
| 114 | Ga0068858_100046913 | 3300005842 | Bacteria | 4005 |
| 115 | Ga0068858_100058513 | 3300005842 | Bacteria | 3564 |
| 116 | Ga0068860_100000011 | 3300005843 | Bacteria | 328172 |
| 117 | Ga0068860_100033567 | 3300005843 | Bacteria | 4923 |
| 118 | Ga0068860_100107761 | 3300005843 | Bacteria | 2662 |
| 119 | Ga0068862_100000139 | 3300005844 | Bacteria | 82475 |
| 120 | Ga0068862_100000366 | 3300005844 | Bacteria | 49032 |
| 121 | Ga0068862_100005265 | 3300005844 | Bacteria | 10850 |
| 122 | Ga0068862_100021554 | 3300005844 | Bacteria | 5385 |
| 123 | Ga0068862_100129428 | 3300005844 | Bacteria | 2231 |
| 124 | Ga0081455_10000106 | 3300005937 | Bacteria | 93286 |
| 125 | Ga0081455_10002738 | 3300005937 | Bacteria | 20795 |
| 126 | Ga0081455_10027460 | 3300005937 | Bacteria | 5216 |
| 127 | Ga0081455_10037772 | 3300005937 | Bacteria | 4282 |
| 128 | Ga0081455_10084826 | 3300005937 | Bacteria | 2584 |
| 129 | Ga0081538_10000763 | 3300005981 | Bacteria | 35158 |
| 130 | Ga0081538_10000973 | 3300005981 | Bacteria | 30622 |
| 131 | Ga0081540_1000046 | 3300005983 | Bacteria | 131375 |
| 132 | Ga0081540_1011454 | 3300005983 | Bacteria | 5924 |
| 133 | Ga0081540_1013115 | 3300005983 | Bacteria | 5411 |
| 134 | Ga0081539_10000236 | 3300005985 | Bacteria | 129646 |
| 135 | Ga0081539_10001074 | 3300005985 | Bacteria | 49797 |
| 136 | Ga0081539_10001710 | 3300005985 | Bacteria | 35211 |
| 137 | Ga0081539_10004566 | 3300005985 | Bacteria | 15131 |
| 138 | Ga0081539_10010378 | 3300005985 | Bacteria | 7574 |
| 139 | Ga0070717_10000059 | 3300006028 | Bacteria | 92958 |
| 140 | Ga0070717_10118149 | 3300006028 | Bacteria | 2269 |
| 141 | Ga0075365_10000193 | 3300006038 | Bacteria | 20067 |
| 142 | Ga0075365_10000898 | 3300006038 | Bacteria | 12474 |
| 143 | Ga0075365_10009502 | 3300006038 | Bacteria | 5595 |
| 144 | Ga0075363_100000427 | 3300006048 | Bacteria | 13107 |
| 145 | Ga0075363_100002846 | 3300006048 | Bacteria | 7200 |
| 146 | Ga0075363_100016916 | 3300006048 | Bacteria | 3608 |
| 147 | Ga0075363_100040584 | 3300006048 | Bacteria | 2453 |
| 148 | Ga0075364_10000577 | 3300006051 | Bacteria | 18886 |
| 149 | Ga0075364_10000892 | 3300006051 | Bacteria | 15760 |
| 150 | Ga0075364_10001241 | 3300006051 | Bacteria | 13684 |
| 151 | Ga0075364_10003280 | 3300006051 | Bacteria | 9173 |
| 152 | Ga0075364_10052920 | 3300006051 | Bacteria | 2654 |
| 153 | Ga0075364_10062082 | 3300006051 | Bacteria | 2452 |
| 154 | Ga0075364_10105557 | 3300006051 | Bacteria | 1877 |
| 155 | Ga0075432_10000398 | 3300006058 | Bacteria | 12679 |
| 156 | Ga0070716_100019063 | 3300006173 | Bacteria | 3582 |
| 157 | Ga0070716_100025057 | 3300006173 | Bacteria | 3178 |
| 158 | Ga0070712_100021922 | 3300006175 | Bacteria | 4200 |
| 159 | Ga0075367_10016382 | 3300006178 | Bacteria | 4047 |
| 160 | Ga0075369_10002193 | 3300006186 | Bacteria | 6904 |
| 161 | Ga0075369_10011109 | 3300006186 | Bacteria | 3533 |
| 162 | Ga0075369_10014500 | 3300006186 | Bacteria | 3149 |
| 163 | Ga0075369_10046765 | 3300006186 | Bacteria | 1864 |
| 164 | Ga0075370_10007355 | 3300006353 | Bacteria | 5605 |
| 165 | Ga0075370_10009536 | 3300006353 | Bacteria | 5046 |
| 166 | Ga0075370_10038551 | 3300006353 | Bacteria | 2689 |
| 167 | Ga0075428_100016930 | 3300006844 | Bacteria | 8050 |
| 168 | Ga0075428_100020281 | 3300006844 | Bacteria | 7362 |
| 169 | Ga0075431_100012901 | 3300006847 | Bacteria | 8434 |
| 170 | Ga0075431_100019604 | 3300006847 | Bacteria | 6899 |
| 171 | Ga0075431_100034685 | 3300006847 | Bacteria | 5198 |
| 172 | Ga0075433_10001708 | 3300006852 | Bacteria | 16382 |
| 173 | Ga0075433_10070863 | 3300006852 | Bacteria | 3064 |
| 174 | Ga0075434_100004328 | 3300006871 | Bacteria | 12772 |
| 175 | Ga0075434_100004603 | 3300006871 | Bacteria | 12453 |
| 176 | Ga0075434_100019309 | 3300006871 | Bacteria | 6595 |
| 177 | Ga0075429_100003236 | 3300006880 | Bacteria | 13858 |
| 178 | Ga0068865_100014483 | 3300006881 | Bacteria | 5011 |
| 179 | Ga0068865_100049452 | 3300006881 | Bacteria | 2898 |
| 180 | Ga0068865_100103041 | 3300006881 | Bacteria | 2092 |
| 181 | Ga0075436_100002186 | 3300006914 | Bacteria | 13483 |
| 182 | Ga0075436_100059928 | 3300006914 | Bacteria | 2629 |
| 183 | Ga0097620_100002544 | 3300006931 | Bacteria | 18515 |
| 184 | Ga0097620_100023557 | 3300006931 | Bacteria | 6178 |
| 185 | Ga0097620_100107709 | 3300006931 | Bacteria | 2847 |
| 186 | Ga0075435_100000562 | 3300007076 | Bacteria | 22817 |
| 187 | Ga0075435_100061086 | 3300007076 | Bacteria | 3057 |
| 188 | Ga0105251_10053118 | 3300009011 | Bacteria | 1927 |
| 189 | Ga0111539_10001351 | 3300009094 | Bacteria | 32652 |
| 190 | Ga0111539_10010304 | 3300009094 | Bacteria | 11767 |
| 191 | Ga0111539_10017096 | 3300009094 | Bacteria | 8978 |
| 192 | Ga0111539_10072393 | 3300009094 | Bacteria | 4064 |
| 193 | Ga0105245_10004802 | 3300009098 | Bacteria | 11924 |
| 194 | Ga0105245_10015520 | 3300009098 | Bacteria | 6642 |
| 195 | Ga0105245_10018530 | 3300009098 | Bacteria | 6088 |
| 196 | Ga0105245_10027146 | 3300009098 | Bacteria | 5044 |
| 197 | Ga0105245_10072901 | 3300009098 | Bacteria | 3121 |
| 198 | Ga0105245_10093030 | 3300009098 | Bacteria | 2778 |
| 199 | Ga0105247_10000067 | 3300009101 | Bacteria | 118585 |
| 200 | Ga0114129_10018395 | 3300009147 | Bacteria | 9952 |
| 201 | Ga0114129_10085188 | 3300009147 | Bacteria | 4384 |
| 202 | Ga0105243_10003878 | 3300009148 | Bacteria | 11951 |
| 203 | Ga0105243_10027691 | 3300009148 | Bacteria | 4345 |
| 204 | Ga0105243_10029456 | 3300009148 | Bacteria | 4222 |
| 205 | Ga0105243_10049144 | 3300009148 | Bacteria | 3327 |
| 206 | Ga0105241_10015475 | 3300009174 | Bacteria | 5588 |
| 207 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 208 | Ga0105242_10003061 | 3300009176 | Bacteria | 13067 |
| 209 | Ga0105248_10000040 | 3300009177 | Bacteria | 172452 |
| 210 | Ga0105248_10007307 | 3300009177 | Bacteria | 12120 |
| 211 | Ga0105248_10046307 | 3300009177 | Bacteria | 4874 |
| 212 | Ga0105248_10174132 | 3300009177 | Bacteria | 2426 |
| 213 | Ga0105248_10256461 | 3300009177 | Bacteria | 1969 |
| 214 | Ga0105237_10016854 | 3300009545 | Bacteria | 7582 |
| 215 | Ga0105237_10051342 | 3300009545 | Bacteria | 4142 |
| 216 | Ga0105237_10137143 | 3300009545 | Bacteria | 2441 |
| 217 | Ga0105237_10164528 | 3300009545 | Bacteria | 2217 |
| 218 | Ga0105237_10264593 | 3300009545 | Bacteria | 1722 |
| 219 | Ga0105238_10192262 | 3300009551 | Bacteria | 2017 |
| 220 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 221 | Ga0105249_10000916 | 3300009553 | Bacteria | 26081 |
| 222 | Ga0105249_10013603 | 3300009553 | Bacteria | 7186 |
| 223 | Ga0105249_10020446 | 3300009553 | Bacteria | 5917 |
| 224 | Ga0105239_10033519 | 3300010375 | Bacteria | 5639 |
| 225 | Ga0105239_10046182 | 3300010375 | Bacteria | 4772 |
| 226 | Ga0105239_10090887 | 3300010375 | Bacteria | 3368 |
| 227 | Ga0105239_10108668 | 3300010375 | Bacteria | 3073 |
| 228 | Ga0105246_10051975 | 3300011119 | Bacteria | 2815 |
| 229 | Ga0105246_10072007 | 3300011119 | Bacteria | 2435 |
| 230 | Ga0105246_10082776 | 3300011119 | Bacteria | 2291 |
| 231 | Ga0157371_10002739 | 3300013102 | Bacteria | 16585 |
| 232 | Ga0157369_10106863 | 3300013105 | Bacteria | 2978 |
| 233 | Ga0157374_10033593 | 3300013296 | Bacteria | 4681 |
| 234 | Ga0157374_10228830 | 3300013296 | Bacteria | 1826 |
| 235 | Ga0157374_10233194 | 3300013296 | Bacteria | 1808 |
| 236 | Ga0157378_10012869 | 3300013297 | Bacteria | 7324 |
| 237 | Ga0157378_10104429 | 3300013297 | Bacteria | 2590 |
| 238 | Ga0163162_10009929 | 3300013306 | Bacteria | 9260 |
| 239 | Ga0163162_10029767 | 3300013306 | Bacteria | 5404 |
| 240 | Ga0163162_10072586 | 3300013306 | Bacteria | 3497 |
| 241 | Ga0163162_10074024 | 3300013306 | Bacteria | 3464 |
| 242 | Ga0163162_10079151 | 3300013306 | Bacteria | 3353 |
| 243 | Ga0163162_10097729 | 3300013306 | Bacteria | 3025 |
| 244 | Ga0163162_10134826 | 3300013306 | Bacteria | 2580 |
| 245 | Ga0163162_10348824 | 3300013306 | Bacteria | 1613 |
| 246 | Ga0157372_10000284 | 3300013307 | Bacteria | 56386 |
| 247 | Ga0157372_10005924 | 3300013307 | Bacteria | 13002 |
| 248 | Ga0157372_10064155 | 3300013307 | Bacteria | 4121 |
| 249 | Ga0157372_10168658 | 3300013307 | Bacteria | 2532 |
| 250 | Ga0157375_10000945 | 3300013308 | Bacteria | 25164 |
| 251 | Ga0157375_10005034 | 3300013308 | Bacteria | 11478 |
| 252 | Ga0157375_10072195 | 3300013308 | Bacteria | 3467 |
| 253 | Ga0157380_10000186 | 3300014326 | Bacteria | 35981 |
| 254 | Ga0157380_10003827 | 3300014326 | Bacteria | 10365 |
| 255 | Ga0157380_10074409 | 3300014326 | Bacteria | 2757 |
| 256 | Ga0157377_10080449 | 3300014745 | Bacteria | 1903 |
| 257 | Ga0157379_10025482 | 3300014968 | Bacteria | 5254 |
| 258 | Ga0157376_10055880 | 3300014969 | Bacteria | 3295 |
| 259 | Ga0163161_10005342 | 3300017792 | Bacteria | 8929 |
| 260 | Ga0206353_10643868 | 3300020082 | Bacteria | 4538 |
| 261 | Ga0213876_10001770 | 3300021384 | Bacteria | 13089 |
| 262 | Ga0213876_10015187 | 3300021384 | Bacteria | 4079 |
| 263 | Ga0213875_10007089 | 3300021388 | Bacteria | 5825 |
| 264 | Ga0209673_1008850 | 3300025273 | Bacteria | 4433 |
| 265 | Ga0209051_1000042 | 3300025303 | Bacteria | 308486 |
| 266 | Ga0209051_1001272 | 3300025303 | Bacteria | 22502 |
| 267 | Ga0209051_1003310 | 3300025303 | Bacteria | 10672 |
| 268 | Ga0209051_1003693 | 3300025303 | Bacteria | 9880 |
| 269 | Ga0207692_10016442 | 3300025898 | Bacteria | 3277 |
| 270 | Ga0207692_10017629 | 3300025898 | Bacteria | 3188 |
| 271 | Ga0207642_10000670 | 3300025899 | Bacteria | 10550 |
| 272 | Ga0207642_10013194 | 3300025899 | Bacteria | 3008 |
| 273 | Ga0207710_10000094 | 3300025900 | Bacteria | 118590 |
| 274 | Ga0207688_10001311 | 3300025901 | Bacteria | 12918 |
| 275 | Ga0207688_10001662 | 3300025901 | Bacteria | 11760 |
| 276 | Ga0207688_10009551 | 3300025901 | Bacteria | 5280 |
| 277 | Ga0207688_10015696 | 3300025901 | Bacteria | 4108 |
| 278 | Ga0207688_10060428 | 3300025901 | Bacteria | 2135 |
| 279 | Ga0207680_10004733 | 3300025903 | Bacteria | 6475 |
| 280 | Ga0207680_10046470 | 3300025903 | Bacteria | 2566 |
| 281 | Ga0207647_10016099 | 3300025904 | Bacteria | 5108 |
| 282 | Ga0207647_10023770 | 3300025904 | Bacteria | 4049 |
| 283 | Ga0207647_10027662 | 3300025904 | Bacteria | 3694 |
| 284 | Ga0207647_10053948 | 3300025904 | Bacteria | 2474 |
| 285 | Ga0207699_10006259 | 3300025906 | Bacteria | 5749 |
| 286 | Ga0207645_10058212 | 3300025907 | Bacteria | 2467 |
| 287 | Ga0207643_10023963 | 3300025908 | Bacteria | 3368 |
| 288 | Ga0207705_10025934 | 3300025909 | Bacteria | 4183 |
| 289 | Ga0207705_10040140 | 3300025909 | Bacteria | 3355 |
| 290 | Ga0207707_10031607 | 3300025912 | Bacteria | 4632 |
| 291 | Ga0207671_10009287 | 3300025914 | Bacteria | 8236 |
| 292 | Ga0207671_10077218 | 3300025914 | Bacteria | 2493 |
| 293 | Ga0207671_10087953 | 3300025914 | Bacteria | 2337 |
| 294 | Ga0207693_10003676 | 3300025915 | Bacteria | 13100 |
| 295 | Ga0207693_10012194 | 3300025915 | Bacteria | 6943 |
| 296 | Ga0207693_10019923 | 3300025915 | Bacteria | 5335 |
| 297 | Ga0207693_10043212 | 3300025915 | Bacteria | 3546 |
| 298 | Ga0207663_10007388 | 3300025916 | Bacteria | 5695 |
| 299 | Ga0207663_10054819 | 3300025916 | Bacteria | 2498 |
| 300 | Ga0207662_10005997 | 3300025918 | Bacteria | 6529 |
| 301 | Ga0207657_10023952 | 3300025919 | Bacteria | 5668 |
| 302 | Ga0207657_10138233 | 3300025919 | Bacteria | 1992 |
| 303 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 304 | Ga0207649_10006432 | 3300025920 | Bacteria | 6380 |
| 305 | Ga0207652_10009781 | 3300025921 | Bacteria | 7717 |
| 306 | Ga0207652_10157724 | 3300025921 | Bacteria | 2033 |
| 307 | Ga0207681_10002134 | 3300025923 | Bacteria | 12626 |
| 308 | Ga0207659_10000707 | 3300025926 | Bacteria | 19793 |
| 309 | Ga0207687_10002110 | 3300025927 | Bacteria | 13589 |
| 310 | Ga0207687_10007569 | 3300025927 | Bacteria | 7143 |
| 311 | Ga0207687_10024556 | 3300025927 | Bacteria | 4028 |
| 312 | Ga0207687_10026230 | 3300025927 | Bacteria | 3900 |
| 313 | Ga0207687_10119107 | 3300025927 | Bacteria | 1972 |
| 314 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 315 | Ga0207664_10008731 | 3300025929 | Bacteria | 7084 |
| 316 | Ga0207644_10083867 | 3300025931 | Bacteria | 2361 |
| 317 | Ga0207690_10000075 | 3300025932 | Bacteria | 85885 |
| 318 | Ga0207690_10006804 | 3300025932 | Bacteria | 6781 |
| 319 | Ga0207690_10032483 | 3300025932 | Bacteria | 3349 |
| 320 | Ga0207706_10012125 | 3300025933 | Bacteria | 7850 |
| 321 | Ga0207706_10017268 | 3300025933 | Bacteria | 6503 |
| 322 | Ga0207706_10117753 | 3300025933 | Bacteria | 2336 |
| 323 | Ga0207686_10000119 | 3300025934 | Bacteria | 64297 |
| 324 | Ga0207686_10034284 | 3300025934 | Bacteria | 3037 |
| 325 | Ga0207709_10013184 | 3300025935 | Bacteria | 4559 |
| 326 | Ga0207709_10036710 | 3300025935 | Bacteria | 2906 |
| 327 | Ga0207669_10030356 | 3300025937 | Bacteria | 3003 |
| 328 | Ga0207669_10070907 | 3300025937 | Bacteria | 2187 |
| 329 | Ga0207704_10008206 | 3300025938 | Bacteria | 4977 |
| 330 | Ga0207704_10024642 | 3300025938 | Bacteria | 3267 |
| 331 | Ga0207704_10025069 | 3300025938 | Bacteria | 3248 |
| 332 | Ga0207665_10009146 | 3300025939 | Bacteria | 6503 |
| 333 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 334 | Ga0207711_10000419 | 3300025941 | Bacteria | 44875 |
| 335 | Ga0207711_10007828 | 3300025941 | Bacteria | 8931 |
| 336 | Ga0207711_10015373 | 3300025941 | Bacteria | 6352 |
| 337 | Ga0207689_10006344 | 3300025942 | Bacteria | 10474 |
| 338 | Ga0207689_10010392 | 3300025942 | Bacteria | 8018 |
| 339 | Ga0207689_10028771 | 3300025942 | Bacteria | 4647 |
| 340 | Ga0207689_10043062 | 3300025942 | Bacteria | 3732 |
| 341 | Ga0207661_10000438 | 3300025944 | Bacteria | 26840 |
| 342 | Ga0207661_10001594 | 3300025944 | Bacteria | 15404 |
| 343 | Ga0207661_10179866 | 3300025944 | Bacteria | 1847 |
| 344 | Ga0207679_10006499 | 3300025945 | Bacteria | 7388 |
| 345 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 346 | Ga0207712_10000994 | 3300025961 | Bacteria | 20219 |
| 347 | Ga0207712_10027061 | 3300025961 | Bacteria | 3826 |
| 348 | Ga0207712_10043652 | 3300025961 | Bacteria | 3094 |
| 349 | Ga0207712_10082501 | 3300025961 | Bacteria | 2344 |
| 350 | Ga0207712_10088424 | 3300025961 | Bacteria | 2275 |
| 351 | Ga0207668_10000972 | 3300025972 | Bacteria | 17220 |
| 352 | Ga0207668_10004404 | 3300025972 | Bacteria | 8272 |
| 353 | Ga0207668_10069075 | 3300025972 | Bacteria | 2514 |
| 354 | Ga0207668_10119262 | 3300025972 | Bacteria | 1994 |
| 355 | Ga0207658_10000513 | 3300025986 | Bacteria | 35348 |
| 356 | Ga0207658_10001083 | 3300025986 | Bacteria | 22062 |
| 357 | Ga0207658_10004107 | 3300025986 | Bacteria | 10155 |
| 358 | Ga0207658_10011128 | 3300025986 | Bacteria | 6127 |
| 359 | Ga0207677_10017030 | 3300026023 | Bacteria | 4320 |
| 360 | Ga0207677_10068318 | 3300026023 | Bacteria | 2493 |
| 361 | Ga0207677_10083694 | 3300026023 | Bacteria | 2297 |
| 362 | Ga0207703_10008803 | 3300026035 | Bacteria | 7958 |
| 363 | Ga0207639_10042649 | 3300026041 | Bacteria | 3401 |
| 364 | Ga0207639_10042898 | 3300026041 | Bacteria | 3393 |
| 365 | Ga0207678_10018936 | 3300026067 | Bacteria | 6050 |
| 366 | Ga0207678_10036639 | 3300026067 | Bacteria | 4270 |
| 367 | Ga0207678_10042158 | 3300026067 | Bacteria | 3956 |
| 368 | Ga0207678_10058204 | 3300026067 | Bacteria | 3325 |
| 369 | Ga0207678_10181705 | 3300026067 | Bacteria | 1796 |
| 370 | Ga0207708_10009808 | 3300026075 | Bacteria | 7106 |
| 371 | Ga0207702_10000419 | 3300026078 | Bacteria | 48574 |
| 372 | Ga0207702_10100883 | 3300026078 | Bacteria | 2548 |
| 373 | Ga0207702_10111204 | 3300026078 | Bacteria | 2436 |
| 374 | Ga0207641_10000489 | 3300026088 | Bacteria | 44684 |
| 375 | Ga0207641_10022045 | 3300026088 | Bacteria | 5238 |
| 376 | Ga0207648_10006599 | 3300026089 | Bacteria | 11521 |
| 377 | Ga0207676_10003416 | 3300026095 | Bacteria | 11230 |
| 378 | Ga0207674_10029086 | 3300026116 | Bacteria | 5824 |
| 379 | Ga0207674_10036548 | 3300026116 | Bacteria | 5115 |
| 380 | Ga0207675_100000896 | 3300026118 | Bacteria | 29755 |
| 381 | Ga0207675_100002895 | 3300026118 | Bacteria | 16878 |
| 382 | Ga0207675_100018303 | 3300026118 | Bacteria | 6532 |
| 383 | Ga0207675_100055105 | 3300026118 | Bacteria | 3709 |
| 384 | Ga0207683_10003700 | 3300026121 | Bacteria | 13285 |
| 385 | Ga0207683_10012181 | 3300026121 | Bacteria | 7341 |
| 386 | Ga0207683_10097115 | 3300026121 | Bacteria | 2627 |
| 387 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 388 | Ga0207698_10096122 | 3300026142 | Bacteria | 2441 |
| 389 | Ga0207428_10001010 | 3300027907 | Bacteria | 31237 |
| 390 | Ga0207428_10011064 | 3300027907 | Bacteria | 8017 |
| 391 | Ga0207428_10036585 | 3300027907 | Bacteria | 4003 |
| 392 | Ga0207428_10108580 | 3300027907 | Bacteria | 2137 |
| 393 | Ga0207428_10113006 | 3300027907 | Bacteria | 2088 |
| 394 | Ga0268266_10000485 | 3300028379 | Bacteria | 57051 |
| 395 | Ga0268266_10001186 | 3300028379 | Bacteria | 32148 |
| 396 | Ga0268266_10016797 | 3300028379 | Bacteria | 6257 |
| 397 | Ga0268266_10031366 | 3300028379 | Bacteria | 4512 |
| 398 | Ga0268266_10121722 | 3300028379 | Bacteria | 2322 |
| 399 | Ga0268265_10000032 | 3300028380 | Bacteria | 225953 |
| 400 | Ga0268265_10003823 | 3300028380 | Bacteria | 10667 |
| 401 | Ga0268265_10039720 | 3300028380 | Bacteria | 3470 |
| 402 | Ga0268265_10128307 | 3300028380 | Bacteria | 2103 |
| 403 | Ga0268265_10186493 | 3300028380 | Bacteria | 1787 |
| 404 | Ga0268265_10219233 | 3300028380 | Bacteria | 1663 |
| 405 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 406 | Ga0268264_10081582 | 3300028381 | Bacteria | 2764 |
| 407 | Ga0268264_10287849 | 3300028381 | Bacteria | 1542 |
| 408 | Ga0265337_1000012 | 3300028556 | Bacteria | 85395 |
| 409 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 410 | Ga0265319_1001040 | 3300028563 | Bacteria | 17346 |
| 411 | Ga0265334_10000094 | 3300028573 | Bacteria | 63340 |
| 412 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 413 | Ga0265336_10004740 | 3300028666 | Bacteria | 5100 |
| 414 | Ga0265336_10008731 | 3300028666 | Bacteria | 3536 |
| 415 | Ga0265338_10003073 | 3300028800 | Bacteria | 23964 |
| 416 | Ga0265338_10039663 | 3300028800 | Bacteria | 4438 |
| 417 | Ga0265324_10001935 | 3300029957 | Bacteria | 11108 |
| 418 | Ga0265324_10011287 | 3300029957 | Bacteria | 3409 |
| 419 | Ga0265332_10009702 | 3300031238 | Bacteria | 4295 |
| 420 | Ga0265328_10000659 | 3300031239 | Bacteria | 16018 |
| 421 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 422 | Ga0265329_10002237 | 3300031242 | Bacteria | 8915 |
| 423 | Ga0265331_10000919 | 3300031250 | Bacteria | 23588 |
| 424 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 425 | Ga0265327_10000626 | 3300031251 | Bacteria | 58052 |
| 426 | Ga0265327_10017384 | 3300031251 | Bacteria | 4515 |
| 427 | Ga0265327_10067674 | 3300031251 | Bacteria | 1798 |
| 428 | Ga0307513_10004621 | 3300031456 | Bacteria | 18332 |
| 429 | Ga0307408_100009103 | 3300031548 | Bacteria | 6550 |
| 430 | Ga0316575_10000856 | 3300031665 | Bacteria | 9329 |
| 431 | Ga0316579_10000197 | 3300031691 | Bacteria | 17803 |
| 432 | Ga0265314_10000224 | 3300031711 | Bacteria | 84325 |
| 433 | Ga0265314_10087093 | 3300031711 | Bacteria | 2043 |
| 434 | Ga0316576_10000472 | 3300031727 | Bacteria | 18887 |
| 435 | Ga0316576_10071005 | 3300031727 | Bacteria | 2568 |
| 436 | Ga0316578_10002095 | 3300031728 | Bacteria | 8556 |
| 437 | Ga0316578_10029750 | 3300031728 | Bacteria | 3101 |
| 438 | Ga0307405_10012822 | 3300031731 | Bacteria | 4453 |
| 439 | Ga0307405_10021001 | 3300031731 | Bacteria | 3662 |
| 440 | Ga0307413_10003082 | 3300031824 | Bacteria | 6931 |
| 441 | Ga0307413_10008230 | 3300031824 | Bacteria | 4908 |
| 442 | Ga0307413_10013804 | 3300031824 | Bacteria | 4078 |
| 443 | Ga0307410_10048177 | 3300031852 | Bacteria | 2852 |
| 444 | Ga0326468_10000144 | 3300031889 | Bacteria | 6750 |
| 445 | Ga0307406_10000212 | 3300031901 | Bacteria | 35056 |
| 446 | Ga0307406_10003159 | 3300031901 | Bacteria | 8964 |
| 447 | Ga0307406_10008888 | 3300031901 | Bacteria | 5614 |
| 448 | Ga0307407_10011467 | 3300031903 | Bacteria | 4219 |
| 449 | Ga0307407_10023004 | 3300031903 | Bacteria | 3244 |
| 450 | Ga0307412_10020831 | 3300031911 | Bacteria | 3997 |
| 451 | Ga0307409_100000273 | 3300031995 | Bacteria | 20946 |
| 452 | Ga0307409_100039242 | 3300031995 | Bacteria | 3511 |
| 453 | Ga0307409_100069954 | 3300031995 | Bacteria | 2783 |
| 454 | Ga0307409_100114239 | 3300031995 | Bacteria | 2271 |
| 455 | Ga0307416_100024902 | 3300032002 | Bacteria | 4377 |
| 456 | Ga0307416_100100022 | 3300032002 | Bacteria | 2520 |
| 457 | Ga0307416_100333315 | 3300032002 | Bacteria | 1526 |
| 458 | Ga0307414_10043440 | 3300032004 | Bacteria | 3061 |
| 459 | Ga0307414_10060645 | 3300032004 | Bacteria | 2676 |
| 460 | Ga0307414_10065657 | 3300032004 | Bacteria | 2590 |
| 461 | Ga0307411_10030039 | 3300032005 | Bacteria | 3327 |
| 462 | Ga0307411_10066141 | 3300032005 | Bacteria | 2427 |
| 463 | Ga0307411_10089911 | 3300032005 | Bacteria | 2140 |
| 464 | Ga0307411_10116855 | 3300032005 | Bacteria | 1921 |
| 465 | Ga0307415_100002934 | 3300032126 | Bacteria | 8555 |
| 466 | Ga0307415_100014609 | 3300032126 | Bacteria | 4623 |
| 467 | Ga0307507_10116584 | 3300033179 | Bacteria | 2157 |
| 468 | Ga0373926_0018656 | 3300035083 | Bacteria | 2388 |
| 469 | Ga0373940_0015452 | 3300035088 | Bacteria | 1878 |
| 470 | Ga0373923_0025185 | 3300035111 | Bacteria | 2356 |
| 471 | Ga0373936_0038871 | 3300035113 | Bacteria | 1903 |
| 472 | Ga0373945_0034978 | 3300035116 | Bacteria | 1793 |
| 473 | Ga0373943_0019111 | 3300035170 | Bacteria | 3150 |
| 474 | Ga0373946_0027023 | 3300035171 | Bacteria | 2267 |
| 475 | Ga0373962_0012023 | 3300035242 | Bacteria | 2177 |
| 476 | Ga0316574_0021377 | 3300035398 | Bacteria | 3841 |
| 477 | Ga0316574_0050231 | 3300035398 | Bacteria | 2595 |
| 478 | Ga0316574_0059543 | 3300035398 | Bacteria | 2395 |
| 479 | Ga0373931_0011804 | 3300035691 | Bacteria | 4223 |
| 480 | Ga0373931_0049431 | 3300035691 | Bacteria | 2233 |
| 481 | Ga0373935_0012382 | 3300035692 | Bacteria | 5132 |
| 482 | Ga0373927_0058976 | 3300035695 | Bacteria | 2482 |
| 483 | Ga0373947_0025273 | 3300035725 | Bacteria | 3463 |
| 484 | Ga0373937_0012589 | 3300036401 | Bacteria | 7444 |
| 485 | Ga0316582_0000099 | 3300036647 | Bacteria | 23809 |
| 486 | Ga0316584_0011486 | 3300036712 | Bacteria | 6224 |
| 487 | Ga0316584_0017792 | 3300036712 | Bacteria | 5117 |
| 488 | Ga0316584_0032919 | 3300036712 | Bacteria | 3837 |
| 489 | Ga0373925_0114583 | 3300037068 | Bacteria | 2086 |
| 490 | Ga0395899_0031667 | 3300037312 | Bacteria | 3974 |
| 491 | Ga0395900_0008269 | 3300037418 | Bacteria | 10715 |
| 492 | Ga0395900_0113694 | 3300037418 | Bacteria | 2778 |
| 493 | Ga0395898_0005178 | 3300037466 | Bacteria | 14109 |
| 494 | Ga0395898_0006290 | 3300037466 | Bacteria | 12693 |
| 495 | Ga0395898_0011426 | 3300037466 | Bacteria | 9222 |
| 496 | Ga0395898_0048546 | 3300037466 | Bacteria | 4162 |
| 497 | Ga0395905_0004214 | 3300037471 | Bacteria | 15037 |
| 498 | Ga0395905_0041668 | 3300037471 | Bacteria | 4309 |
| 499 | Ga0395905_0053436 | 3300037471 | Bacteria | 3781 |
| 500 | Ga0395905_0123278 | 3300037471 | Bacteria | 2437 |
| 501 | Ga0436364_0908867 | 3300037853 | Bacteria | 5649 |
| 502 | Ga0436364_1011521 | 3300037853 | Bacteria | 14844 |
| 503 | Ga0436364_1192519 | 3300037853 | Bacteria | 17220 |
| 504 | Ga0436364_1442254 | 3300037853 | Bacteria | 7087 |
| 505 | Ga0395901_0003473 | 3300038443 | Bacteria | 15871 |
| 506 | Ga0395901_0012501 | 3300038443 | Bacteria | 8614 |
| 507 | Ga0395901_0045998 | 3300038443 | Bacteria | 4531 |
| 508 | Ga0395901_0074150 | 3300038443 | Bacteria | 3550 |
| 509 | Ga0395901_0170831 | 3300038443 | Bacteria | 2281 |
| 510 | Ga0242420_004140 | 3300038996 | Bacteria | 2180 |
| 511 | Ga0436365_0064899 | 3300039437 | Bacteria | 12232 |
| 512 | Ga0436365_0641890 | 3300039437 | Bacteria | 23847 |
| 513 | Ga0436365_1856170 | 3300039437 | Bacteria | 22649 |
| 514 | Ga0436362_1177671 | 3300039453 | Bacteria | 2709 |
| 515 | Ga0439466_0001181 | 3300041411 | Bacteria | 10165 |
| 516 | Ga0439466_0006248 | 3300041411 | Bacteria | 4533 |
| 517 | Ga0439466_0010202 | 3300041411 | Bacteria | 3493 |
| 518 | Ga0439465_0001503 | 3300041413 | Bacteria | 7562 |
| 519 | Ga0439465_0026450 | 3300041413 | Bacteria | 1835 |
| 520 | Ga0451833_0918545 | 3300041491 | Bacteria | 4797 |
| 521 | Ga0451837_0394872 | 3300041494 | Bacteria | 1923 |
| 522 | Ga0439450_001482 | 3300042008 | Bacteria | 3454 |
| 523 | Ga0439463_003079 | 3300042016 | Bacteria | 4234 |
| 524 | Ga0439459_0009821 | 3300042438 | Bacteria | 1658 |
| 525 | Ga0439464_0014935 | 3300042439 | Bacteria | 2093 |
| 526 | Ga0439440_0003643 | 3300042993 | Bacteria | 2986 |
| 527 | Ga0466972_0007601 | 3300044658 | Bacteria | 5442 |
| 528 | Ga0466972_0013868 | 3300044658 | Bacteria | 4045 |
| 529 | Ga0466965_0005448 | 3300044683 | Bacteria | 5735 |
| 530 | Ga0466966_0016384 | 3300044684 | Bacteria | 4898 |
| 531 | Ga0466966_0031501 | 3300044684 | Bacteria | 3438 |
| 532 | Ga0466966_0033360 | 3300044684 | Bacteria | 3334 |
| 533 | Ga0466961_0008896 | 3300044693 | Bacteria | 6404 |
| 534 | Ga0466961_0057918 | 3300044693 | Bacteria | 2465 |
| 535 | Ga0466963_0003743 | 3300044694 | Bacteria | 8759 |
| 536 | Ga0466968_0001398 | 3300044735 | Bacteria | 8636 |
| 537 | Ga0466970_0009706 | 3300044765 | Bacteria | 4869 |
| 538 | Ga0466970_0025734 | 3300044765 | Bacteria | 3082 |
| 539 | Ga0466970_0030982 | 3300044765 | Bacteria | 2823 |
| 540 | Ga0466970_0032132 | 3300044765 | Bacteria | 2773 |
| 541 | Ga0466957_0008957 | 3300044842 | Bacteria | 5705 |
| 542 | Ga0466957_0037436 | 3300044842 | Bacteria | 2921 |
| 543 | Ga0466957_0058481 | 3300044842 | Bacteria | 2362 |
| 544 | Ga0466960_0006440 | 3300044901 | Bacteria | 4710 |
| 545 | Ga0466960_0010724 | 3300044901 | Bacteria | 3812 |
| 546 | Ga0466960_0081961 | 3300044901 | Bacteria | 1628 |
| 547 | Ga0466959_0063426 | 3300045049 | Bacteria | 2683 |
| 548 | Ga0466959_0105976 | 3300045049 | Bacteria | 2010 |
| 549 | Ga0466958_0001373 | 3300045836 | Bacteria | 11504 |
| 550 | Ga0466958_0067657 | 3300045836 | Bacteria | 2182 |
| 551 | Ga0466958_0075000 | 3300045836 | Bacteria | 2074 |
| 552 | Ga0466958_0075647 | 3300045836 | Bacteria | 2066 |
| 553 | Ga0466967_0010537 | 3300045976 | Bacteria | 6942 |
| 554 | Ga0466967_0038601 | 3300045976 | Bacteria | 4097 |
| 555 | Ga0466967_0043750 | 3300045976 | Bacteria | 3879 |
| 556 | Ga0466967_0047433 | 3300045976 | Bacteria | 3745 |
| 557 | Ga0466967_0088839 | 3300045976 | Bacteria | 2805 |
| 558 | Ga0466967_0090174 | 3300045976 | Bacteria | 2785 |
| 559 | Ga0466967_0096159 | 3300045976 | Bacteria | 2701 |
| 560 | Ga0495592_0057277 | 3300046454 | Bacteria | 2877 |
| 561 | Ga0495629_0000899 | 3300046459 | Bacteria | 23864 |
| 562 | Ga0495629_0051881 | 3300046459 | Bacteria | 2870 |
| 563 | Ga0495638_0019649 | 3300046460 | Bacteria | 4468 |
| 564 | Ga0495641_0027036 | 3300046461 | Bacteria | 2794 |
| 565 | Ga0495641_0040289 | 3300046461 | Bacteria | 2173 |
| 566 | Ga0495651_0004912 | 3300046462 | Bacteria | 10227 |
| 567 | Ga0495651_0070075 | 3300046462 | Bacteria | 2669 |
| 568 | Ga0495653_0049986 | 3300046463 | Bacteria | 3217 |
| 569 | Ga0495662_0040659 | 3300046476 | Bacteria | 2245 |
| 570 | Ga0495664_0041217 | 3300046477 | Bacteria | 2731 |
| 571 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 572 | Ga0495608_0016334 | 3300046511 | Bacteria | 5136 |
| 573 | Ga0495620_0036222 | 3300046515 | Bacteria | 2209 |
| 574 | Ga0495630_0001450 | 3300046517 | Bacteria | 16430 |
| 575 | Ga0495630_0089710 | 3300046517 | Bacteria | 2322 |
| 576 | Ga0495637_0043437 | 3300046520 | Bacteria | 1918 |
| 577 | Ga0495652_0032691 | 3300046529 | Bacteria | 4547 |
| 578 | Ga0495665_0041579 | 3300046531 | Bacteria | 2447 |
| 579 | Ga0495622_0000076 | 3300046557 | Bacteria | 86777 |
| 580 | Ga0495667_0001386 | 3300046559 | Bacteria | 15954 |
| 581 | Ga0495668_0099388 | 3300046616 | Bacteria | 1592 |
| 582 | Ga0495611_0028032 | 3300046648 | Bacteria | 2466 |
| 583 | Ga0495635_0035246 | 3300046663 | Bacteria | 3470 |
| 584 | Ga0495661_0081058 | 3300046665 | Bacteria | 1871 |
| 585 | Ga0495588_0000247 | 3300046674 | Bacteria | 45295 |
| 586 | Ga0495657_0099895 | 3300046675 | Bacteria | 1850 |
| 587 | Ga0495599_0032632 | 3300046678 | Bacteria | 3269 |
| 588 | Ga0495647_0000307 | 3300046681 | Bacteria | 13755 |
| 589 | Ga0495647_0040683 | 3300046681 | Bacteria | 1767 |
| 590 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 591 | Ga0495624_0000196 | 3300046690 | Bacteria | 46319 |
| 592 | Ga0495624_0041006 | 3300046690 | Bacteria | 2963 |
| 593 | Ga0495671_0054600 | 3300046692 | Bacteria | 1980 |
| 594 | Ga0495649_0090744 | 3300046694 | Bacteria | 1629 |
| 595 | Ga0495589_0059270 | 3300046794 | Bacteria | 1882 |
| 596 | Ga0495600_0010574 | 3300046809 | Bacteria | 5730 |
| 597 | Ga0495581_0078165 | 3300047315 | Bacteria | 1915 |
| 598 | Ga0495604_0000448 | 3300047317 | Bacteria | 36537 |
| 599 | Ga0495672_0008631 | 3300047320 | Bacteria | 7495 |
| 600 | Ga0495676_0045128 | 3300047321 | Bacteria | 3590 |
| 601 | Ga0495680_0012579 | 3300047322 | Bacteria | 7437 |
| 602 | Ga0495680_0079033 | 3300047322 | Bacteria | 2488 |
| 603 | Ga0495680_0165455 | 3300047322 | Bacteria | 1604 |
| 604 | Ga0495675_0109406 | 3300047444 | Bacteria | 1726 |
| 605 | Ga0495677_0019440 | 3300047445 | Bacteria | 2463 |
| 606 | Ga0495673_0016778 | 3300047469 | Bacteria | 3734 |
| 607 | Ga0495684_0107659 | 3300047471 | Bacteria | 2105 |
| 608 | Ga0495686_0085374 | 3300047472 | Bacteria | 1922 |
| 609 | Ga0495593_0053739 | 3300047673 | Bacteria | 2125 |
| 610 | Ga0495602_0034328 | 3300048088 | Bacteria | 4747 |
| 611 | Ga0495626_0044170 | 3300048091 | Bacteria | 2087 |
| 612 | Ga0496100_0000115 | 3300048903 | Bacteria | 45942 |
| 613 | Ga0496100_0000248 | 3300048903 | Bacteria | 28219 |
| 614 | Ga0496100_0002933 | 3300048903 | Bacteria | 8767 |
| 615 | Ga0496100_0016650 | 3300048903 | Bacteria | 4322 |
| 616 | Ga0496100_0041825 | 3300048903 | Bacteria | 2924 |
| 617 | Ga0496100_0073614 | 3300048903 | Bacteria | 2287 |
| 618 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 619 | Ga0496101_0000262 | 3300048904 | Bacteria | 37343 |
| 620 | Ga0496101_0001407 | 3300048904 | Bacteria | 14398 |
| 621 | Ga0496101_0010040 | 3300048904 | Bacteria | 6238 |
| 622 | Ga0496101_0012992 | 3300048904 | Bacteria | 5570 |
| 623 | Ga0496101_0027119 | 3300048904 | Bacteria | 3986 |
| 624 | Ga0496101_0044251 | 3300048904 | Bacteria | 3185 |
| 625 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 626 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 627 | Ga0496102_0000427 | 3300048905 | Bacteria | 48669 |
| 628 | Ga0496102_0000473 | 3300048905 | Bacteria | 44556 |
| 629 | Ga0496102_0002046 | 3300048905 | Bacteria | 17412 |
| 630 | Ga0496102_0002055 | 3300048905 | Bacteria | 17349 |
| 631 | Ga0496102_0006363 | 3300048905 | Bacteria | 10069 |
| 632 | Ga0496102_0011131 | 3300048905 | Bacteria | 7747 |
| 633 | Ga0496102_0011180 | 3300048905 | Bacteria | 7730 |
| 634 | Ga0496102_0051271 | 3300048905 | Bacteria | 3759 |
| 635 | Ga0496102_0073611 | 3300048905 | Bacteria | 3139 |
| 636 | Ga0496102_0096456 | 3300048905 | Bacteria | 2741 |
| 637 | Ga0496102_0101390 | 3300048905 | Bacteria | 2674 |
| 638 | Ga0496102_0174137 | 3300048905 | Bacteria | 2026 |
| 639 | Ga0496102_0236043 | 3300048905 | Bacteria | 1724 |
| 640 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 641 | Ga0496103_0000124 | 3300048906 | Bacteria | 83703 |
| 642 | Ga0496103_0000228 | 3300048906 | Bacteria | 54634 |
| 643 | Ga0496103_0000577 | 3300048906 | Bacteria | 28994 |
| 644 | Ga0496103_0000826 | 3300048906 | Bacteria | 22737 |
| 645 | Ga0496103_0004385 | 3300048906 | Bacteria | 8563 |
| 646 | Ga0496103_0009160 | 3300048906 | Bacteria | 5862 |
| 647 | Ga0496103_0013663 | 3300048906 | Bacteria | 4817 |
| 648 | Ga0496103_0020956 | 3300048906 | Bacteria | 3930 |
| 649 | Ga0496103_0063027 | 3300048906 | Bacteria | 2308 |
| 650 | Ga0496103_0074754 | 3300048906 | Bacteria | 2124 |
| 651 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 652 | Ga0496104_0001982 | 3300048907 | Bacteria | 17745 |
| 653 | Ga0496104_0004190 | 3300048907 | Bacteria | 12525 |
| 654 | Ga0496104_0012997 | 3300048907 | Bacteria | 7494 |
| 655 | Ga0496104_0017430 | 3300048907 | Bacteria | 6539 |
| 656 | Ga0496104_0047233 | 3300048907 | Bacteria | 4058 |
| 657 | Ga0496104_0058256 | 3300048907 | Bacteria | 3656 |
| 658 | Ga0496104_0199897 | 3300048907 | Bacteria | 1911 |
| 659 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 660 | Ga0496105_0004544 | 3300048908 | Bacteria | 10454 |
| 661 | Ga0496105_0004639 | 3300048908 | Bacteria | 10358 |
| 662 | Ga0496105_0011165 | 3300048908 | Bacteria | 7085 |
| 663 | Ga0496105_0029867 | 3300048908 | Bacteria | 4463 |
| 664 | Ga0496105_0071975 | 3300048908 | Bacteria | 2857 |
| 665 | Ga0496105_0087370 | 3300048908 | Bacteria | 2576 |
| 666 | Ga0496106_0003914 | 3300048909 | Bacteria | 11116 |
| 667 | Ga0496106_0008140 | 3300048909 | Bacteria | 7744 |
| 668 | Ga0496106_0008855 | 3300048909 | Bacteria | 7439 |
| 669 | Ga0496106_0056607 | 3300048909 | Bacteria | 2964 |
| 670 | Ga0496106_0132073 | 3300048909 | Bacteria | 1959 |
| 671 | Ga0496107_0006162 | 3300048910 | Bacteria | 8238 |
| 672 | Ga0496107_0033034 | 3300048910 | Bacteria | 3701 |
| 673 | Ga0496107_0056099 | 3300048910 | Bacteria | 2846 |
| 674 | Ga0496107_0079709 | 3300048910 | Bacteria | 2387 |
| 675 | Ga0496107_0082343 | 3300048910 | Bacteria | 2347 |
| 676 | Ga0496107_0092966 | 3300048910 | Bacteria | 2205 |
| 677 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 678 | Ga0496108_0002448 | 3300048911 | Bacteria | 14844 |
| 679 | Ga0496108_0002714 | 3300048911 | Bacteria | 14144 |
| 680 | Ga0496108_0013790 | 3300048911 | Bacteria | 6592 |
| 681 | Ga0496108_0015909 | 3300048911 | Bacteria | 6132 |
| 682 | Ga0496108_0176697 | 3300048911 | Bacteria | 1848 |
| 683 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 684 | Ga0496109_0000882 | 3300048912 | Bacteria | 25056 |
| 685 | Ga0496109_0002062 | 3300048912 | Bacteria | 16675 |
| 686 | Ga0496109_0029930 | 3300048912 | Bacteria | 4880 |
| 687 | Ga0496109_0041287 | 3300048912 | Bacteria | 4179 |
| 688 | Ga0496109_0042404 | 3300048912 | Bacteria | 4121 |
| 689 | Ga0496109_0061436 | 3300048912 | Bacteria | 3435 |
| 690 | Ga0496109_0095485 | 3300048912 | Bacteria | 2753 |
| 691 | Ga0496109_0153541 | 3300048912 | Bacteria | 2156 |
| 692 | Ga0496109_0160547 | 3300048912 | Bacteria | 2106 |
| 693 | Ga0496110_0000185 | 3300048913 | Bacteria | 39094 |
| 694 | Ga0496110_0000649 | 3300048913 | Bacteria | 23779 |
| 695 | Ga0496110_0022898 | 3300048913 | Bacteria | 5309 |
| 696 | Ga0496110_0041812 | 3300048913 | Bacteria | 4001 |
| 697 | Ga0496110_0046947 | 3300048913 | Bacteria | 3779 |
| 698 | Ga0496111_0000119 | 3300048914 | Bacteria | 34223 |
| 699 | Ga0496111_0002441 | 3300048914 | Bacteria | 11230 |
| 700 | Ga0496111_0024253 | 3300048914 | Bacteria | 4268 |
| 701 | Ga0496111_0086151 | 3300048914 | Bacteria | 2298 |
| 702 | Ga0496112_0001010 | 3300048915 | Bacteria | 20632 |
| 703 | Ga0496112_0002266 | 3300048915 | Bacteria | 15385 |
| 704 | Ga0496112_0016420 | 3300048915 | Bacteria | 6935 |
| 705 | Ga0496112_0032910 | 3300048915 | Bacteria | 5035 |
| 706 | Ga0496112_0057285 | 3300048915 | Bacteria | 3836 |
| 707 | Ga0496112_0086219 | 3300048915 | Bacteria | 3107 |
| 708 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 709 | Ga0496114_0000153 | 3300048917 | Bacteria | 50028 |
| 710 | Ga0496114_0000178 | 3300048917 | Bacteria | 45143 |
| 711 | Ga0496114_0004178 | 3300048917 | Bacteria | 11181 |
| 712 | Ga0496114_0008010 | 3300048917 | Bacteria | 8360 |
| 713 | Ga0496114_0015102 | 3300048917 | Bacteria | 6209 |
| 714 | Ga0496114_0018264 | 3300048917 | Bacteria | 5668 |
| 715 | Ga0496114_0028182 | 3300048917 | Bacteria | 4606 |
| 716 | Ga0496114_0049855 | 3300048917 | Bacteria | 3484 |
| 717 | Ga0496114_0065222 | 3300048917 | Bacteria | 3051 |
| 718 | Ga0496114_0074918 | 3300048917 | Bacteria | 2850 |
| 719 | Ga0496114_0131567 | 3300048917 | Bacteria | 2161 |
| 720 | Ga0496114_0146011 | 3300048917 | Bacteria | 2050 |
| 721 | Ga0496115_0004346 | 3300048918 | Bacteria | 10254 |
| 722 | Ga0496115_0061463 | 3300048918 | Bacteria | 3028 |
| 723 | Ga0496115_0093219 | 3300048918 | Bacteria | 2462 |
| 724 | Ga0496116_0000297 | 3300048919 | Bacteria | 83713 |
| 725 | Ga0496116_0005593 | 3300048919 | Bacteria | 11581 |
| 726 | Ga0496116_0076529 | 3300048919 | Bacteria | 2095 |
| 727 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 728 | Ga0496117_0001007 | 3300048920 | Bacteria | 43130 |
| 729 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 730 | Ga0496118_0000857 | 3300048921 | Bacteria | 48262 |
| 731 | Ga0496118_0001227 | 3300048921 | Bacteria | 39393 |
| 732 | Ga0496118_0001272 | 3300048921 | Bacteria | 38676 |
| 733 | Ga0496119_0000286 | 3300048922 | Bacteria | 70906 |
| 734 | Ga0496119_0001211 | 3300048922 | Bacteria | 32228 |
| 735 | Ga0496119_0006092 | 3300048922 | Bacteria | 11298 |
| 736 | Ga0496119_0013479 | 3300048922 | Bacteria | 6505 |
| 737 | Ga0496120_0001566 | 3300048923 | Bacteria | 26762 |
| 738 | Ga0496120_0032496 | 3300048923 | Bacteria | 3146 |
| 739 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 740 | Ga0496121_0000425 | 3300048924 | Bacteria | 82887 |
| 741 | Ga0496121_0001945 | 3300048924 | Bacteria | 32921 |
| 742 | Ga0496121_0033354 | 3300048924 | Bacteria | 4660 |
| 743 | Ga0496122_0000132 | 3300048925 | Bacteria | 172228 |
| 744 | Ga0496122_0021059 | 3300048925 | Bacteria | 5856 |
| 745 | Ga0496123_0006535 | 3300048926 | Bacteria | 11261 |
| 746 | Ga0496123_0009503 | 3300048926 | Bacteria | 8750 |
| 747 | Ga0496123_0031449 | 3300048926 | Bacteria | 3861 |
| 748 | Ga0496124_0000106 | 3300048927 | Bacteria | 172511 |
| 749 | Ga0496124_0049234 | 3300048927 | Bacteria | 3595 |
| 750 | Ga0496124_0119605 | 3300048927 | Bacteria | 2107 |
| 751 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 752 | Ga0496125_0005528 | 3300048928 | Bacteria | 13995 |
| 753 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 754 | Ga0496126_0000666 | 3300048929 | Bacteria | 63592 |
| 755 | Ga0496126_0002345 | 3300048929 | Bacteria | 25883 |
| 756 | Ga0496126_0002811 | 3300048929 | Bacteria | 22838 |
| 757 | Ga0496126_0030074 | 3300048929 | Bacteria | 5152 |
| 758 | Ga0496126_0127491 | 3300048929 | Bacteria | 2202 |
| 759 | Ga0496126_0132159 | 3300048929 | Bacteria | 2156 |
| 760 | Ga0501031_0000115 | 3300049568 | Bacteria | 43139 |
| 761 | Ga0501031_0000689 | 3300049568 | Bacteria | 20159 |
| 762 | Ga0501032_0000052 | 3300049569 | Bacteria | 101001 |
| 763 | Ga0501032_0003025 | 3300049569 | Bacteria | 13037 |
| 764 | Ga0501033_0003226 | 3300049570 | Bacteria | 13490 |
| 765 | Ga0501033_0081573 | 3300049570 | Bacteria | 2372 |
| 766 | Ga0501034_0003913 | 3300049571 | Bacteria | 16733 |
| 767 | Ga0501034_0007479 | 3300049571 | Bacteria | 11623 |
| 768 | Ga0501034_0007562 | 3300049571 | Bacteria | 11562 |
| 769 | Ga0501034_0009939 | 3300049571 | Bacteria | 9944 |
| 770 | Ga0501034_0018093 | 3300049571 | Bacteria | 7231 |
| 771 | Ga0501034_0042719 | 3300049571 | Bacteria | 4589 |
| 772 | Ga0501034_0077054 | 3300049571 | Bacteria | 3340 |
| 773 | Ga0501036_0000061 | 3300049572 | Bacteria | 71856 |
| 774 | Ga0501036_0007304 | 3300049572 | Bacteria | 9001 |
| 775 | Ga0501036_0007724 | 3300049572 | Bacteria | 8787 |
| 776 | Ga0501037_0000046 | 3300049573 | Bacteria | 116524 |
| 777 | Ga0501037_0000759 | 3300049573 | Bacteria | 24321 |
| 778 | Ga0501037_0009351 | 3300049573 | Bacteria | 7195 |
| 779 | Ga0501037_0032693 | 3300049573 | Bacteria | 3843 |
| 780 | Ga0501038_0000068 | 3300049574 | Bacteria | 84886 |
| 781 | Ga0501038_0001047 | 3300049574 | Bacteria | 24924 |
| 782 | Ga0501038_0037505 | 3300049574 | Bacteria | 4249 |
| 783 | Ga0501039_0000292 | 3300049575 | Bacteria | 35532 |
| 784 | Ga0501039_0007114 | 3300049575 | Bacteria | 8525 |
| 785 | Ga0501039_0015833 | 3300049575 | Bacteria | 5774 |
| 786 | Ga0501039_0017339 | 3300049575 | Bacteria | 5525 |
| 787 | Ga0501039_0089429 | 3300049575 | Bacteria | 2400 |
| 788 | Ga0501039_0125632 | 3300049575 | Bacteria | 2012 |
| 789 | Ga0501041_0018231 | 3300049577 | Bacteria | 4180 |
| 790 | Ga0501041_0089571 | 3300049577 | Bacteria | 1899 |
| 791 | Ga0501042_0083451 | 3300049578 | Bacteria | 2291 |
| 792 | Ga0501043_0000340 | 3300049579 | Bacteria | 42317 |
| 793 | Ga0501043_0006218 | 3300049579 | Bacteria | 9591 |
| 794 | Ga0501043_0012119 | 3300049579 | Bacteria | 6741 |
| 795 | Ga0501043_0019541 | 3300049579 | Bacteria | 5317 |
| 796 | Ga0501043_0119895 | 3300049579 | Bacteria | 2063 |
| 797 | Ga0501046_0000102 | 3300049580 | Bacteria | 89938 |
| 798 | Ga0501046_0000695 | 3300049580 | Bacteria | 32596 |
| 799 | Ga0501046_0013449 | 3300049580 | Bacteria | 6928 |
| 800 | Ga0501047_0001039 | 3300049581 | Bacteria | 27771 |
| 801 | Ga0501047_0005250 | 3300049581 | Bacteria | 12168 |
| 802 | Ga0501047_0006620 | 3300049581 | Bacteria | 10899 |
| 803 | Ga0501048_0000006 | 3300049582 | Bacteria | 93252 |
| 804 | Ga0501048_0001635 | 3300049582 | Bacteria | 17071 |
| 805 | Ga0501048_0086500 | 3300049582 | Bacteria | 2211 |
| 806 | Ga0501067_0001571 | 3300049583 | Bacteria | 12490 |
| 807 | Ga0501067_0008217 | 3300049583 | Bacteria | 5795 |
| 808 | Ga0501068_0014755 | 3300049584 | Bacteria | 4471 |
| 809 | Ga0501068_0021950 | 3300049584 | Bacteria | 3731 |
| 810 | Ga0501069_0005606 | 3300049585 | Bacteria | 6529 |
| 811 | Ga0501069_0052816 | 3300049585 | Bacteria | 2264 |
| 812 | Ga0501070_0000139 | 3300049586 | Bacteria | 65962 |
| 813 | Ga0501070_0001449 | 3300049586 | Bacteria | 21219 |
| 814 | Ga0501071_0028813 | 3300049587 | Bacteria | 3915 |
| 815 | Ga0501071_0048989 | 3300049587 | Bacteria | 3040 |
| 816 | Ga0501072_0001960 | 3300049588 | Bacteria | 15333 |
| 817 | Ga0501072_0005664 | 3300049588 | Bacteria | 9511 |
| 818 | Ga0501074_0000256 | 3300049590 | Bacteria | 30065 |
| 819 | Ga0501074_0007580 | 3300049590 | Bacteria | 7853 |
| 820 | Ga0501075_0013424 | 3300049591 | Bacteria | 5844 |
| 821 | Ga0501076_0001319 | 3300049592 | Bacteria | 16559 |
| 822 | Ga0501076_0124969 | 3300049592 | Bacteria | 2084 |
| 823 | Ga0501077_0002277 | 3300049593 | Bacteria | 11562 |
| 824 | Ga0501079_0003278 | 3300049741 | Bacteria | 11859 |
| 825 | Ga0501080_0000051 | 3300049742 | Bacteria | 75804 |
| 826 | Ga0501081_0007069 | 3300049743 | Bacteria | 7297 |
| 827 | Ga0501081_0009280 | 3300049743 | Bacteria | 6408 |
| 828 | Ga0501083_0002108 | 3300049744 | Bacteria | 13653 |
| 829 | Ga0501035_0000321 | 3300049822 | Bacteria | 55455 |
| 830 | Ga0501035_0021506 | 3300049822 | Bacteria | 5930 |
| 831 | Ga0501035_0137976 | 3300049822 | Bacteria | 2122 |
| 832 | Ga0501044_0000137 | 3300049823 | Bacteria | 89352 |
| 833 | Ga0501044_0014259 | 3300049823 | Bacteria | 8582 |
| 834 | Ga0501044_0093370 | 3300049823 | Bacteria | 3034 |
| 835 | Ga0501044_0098533 | 3300049823 | Bacteria | 2943 |
| 836 | Ga0501045_0000759 | 3300049824 | Bacteria | 20665 |
| 837 | Ga0501045_0004172 | 3300049824 | Bacteria | 9983 |
| 838 | nmdc:mga03n38_2544_c1 | 3300050490 | Bacteria | 5659 |
| 839 | nmdc:mga03n38_2774_c1 | 3300050490 | Bacteria | 5501 |
| 840 | nmdc:mga03n38_43742_c1 | 3300050490 | Bacteria | 1964 |
| 841 | nmdc:mga00v17_1112_c1 | 3300050491 | Bacteria | 14123 |
| 842 | nmdc:mga00v17_1395_c1 | 3300050491 | Bacteria | 11472 |
| 843 | nmdc:mga00v17_18036_c1 | 3300050491 | Bacteria | 4006 |
| 844 | nmdc:mga00v17_21287_c1 | 3300050491 | Bacteria | 3726 |
| 845 | nmdc:mga00v17_26340_c1 | 3300050491 | Bacteria | 3387 |
| 846 | nmdc:mga00v17_55615_c1 | 3300050491 | Bacteria | 2417 |
| 847 | nmdc:mga0yw44_17378_c1 | 3300050492 | Bacteria | 3913 |
| 848 | nmdc:mga0yw44_1762_c1 | 3300050492 | Bacteria | 8818 |
| 849 | nmdc:mga0yw44_3292_c1 | 3300050492 | Bacteria | 7141 |
| 850 | nmdc:mga0yw44_34620_c1 | 3300050492 | Bacteria | 2960 |
| 851 | nmdc:mga0yw44_4326_c1 | 3300050492 | Bacteria | 6486 |
| 852 | nmdc:mga0yw44_4737_c1 | 3300050492 | Bacteria | 6300 |
| 853 | nmdc:mga06z11_10749_c1 | 3300050494 | Bacteria | 3915 |
| 854 | nmdc:mga04h51_21315_c1 | 3300050495 | Bacteria | 1948 |
| 855 | nmdc:mga07m45_23424_c1 | 3300050496 | Bacteria | 3375 |
| 856 | nmdc:mga07m45_41212_c1 | 3300050496 | Bacteria | 2585 |
| 857 | nmdc:mga07m45_6183_c1 | 3300050496 | Bacteria | 6039 |
| 858 | nmdc:mga07m45_8326_c1 | 3300050496 | Bacteria | 5326 |
| 859 | nmdc:mga05p37_22514_c1 | 3300050507 | Bacteria | 7642 |
| 860 | nmdc:mga05p37_60697_c1 | 3300050507 | Bacteria | 4655 |
| 861 | nmdc:mga09592_105574_c1 | 3300050508 | Bacteria | 2415 |
| 862 | nmdc:mga06r32_166033_c1 | 3300050510 | Bacteria | 2190 |
| 863 | nmdc:mga06r32_181758_c1 | 3300050510 | Bacteria | 2089 |
| 864 | nmdc:mga06r32_25842_c1 | 3300050510 | Bacteria | 5466 |
| 865 | nmdc:mga06r32_36408_c1 | 3300050510 | Bacteria | 4649 |
| 866 | nmdc:mga06r32_6628_c1 | 3300050510 | Bacteria | 10407 |
| 867 | nmdc:mga08y16_101120_c1 | 3300050511 | Bacteria | 3001 |
| 868 | nmdc:mga08y16_132329_c1 | 3300050511 | Bacteria | 2593 |
| 869 | nmdc:mga08y16_6449_c1 | 3300050511 | Bacteria | 12306 |
| 870 | nmdc:mga08y16_7008_c1 | 3300050511 | Bacteria | 11820 |
| 871 | nmdc:mga08y16_80980_c1 | 3300050511 | Bacteria | 3386 |
| 872 | nmdc:mga0n895_70602_c1 | 3300050512 | Bacteria | 3462 |
| 873 | nmdc:mga0n895_74334_c1 | 3300050512 | Bacteria | 3376 |
| 874 | nmdc:mga0n895_8375_c1 | 3300050512 | Bacteria | 8950 |
| 875 | nmdc:mga0rr50_1370_c1 | 3300050513 | Bacteria | 13349 |
| 876 | nmdc:mga0rr50_42753_c1 | 3300050513 | Bacteria | 3311 |
| 877 | nmdc:mga08x19_1536_c1 | 3300050514 | Bacteria | 14321 |
| 878 | nmdc:mga08x19_51315_c1 | 3300050514 | Bacteria | 2649 |
| 879 | nmdc:mga0a205_34993_c1 | 3300050515 | Bacteria | 4823 |
| 880 | nmdc:mga0a205_783_c2 | 3300050515 | Bacteria | 17242 |
| 881 | nmdc:mga0sz30_1720_c1 | 3300050516 | Bacteria | 7765 |
| 882 | nmdc:mga0sz30_31391_c1 | 3300050516 | Bacteria | 2198 |
| 883 | nmdc:mga0sz30_9291_c1 | 3300050516 | Bacteria | 3167 |
| 884 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 885 | Ga0500610_0001987 | 3300053079 | Bacteria | 7296 |
| 886 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 887 | Ga0500641_0000526 | 3300053096 | Bacteria | 13777 |
| 888 | Ga0500641_0004436 | 3300053096 | Bacteria | 4963 |
| 889 | Ga0500562_001179 | 3300053108 | Bacteria | 6445 |
| 890 | Ga0500628_000024 | 3300053129 | Bacteria | 64538 |
| 891 | Ga0500568_0000039 | 3300053139 | Bacteria | 134018 |
| 892 | Ga0500616_0000535 | 3300053153 | Bacteria | 47523 |
| 893 | Ga0500616_0002876 | 3300053153 | Bacteria | 13812 |
| 894 | Ga0500616_0007902 | 3300053153 | Bacteria | 6684 |
| 895 | Ga0500616_0038579 | 3300053153 | Bacteria | 2580 |
| 896 | Ga0500645_000063 | 3300053730 | Bacteria | 85018 |
| 897 | Ga0501084_0001328 | 3300054114 | Bacteria | 19507 |
| 898 | Ga0501084_0116680 | 3300054114 | Bacteria | 2244 |
| 899 | Ga0501082_0003048 | 3300060353 | Bacteria | 14621 |
| 900 | Ga0501082_0065353 | 3300060353 | Bacteria | 3133 |
| 901 | Ga0466962_0014986 | 3300061719 | Bacteria | 3736 |
| 902 | 2643851843 | 2643221567 | Bacteria | 4163945 |
| 903 | 2644137568 | 2643221624 | Bacteria | 4384879 |
| 904 | 2644456039 | 2643221681 | Bacteria | 3707866 |
| 905 | 2644491205 | 2643221687 | Bacteria | 6500351 |
| 906 | 2644538700 | 2643221697 | Bacteria | 3575694 |
| 907 | 2644609989 | 2643221711 | Bacteria | 4865335 |
| 908 | 2644636617 | 2643221715 | Bacteria | 6671032 |
| 909 | 2645720701 | 2643221961 | Bacteria | 3919167 |
| 910 | 2645723719 | 2643221962 | Bacteria | 3874254 |
| 911 | 2731909430 | 2731639228 | Bacteria | 4187555 |
| 912 | 2738666841 | 2738541264 | Bacteria | 5935393 |
| 913 | 2739145685 | 2738541356 | Bacteria | 5935017 |
| 914 | 2774395152 | 2773857762 | Bacteria | 5971770 |
| 915 | 2799186767 | 2799112218 | Bacteria | 4315149 |
| 916 | 2809194013 | 2808606439 | Bacteria | 5952208 |
| 917 | 2812348750 | 2811994878 | Bacteria | 5992952 |
| 918 | 2816427141 | 2816332119 | Bacteria | 8120218 |
| 919 | 2852643855 | 2852643534 | Bacteria | 3013378 |
| 920 | 2870782933 | 2870782633 | Bacteria | 9624083 |
| 921 | 2883825819 | 2883821847 | Bacteria | 5121194 |
| 922 | 2891973486 | 2891968417 | Bacteria | 5821697 |
| 923 | 2902797317 | 2902792274 | Bacteria | 7270173 |
| 924 | 2902814579 | 2902810491 | Bacteria | 6794147 |
| 925 | 2902843024 | 2902837492 | Bacteria | 6697721 |
| 926 | 2904769979 | 2904765812 | Bacteria | 5369154 |
| 927 | 2904771171 | 2904770941 | Bacteria | 5580202 |
| 928 | 2908815215 | 2908811453 | Bacteria | 5478616 |
| 929 | 2919423334 | 2919420072 | Bacteria | 5390363 |
| 930 | 2919435942 | 2919432681 | Bacteria | 5390474 |
| 931 | 2919448712 | 2919446982 | Bacteria | 3994487 |
| 932 | 2929218388 | 2929212328 | Bacteria | 7708288 |
| 933 | 2939585034 | 2939582691 | Bacteria | 7088898 |
| 934 | 2966923363 | 2966921586 | Bacteria | 3092803 |
| 935 | 2974318556 | 2974315732 | Bacteria | 4602776 |
| 936 | 2984526767 | 2984523437 | Bacteria | 4508481 |
| 937 | 2984578042 | 2984576629 | Bacteria | 4248407 |
| 938 | 2984593939 | 2984592036 | Bacteria | 3670284 |
| 939 | 2990257556 | 2990256926 | Bacteria | 4252839 |
| 940 | Ga0068860_100049579 | |||
| 941 | JGI24741J21665_1004231 | |||
| 942 | JGI24740J21852_10012686 | |||
| 943 | JGI24739J22299_10007492 | |||
| 944 | JGI24737J22298_10014225 | |||
| 945 | JGI24735J21928_10014328 | |||
| 946 | JGI24750J21931_1003282 | |||
| 947 | JGI24745J21846_1001386 | |||
| 948 | JGI24744J21845_10002686 | |||
| 949 | JGI24033J26618_1000922 | |||
| 950 | JGI24751J29686_10002325 | |||
| 951 | JGI24751J29686_10006759 | |||
| 952 | JGI25406J46586_10005948 | |||
| 953 | JGI25407J50210_10000047 | |||
| 954 | JGI25407J50210_10011902 | |||
| 955 | Ga0055540_1000065 | |||
| 956 | Ga0055540_1001113 | |||
| 957 | Ga0055540_1001796 | |||
| 958 | Ga0055540_1003135 | |||
| 959 | Ga0070658_10077740 | |||
| 960 | Ga0070658_10093759 | |||
| 961 | Ga0070676_10008718 | |||
| 962 | Ga0070683_100000527 | |||
| 963 | Ga0070683_100079610 | |||
| 964 | Ga0070683_100207572 | |||
| 965 | Ga0070690_100021595 | |||
| 966 | Ga0070670_100105668 | |||
| 967 | Ga0068869_100014020 | |||
| 968 | Ga0070666_10055053 | |||
| 969 | Ga0070682_100001211 | |||
| 970 | Ga0070682_100006610 | |||
| 971 | Ga0070682_100090917 | |||
| 972 | Ga0068868_100019969 | |||
| 973 | Ga0068868_100048728 | |||
| 974 | Ga0068868_100177504 | |||
| 975 | Ga0070689_100016786 | |||
| 976 | Ga0070661_100000110 | |||
| 977 | Ga0070661_100013458 | |||
| 978 | Ga0070661_100071708 | |||
| 979 | Ga0070661_100129182 | |||
| 980 | Ga0070692_10012228 | |||
| 981 | Ga0070668_100001430 | |||
| 982 | Ga0070668_100002698 | |||
| 983 | Ga0070668_100007667 | |||
| 984 | Ga0070668_100028160 | |||
| 985 | Ga0070668_100028625 | |||
| 986 | Ga0070668_100045992 | |||
| 987 | Ga0070668_100063880 | |||
| 988 | Ga0070668_100106218 | |||
| 989 | Ga0070669_100016048 | |||
| 990 | Ga0070671_100002337 | |||
| 991 | Ga0070674_100000153 | |||
| 992 | Ga0070688_100000053 | |||
| 993 | Ga0070659_100000013 | |||
| 994 | Ga0070659_100016187 | |||
| 995 | Ga0070667_100000840 | |||
| 996 | Ga0070667_100008468 | |||
| 997 | Ga0070667_100028629 | |||
| 998 | Ga0070667_100053878 | |||
| 999 | Ga0070714_100011637 | |||
| 1000 | Ga0070714_100149830 | |||
| 1001 | Ga0070713_100133350 | |||
| 1002 | Ga0070710_10001412 | |||
| 1003 | Ga0070710_10012538 | |||
| 1004 | Ga0070701_10022358 | |||
| 1005 | Ga0070711_100000205 | |||
| 1006 | Ga0070711_100010610 | |||
| 1007 | Ga0070705_100018204 | |||
| 1008 | Ga0070694_100048154 | |||
| 1009 | Ga0070663_100031238 | |||
| 1010 | Ga0070663_100083040 | |||
| 1011 | Ga0070678_100004645 | |||
| 1012 | Ga0070678_100021506 | |||
| 1013 | Ga0070662_100020708 | |||
| 1014 | Ga0070662_100096833 | |||
| 1015 | Ga0070662_100124614 | |||
| 1016 | Ga0070681_10043343 | |||
| 1017 | Ga0068867_100006760 | |||
| 1018 | Ga0068867_100026849 | |||
| 1019 | Ga0068867_100156717 | |||
| 1020 | Ga0070685_10000086 | |||
| 1021 | Ga0070685_10014773 | |||
| 1022 | Ga0070685_10033305 | |||
| 1023 | Ga0070707_100165503 | |||
| 1024 | Ga0070679_100002668 | |||
| 1025 | Ga0068853_100033816 | |||
| 1026 | Ga0068853_100071658 | |||
| 1027 | Ga0068853_100149071 | |||
| 1028 | Ga0070686_100048679 | |||
| 1029 | Ga0070696_100034595 | |||
| 1030 | Ga0070696_100166725 | |||
| 1031 | Ga0070693_100019527 | |||
| 1032 | Ga0070665_100004960 | |||
| 1033 | Ga0070665_100032045 | |||
| 1034 | Ga0070665_100043787 | |||
| 1035 | Ga0070665_100075978 | |||
| 1036 | Ga0070704_100000289 | |||
| 1037 | Ga0070704_100064102 | |||
| 1038 | Ga0068857_100084732 | |||
| 1039 | Ga0068854_100025337 | |||
| 1040 | Ga0068856_100001228 | |||
| 1041 | Ga0070702_100029922 | |||
| 1042 | Ga0070702_100031581 | |||
| 1043 | Ga0068852_100059236 | |||
| 1044 | Ga0068859_100002544 | |||
| 1045 | Ga0068859_100023558 | |||
| 1046 | Ga0068859_100107717 | |||
| 1047 | Ga0068866_10001088 | |||
| 1048 | Ga0068861_100002774 | |||
| 1049 | Ga0068863_100000373 | |||
| 1050 | Ga0068863_100024127 | |||
| 1051 | Ga0068863_100093058 | |||
| 1052 | Ga0068858_100003979 | |||
| 1053 | Ga0068858_100046913 | |||
| 1054 | Ga0068858_100058513 | |||
| 1055 | Ga0068860_100000011 | |||
| 1056 | Ga0068860_100033567 | |||
| 1057 | Ga0068860_100107761 | |||
| 1058 | Ga0068862_100000139 | |||
| 1059 | Ga0068862_100000366 | |||
| 1060 | Ga0068862_100005265 | |||
| 1061 | Ga0068862_100021554 | |||
| 1062 | Ga0068862_100129428 | |||
| 1063 | Ga0081455_10000106 | |||
| 1064 | Ga0081455_10002738 | |||
| 1065 | Ga0081455_10027460 | |||
| 1066 | Ga0081455_10037772 | |||
| 1067 | Ga0081455_10084826 | |||
| 1068 | Ga0081538_10000763 | |||
| 1069 | Ga0081538_10000973 | |||
| 1070 | Ga0081540_1000046 | |||
| 1071 | Ga0081540_1011454 | |||
| 1072 | Ga0081540_1013115 | |||
| 1073 | Ga0081539_10000236 | |||
| 1074 | Ga0081539_10001074 | |||
| 1075 | Ga0081539_10001710 | |||
| 1076 | Ga0081539_10004566 | |||
| 1077 | Ga0081539_10010378 | |||
| 1078 | Ga0070717_10000059 | |||
| 1079 | Ga0070717_10118149 | |||
| 1080 | Ga0075365_10000193 | |||
| 1081 | Ga0075365_10000898 | |||
| 1082 | Ga0075365_10009502 | |||
| 1083 | Ga0075363_100000427 | |||
| 1084 | Ga0075363_100002846 | |||
| 1085 | Ga0075363_100016916 | |||
| 1086 | Ga0075363_100040584 | |||
| 1087 | Ga0075364_10000577 | |||
| 1088 | Ga0075364_10000892 | |||
| 1089 | Ga0075364_10001241 | |||
| 1090 | Ga0075364_10003280 | |||
| 1091 | Ga0075364_10052920 | |||
| 1092 | Ga0075364_10062082 | |||
| 1093 | Ga0075364_10105557 | |||
| 1094 | Ga0075432_10000398 | |||
| 1095 | Ga0070716_100019063 | |||
| 1096 | Ga0070716_100025057 | |||
| 1097 | Ga0070712_100021922 | |||
| 1098 | Ga0075367_10016382 | |||
| 1099 | Ga0075369_10002193 | |||
| 1100 | Ga0075369_10011109 | |||
| 1101 | Ga0075369_10014500 | |||
| 1102 | Ga0075369_10046765 | |||
| 1103 | Ga0075370_10007355 | |||
| 1104 | Ga0075370_10009536 | |||
| 1105 | Ga0075370_10038551 | |||
| 1106 | Ga0075428_100016930 | |||
| 1107 | Ga0075428_100020281 | |||
| 1108 | Ga0075431_100012901 | |||
| 1109 | Ga0075431_100019604 | |||
| 1110 | Ga0075431_100034685 | |||
| 1111 | Ga0075433_10001708 | |||
| 1112 | Ga0075433_10070863 | |||
| 1113 | Ga0075434_100004328 | |||
| 1114 | Ga0075434_100004603 | |||
| 1115 | Ga0075434_100019309 | |||
| 1116 | Ga0075429_100003236 | |||
| 1117 | Ga0068865_100014483 | |||
| 1118 | Ga0068865_100049452 | |||
| 1119 | Ga0068865_100103041 | |||
| 1120 | Ga0075436_100002186 | |||
| 1121 | Ga0075436_100059928 | |||
| 1122 | Ga0097620_100002544 | |||
| 1123 | Ga0097620_100023557 | |||
| 1124 | Ga0097620_100107709 | |||
| 1125 | Ga0075435_100000562 | |||
| 1126 | Ga0075435_100061086 | |||
| 1127 | Ga0105251_10053118 | |||
| 1128 | Ga0111539_10001351 | |||
| 1129 | Ga0111539_10010304 | |||
| 1130 | Ga0111539_10017096 | |||
| 1131 | Ga0111539_10072393 | |||
| 1132 | Ga0105245_10004802 | |||
| 1133 | Ga0105245_10015520 | |||
| 1134 | Ga0105245_10018530 | |||
| 1135 | Ga0105245_10027146 | |||
| 1136 | Ga0105245_10072901 | |||
| 1137 | Ga0105245_10093030 | |||
| 1138 | Ga0105247_10000067 | |||
| 1139 | Ga0114129_10018395 | |||
| 1140 | Ga0114129_10085188 | |||
| 1141 | Ga0105243_10003878 | |||
| 1142 | Ga0105243_10027691 | |||
| 1143 | Ga0105243_10029456 | |||
| 1144 | Ga0105243_10049144 | |||
| 1145 | Ga0105241_10015475 | |||
| 1146 | Ga0105242_10000052 | |||
| 1147 | Ga0105242_10003061 | |||
| 1148 | Ga0105248_10000040 | |||
| 1149 | Ga0105248_10007307 | |||
| 1150 | Ga0105248_10046307 | |||
| 1151 | Ga0105248_10174132 | |||
| 1152 | Ga0105248_10256461 | |||
| 1153 | Ga0105237_10016854 | |||
| 1154 | Ga0105237_10051342 | |||
| 1155 | Ga0105237_10137143 | |||
| 1156 | Ga0105237_10164528 | |||
| 1157 | Ga0105237_10264593 | |||
| 1158 | Ga0105238_10192262 | |||
| 1159 | Ga0105249_10000001 | |||
| 1160 | Ga0105249_10000916 | |||
| 1161 | Ga0105249_10013603 | |||
| 1162 | Ga0105249_10020446 | |||
| 1163 | Ga0105239_10033519 | |||
| 1164 | Ga0105239_10046182 | |||
| 1165 | Ga0105239_10090887 | |||
| 1166 | Ga0105239_10108668 | |||
| 1167 | Ga0105246_10051975 | |||
| 1168 | Ga0105246_10072007 | |||
| 1169 | Ga0105246_10082776 | |||
| 1170 | Ga0157371_10002739 | |||
| 1171 | Ga0157369_10106863 | |||
| 1172 | Ga0157374_10033593 | |||
| 1173 | Ga0157374_10228830 | |||
| 1174 | Ga0157374_10233194 | |||
| 1175 | Ga0157378_10012869 | |||
| 1176 | Ga0157378_10104429 | |||
| 1177 | Ga0163162_10009929 | |||
| 1178 | Ga0163162_10029767 | |||
| 1179 | Ga0163162_10072586 | |||
| 1180 | Ga0163162_10074024 | |||
| 1181 | Ga0163162_10079151 | |||
| 1182 | Ga0163162_10097729 | |||
| 1183 | Ga0163162_10134826 | |||
| 1184 | Ga0163162_10348824 | |||
| 1185 | Ga0157372_10000284 | |||
| 1186 | Ga0157372_10005924 | |||
| 1187 | Ga0157372_10064155 | |||
| 1188 | Ga0157372_10168658 | |||
| 1189 | Ga0157375_10000945 | |||
| 1190 | Ga0157375_10005034 | |||
| 1191 | Ga0157375_10072195 | |||
| 1192 | Ga0157380_10000186 | |||
| 1193 | Ga0157380_10003827 | |||
| 1194 | Ga0157380_10074409 | |||
| 1195 | Ga0157377_10080449 | |||
| 1196 | Ga0157379_10025482 | |||
| 1197 | Ga0157376_10055880 | |||
| 1198 | Ga0163161_10005342 | |||
| 1199 | Ga0206353_10643868 | |||
| 1200 | Ga0213876_10001770 | |||
| 1201 | Ga0213876_10015187 | |||
| 1202 | Ga0213875_10007089 | |||
| 1203 | Ga0209673_1008850 | |||
| 1204 | Ga0209051_1000042 | |||
| 1205 | Ga0209051_1001272 | |||
| 1206 | Ga0209051_1003310 | |||
| 1207 | Ga0209051_1003693 | |||
| 1208 | Ga0207692_10016442 | |||
| 1209 | Ga0207692_10017629 | |||
| 1210 | Ga0207642_10000670 | |||
| 1211 | Ga0207642_10013194 | |||
| 1212 | Ga0207710_10000094 | |||
| 1213 | Ga0207688_10001311 | |||
| 1214 | Ga0207688_10001662 | |||
| 1215 | Ga0207688_10009551 | |||
| 1216 | Ga0207688_10015696 | |||
| 1217 | Ga0207688_10060428 | |||
| 1218 | Ga0207680_10004733 | |||
| 1219 | Ga0207680_10046470 | |||
| 1220 | Ga0207647_10016099 | |||
| 1221 | Ga0207647_10023770 | |||
| 1222 | Ga0207647_10027662 | |||
| 1223 | Ga0207647_10053948 | |||
| 1224 | Ga0207699_10006259 | |||
| 1225 | Ga0207645_10058212 | |||
| 1226 | Ga0207643_10023963 | |||
| 1227 | Ga0207705_10025934 | |||
| 1228 | Ga0207705_10040140 | |||
| 1229 | Ga0207707_10031607 | |||
| 1230 | Ga0207671_10009287 | |||
| 1231 | Ga0207671_10077218 | |||
| 1232 | Ga0207671_10087953 | |||
| 1233 | Ga0207693_10003676 | |||
| 1234 | Ga0207693_10012194 | |||
| 1235 | Ga0207693_10019923 | |||
| 1236 | Ga0207693_10043212 | |||
| 1237 | Ga0207663_10007388 | |||
| 1238 | Ga0207663_10054819 | |||
| 1239 | Ga0207662_10005997 | |||
| 1240 | Ga0207657_10023952 | |||
| 1241 | Ga0207657_10138233 | |||
| 1242 | Ga0207649_10000015 | |||
| 1243 | Ga0207649_10006432 | |||
| 1244 | Ga0207652_10009781 | |||
| 1245 | Ga0207652_10157724 | |||
| 1246 | Ga0207681_10002134 | |||
| 1247 | Ga0207659_10000707 | |||
| 1248 | Ga0207687_10002110 | |||
| 1249 | Ga0207687_10007569 | |||
| 1250 | Ga0207687_10024556 | |||
| 1251 | Ga0207687_10026230 | |||
| 1252 | Ga0207687_10119107 | |||
| 1253 | Ga0207700_10000003 | |||
| 1254 | Ga0207664_10008731 | |||
| 1255 | Ga0207644_10083867 | |||
| 1256 | Ga0207690_10000075 | |||
| 1257 | Ga0207690_10006804 | |||
| 1258 | Ga0207690_10032483 | |||
| 1259 | Ga0207706_10012125 | |||
| 1260 | Ga0207706_10017268 | |||
| 1261 | Ga0207706_10117753 | |||
| 1262 | Ga0207686_10000119 | |||
| 1263 | Ga0207686_10034284 | |||
| 1264 | Ga0207709_10013184 | |||
| 1265 | Ga0207709_10036710 | |||
| 1266 | Ga0207669_10030356 | |||
| 1267 | Ga0207669_10070907 | |||
| 1268 | Ga0207704_10008206 | |||
| 1269 | Ga0207704_10024642 | |||
| 1270 | Ga0207704_10025069 | |||
| 1271 | Ga0207665_10009146 | |||
| 1272 | Ga0207711_10000011 | |||
| 1273 | Ga0207711_10000419 | |||
| 1274 | Ga0207711_10007828 | |||
| 1275 | Ga0207711_10015373 | |||
| 1276 | Ga0207689_10006344 | |||
| 1277 | Ga0207689_10010392 | |||
| 1278 | Ga0207689_10028771 | |||
| 1279 | Ga0207689_10043062 | |||
| 1280 | Ga0207661_10000438 | |||
| 1281 | Ga0207661_10001594 | |||
| 1282 | Ga0207661_10179866 | |||
| 1283 | Ga0207679_10006499 | |||
| 1284 | Ga0207712_10000006 | |||
| 1285 | Ga0207712_10000994 | |||
| 1286 | Ga0207712_10027061 | |||
| 1287 | Ga0207712_10043652 | |||
| 1288 | Ga0207712_10082501 | |||
| 1289 | Ga0207712_10088424 | |||
| 1290 | Ga0207668_10000972 | |||
| 1291 | Ga0207668_10004404 | |||
| 1292 | Ga0207668_10069075 | |||
| 1293 | Ga0207668_10119262 | |||
| 1294 | Ga0207658_10000513 | |||
| 1295 | Ga0207658_10001083 | |||
| 1296 | Ga0207658_10004107 | |||
| 1297 | Ga0207658_10011128 | |||
| 1298 | Ga0207677_10017030 | |||
| 1299 | Ga0207677_10068318 | |||
| 1300 | Ga0207677_10083694 | |||
| 1301 | Ga0207703_10008803 | |||
| 1302 | Ga0207639_10042649 | |||
| 1303 | Ga0207639_10042898 | |||
| 1304 | Ga0207678_10018936 | |||
| 1305 | Ga0207678_10036639 | |||
| 1306 | Ga0207678_10042158 | |||
| 1307 | Ga0207678_10058204 | |||
| 1308 | Ga0207678_10181705 | |||
| 1309 | Ga0207708_10009808 | |||
| 1310 | Ga0207702_10000419 | |||
| 1311 | Ga0207702_10100883 | |||
| 1312 | Ga0207702_10111204 | |||
| 1313 | Ga0207641_10000489 | |||
| 1314 | Ga0207641_10022045 | |||
| 1315 | Ga0207648_10006599 | |||
| 1316 | Ga0207676_10003416 | |||
| 1317 | Ga0207674_10029086 | |||
| 1318 | Ga0207674_10036548 | |||
| 1319 | Ga0207675_100000896 | |||
| 1320 | Ga0207675_100002895 | |||
| 1321 | Ga0207675_100018303 | |||
| 1322 | Ga0207675_100055105 | |||
| 1323 | Ga0207683_10003700 | |||
| 1324 | Ga0207683_10012181 | |||
| 1325 | Ga0207683_10097115 | |||
| 1326 | Ga0207698_10000015 | |||
| 1327 | Ga0207698_10096122 | |||
| 1328 | Ga0207428_10001010 | |||
| 1329 | Ga0207428_10011064 | |||
| 1330 | Ga0207428_10036585 | |||
| 1331 | Ga0207428_10108580 | |||
| 1332 | Ga0207428_10113006 | |||
| 1333 | Ga0268266_10000485 | |||
| 1334 | Ga0268266_10001186 | |||
| 1335 | Ga0268266_10016797 | |||
| 1336 | Ga0268266_10031366 | |||
| 1337 | Ga0268266_10121722 | |||
| 1338 | Ga0268265_10000032 | |||
| 1339 | Ga0268265_10003823 | |||
| 1340 | Ga0268265_10039720 | |||
| 1341 | Ga0268265_10128307 | |||
| 1342 | Ga0268265_10186493 | |||
| 1343 | Ga0268265_10219233 | |||
| 1344 | Ga0268264_10000026 | |||
| 1345 | Ga0268264_10081582 | |||
| 1346 | Ga0268264_10287849 | |||
| 1347 | Ga0265337_1000012 | |||
| 1348 | Ga0265326_10000007 | |||
| 1349 | Ga0265319_1001040 | |||
| 1350 | Ga0265334_10000094 | |||
| 1351 | Ga0265322_10000001 | |||
| 1352 | Ga0265336_10004740 | |||
| 1353 | Ga0265336_10008731 | |||
| 1354 | Ga0265338_10003073 | |||
| 1355 | Ga0265338_10039663 | |||
| 1356 | Ga0265324_10001935 | |||
| 1357 | Ga0265324_10011287 | |||
| 1358 | Ga0265332_10009702 | |||
| 1359 | Ga0265328_10000659 | |||
| 1360 | Ga0265320_10000002 | |||
| 1361 | Ga0265329_10002237 | |||
| 1362 | Ga0265331_10000919 | |||
| 1363 | Ga0265327_10000011 | |||
| 1364 | Ga0265327_10000626 | |||
| 1365 | Ga0265327_10017384 | |||
| 1366 | Ga0265327_10067674 | |||
| 1367 | Ga0307513_10004621 | |||
| 1368 | Ga0307408_100009103 | |||
| 1369 | Ga0316575_10000856 | |||
| 1370 | Ga0316579_10000197 | |||
| 1371 | Ga0265314_10000224 | |||
| 1372 | Ga0265314_10087093 | |||
| 1373 | Ga0316576_10000472 | |||
| 1374 | Ga0316576_10071005 | |||
| 1375 | Ga0316578_10002095 | |||
| 1376 | Ga0316578_10029750 | |||
| 1377 | Ga0307405_10012822 | |||
| 1378 | Ga0307405_10021001 | |||
| 1379 | Ga0307413_10003082 | |||
| 1380 | Ga0307413_10008230 | |||
| 1381 | Ga0307413_10013804 | |||
| 1382 | Ga0307410_10048177 | |||
| 1383 | Ga0326468_10000144 | |||
| 1384 | Ga0307406_10000212 | |||
| 1385 | Ga0307406_10003159 | |||
| 1386 | Ga0307406_10008888 | |||
| 1387 | Ga0307407_10011467 | |||
| 1388 | Ga0307407_10023004 | |||
| 1389 | Ga0307412_10020831 | |||
| 1390 | Ga0307409_100000273 | |||
| 1391 | Ga0307409_100039242 | |||
| 1392 | Ga0307409_100069954 | |||
| 1393 | Ga0307409_100114239 | |||
| 1394 | Ga0307416_100024902 | |||
| 1395 | Ga0307416_100100022 | |||
| 1396 | Ga0307416_100333315 | |||
| 1397 | Ga0307414_10043440 | |||
| 1398 | Ga0307414_10060645 | |||
| 1399 | Ga0307414_10065657 | |||
| 1400 | Ga0307411_10030039 | |||
| 1401 | Ga0307411_10066141 | |||
| 1402 | Ga0307411_10089911 | |||
| 1403 | Ga0307411_10116855 | |||
| 1404 | Ga0307415_100002934 | |||
| 1405 | Ga0307415_100014609 | |||
| 1406 | Ga0307507_10116584 | |||
| 1407 | Ga0373926_0018656 | |||
| 1408 | Ga0373940_0015452 | |||
| 1409 | Ga0373923_0025185 | |||
| 1410 | Ga0373936_0038871 | |||
| 1411 | Ga0373945_0034978 | |||
| 1412 | Ga0373943_0019111 | |||
| 1413 | Ga0373946_0027023 | |||
| 1414 | Ga0373962_0012023 | |||
| 1415 | Ga0316574_0021377 | |||
| 1416 | Ga0316574_0050231 | |||
| 1417 | Ga0316574_0059543 | |||
| 1418 | Ga0373931_0011804 | |||
| 1419 | Ga0373931_0049431 | |||
| 1420 | Ga0373935_0012382 | |||
| 1421 | Ga0373927_0058976 | |||
| 1422 | Ga0373947_0025273 | |||
| 1423 | Ga0373937_0012589 | |||
| 1424 | Ga0316582_0000099 | |||
| 1425 | Ga0316584_0011486 | |||
| 1426 | Ga0316584_0017792 | |||
| 1427 | Ga0316584_0032919 | |||
| 1428 | Ga0373925_0114583 | |||
| 1429 | Ga0395899_0031667 | |||
| 1430 | Ga0395900_0008269 | |||
| 1431 | Ga0395900_0113694 | |||
| 1432 | Ga0395898_0005178 | |||
| 1433 | Ga0395898_0006290 | |||
| 1434 | Ga0395898_0011426 | |||
| 1435 | Ga0395898_0048546 | |||
| 1436 | Ga0395905_0004214 | |||
| 1437 | Ga0395905_0041668 | |||
| 1438 | Ga0395905_0053436 | |||
| 1439 | Ga0395905_0123278 | |||
| 1440 | Ga0436364_0908867 | |||
| 1441 | Ga0436364_1011521 | |||
| 1442 | Ga0436364_1192519 | |||
| 1443 | Ga0436364_1442254 | |||
| 1444 | Ga0395901_0003473 | |||
| 1445 | Ga0395901_0012501 | |||
| 1446 | Ga0395901_0045998 | |||
| 1447 | Ga0395901_0074150 | |||
| 1448 | Ga0395901_0170831 | |||
| 1449 | Ga0242420_004140 | |||
| 1450 | Ga0436365_0064899 | |||
| 1451 | Ga0436365_0641890 | |||
| 1452 | Ga0436365_1856170 | |||
| 1453 | Ga0436362_1177671 | |||
| 1454 | Ga0439466_0001181 | |||
| 1455 | Ga0439466_0006248 | |||
| 1456 | Ga0439466_0010202 | |||
| 1457 | Ga0439465_0001503 | |||
| 1458 | Ga0439465_0026450 | |||
| 1459 | Ga0451833_0918545 | |||
| 1460 | Ga0451837_0394872 | |||
| 1461 | Ga0439450_001482 | |||
| 1462 | Ga0439463_003079 | |||
| 1463 | Ga0439459_0009821 | |||
| 1464 | Ga0439464_0014935 | |||
| 1465 | Ga0439440_0003643 | |||
| 1466 | Ga0466972_0007601 | |||
| 1467 | Ga0466972_0013868 | |||
| 1468 | Ga0466965_0005448 | |||
| 1469 | Ga0466966_0016384 | |||
| 1470 | Ga0466966_0031501 | |||
| 1471 | Ga0466966_0033360 | |||
| 1472 | Ga0466961_0008896 | |||
| 1473 | Ga0466961_0057918 | |||
| 1474 | Ga0466963_0003743 | |||
| 1475 | Ga0466968_0001398 | |||
| 1476 | Ga0466970_0009706 | |||
| 1477 | Ga0466970_0025734 | |||
| 1478 | Ga0466970_0030982 | |||
| 1479 | Ga0466970_0032132 | |||
| 1480 | Ga0466957_0008957 | |||
| 1481 | Ga0466957_0037436 | |||
| 1482 | Ga0466957_0058481 | |||
| 1483 | Ga0466960_0006440 | |||
| 1484 | Ga0466960_0010724 | |||
| 1485 | Ga0466960_0081961 | |||
| 1486 | Ga0466959_0063426 | |||
| 1487 | Ga0466959_0105976 | |||
| 1488 | Ga0466958_0001373 | |||
| 1489 | Ga0466958_0067657 | |||
| 1490 | Ga0466958_0075000 | |||
| 1491 | Ga0466958_0075647 | |||
| 1492 | Ga0466967_0010537 | |||
| 1493 | Ga0466967_0038601 | |||
| 1494 | Ga0466967_0043750 | |||
| 1495 | Ga0466967_0047433 | |||
| 1496 | Ga0466967_0088839 | |||
| 1497 | Ga0466967_0090174 | |||
| 1498 | Ga0466967_0096159 | |||
| 1499 | Ga0495592_0057277 | |||
| 1500 | Ga0495629_0000899 | |||
| 1501 | Ga0495629_0051881 | |||
| 1502 | Ga0495638_0019649 | |||
| 1503 | Ga0495641_0027036 | |||
| 1504 | Ga0495641_0040289 | |||
| 1505 | Ga0495651_0004912 | |||
| 1506 | Ga0495651_0070075 | |||
| 1507 | Ga0495653_0049986 | |||
| 1508 | Ga0495662_0040659 | |||
| 1509 | Ga0495664_0041217 | |||
| 1510 | Ga0495594_0000012 | |||
| 1511 | Ga0495608_0016334 | |||
| 1512 | Ga0495620_0036222 | |||
| 1513 | Ga0495630_0001450 | |||
| 1514 | Ga0495630_0089710 | |||
| 1515 | Ga0495637_0043437 | |||
| 1516 | Ga0495652_0032691 | |||
| 1517 | Ga0495665_0041579 | |||
| 1518 | Ga0495622_0000076 | |||
| 1519 | Ga0495667_0001386 | |||
| 1520 | Ga0495668_0099388 | |||
| 1521 | Ga0495611_0028032 | |||
| 1522 | Ga0495635_0035246 | |||
| 1523 | Ga0495661_0081058 | |||
| 1524 | Ga0495588_0000247 | |||
| 1525 | Ga0495657_0099895 | |||
| 1526 | Ga0495599_0032632 | |||
| 1527 | Ga0495647_0000307 | |||
| 1528 | Ga0495647_0040683 | |||
| 1529 | Ga0495613_0000132 | |||
| 1530 | Ga0495624_0000196 | |||
| 1531 | Ga0495624_0041006 | |||
| 1532 | Ga0495671_0054600 | |||
| 1533 | Ga0495649_0090744 | |||
| 1534 | Ga0495589_0059270 | |||
| 1535 | Ga0495600_0010574 | |||
| 1536 | Ga0495581_0078165 | |||
| 1537 | Ga0495604_0000448 | |||
| 1538 | Ga0495672_0008631 | |||
| 1539 | Ga0495676_0045128 | |||
| 1540 | Ga0495680_0012579 | |||
| 1541 | Ga0495680_0079033 | |||
| 1542 | Ga0495680_0165455 | |||
| 1543 | Ga0495675_0109406 | |||
| 1544 | Ga0495677_0019440 | |||
| 1545 | Ga0495673_0016778 | |||
| 1546 | Ga0495684_0107659 | |||
| 1547 | Ga0495686_0085374 | |||
| 1548 | Ga0495593_0053739 | |||
| 1549 | Ga0495602_0034328 | |||
| 1550 | Ga0495626_0044170 | |||
| 1551 | Ga0496100_0000115 | |||
| 1552 | Ga0496100_0000248 | |||
| 1553 | Ga0496100_0002933 | |||
| 1554 | Ga0496100_0016650 | |||
| 1555 | Ga0496100_0041825 | |||
| 1556 | Ga0496100_0073614 | |||
| 1557 | Ga0496101_0000031 | |||
| 1558 | Ga0496101_0000262 | |||
| 1559 | Ga0496101_0001407 | |||
| 1560 | Ga0496101_0010040 | |||
| 1561 | Ga0496101_0012992 | |||
| 1562 | Ga0496101_0027119 | |||
| 1563 | Ga0496101_0044251 | |||
| 1564 | Ga0496102_0000011 | |||
| 1565 | Ga0496102_0000129 | |||
| 1566 | Ga0496102_0000427 | |||
| 1567 | Ga0496102_0000473 | |||
| 1568 | Ga0496102_0002046 | |||
| 1569 | Ga0496102_0002055 | |||
| 1570 | Ga0496102_0006363 | |||
| 1571 | Ga0496102_0011131 | |||
| 1572 | Ga0496102_0011180 | |||
| 1573 | Ga0496102_0051271 | |||
| 1574 | Ga0496102_0073611 | |||
| 1575 | Ga0496102_0096456 | |||
| 1576 | Ga0496102_0101390 | |||
| 1577 | Ga0496102_0174137 | |||
| 1578 | Ga0496102_0236043 | |||
| 1579 | Ga0496103_0000087 | |||
| 1580 | Ga0496103_0000124 | |||
| 1581 | Ga0496103_0000228 | |||
| 1582 | Ga0496103_0000577 | |||
| 1583 | Ga0496103_0000826 | |||
| 1584 | Ga0496103_0004385 | |||
| 1585 | Ga0496103_0009160 | |||
| 1586 | Ga0496103_0013663 | |||
| 1587 | Ga0496103_0020956 | |||
| 1588 | Ga0496103_0063027 | |||
| 1589 | Ga0496103_0074754 | |||
| 1590 | Ga0496104_0000004 | |||
| 1591 | Ga0496104_0001982 | |||
| 1592 | Ga0496104_0004190 | |||
| 1593 | Ga0496104_0012997 | |||
| 1594 | Ga0496104_0017430 | |||
| 1595 | Ga0496104_0047233 | |||
| 1596 | Ga0496104_0058256 | |||
| 1597 | Ga0496104_0199897 | |||
| 1598 | Ga0496105_0000001 | |||
| 1599 | Ga0496105_0004544 | |||
| 1600 | Ga0496105_0004639 | |||
| 1601 | Ga0496105_0011165 | |||
| 1602 | Ga0496105_0029867 | |||
| 1603 | Ga0496105_0071975 | |||
| 1604 | Ga0496105_0087370 | |||
| 1605 | Ga0496106_0003914 | |||
| 1606 | Ga0496106_0008140 | |||
| 1607 | Ga0496106_0008855 | |||
| 1608 | Ga0496106_0056607 | |||
| 1609 | Ga0496106_0132073 | |||
| 1610 | Ga0496107_0006162 | |||
| 1611 | Ga0496107_0033034 | |||
| 1612 | Ga0496107_0056099 | |||
| 1613 | Ga0496107_0079709 | |||
| 1614 | Ga0496107_0082343 | |||
| 1615 | Ga0496107_0092966 | |||
| 1616 | Ga0496108_0000005 | |||
| 1617 | Ga0496108_0002448 | |||
| 1618 | Ga0496108_0002714 | |||
| 1619 | Ga0496108_0013790 | |||
| 1620 | Ga0496108_0015909 | |||
| 1621 | Ga0496108_0176697 | |||
| 1622 | Ga0496109_0000002 | |||
| 1623 | Ga0496109_0000882 | |||
| 1624 | Ga0496109_0002062 | |||
| 1625 | Ga0496109_0029930 | |||
| 1626 | Ga0496109_0041287 | |||
| 1627 | Ga0496109_0042404 | |||
| 1628 | Ga0496109_0061436 | |||
| 1629 | Ga0496109_0095485 | |||
| 1630 | Ga0496109_0153541 | |||
| 1631 | Ga0496109_0160547 | |||
| 1632 | Ga0496110_0000185 | |||
| 1633 | Ga0496110_0000649 | |||
| 1634 | Ga0496110_0022898 | |||
| 1635 | Ga0496110_0041812 | |||
| 1636 | Ga0496110_0046947 | |||
| 1637 | Ga0496111_0000119 | |||
| 1638 | Ga0496111_0002441 | |||
| 1639 | Ga0496111_0024253 | |||
| 1640 | Ga0496111_0086151 | |||
| 1641 | Ga0496112_0001010 | |||
| 1642 | Ga0496112_0002266 | |||
| 1643 | Ga0496112_0016420 | |||
| 1644 | Ga0496112_0032910 | |||
| 1645 | Ga0496112_0057285 | |||
| 1646 | Ga0496112_0086219 | |||
| 1647 | Ga0496113_0000017 | |||
| 1648 | Ga0496114_0000153 | |||
| 1649 | Ga0496114_0000178 | |||
| 1650 | Ga0496114_0004178 | |||
| 1651 | Ga0496114_0008010 | |||
| 1652 | Ga0496114_0015102 | |||
| 1653 | Ga0496114_0018264 | |||
| 1654 | Ga0496114_0028182 | |||
| 1655 | Ga0496114_0049855 | |||
| 1656 | Ga0496114_0065222 | |||
| 1657 | Ga0496114_0074918 | |||
| 1658 | Ga0496114_0131567 | |||
| 1659 | Ga0496114_0146011 | |||
| 1660 | Ga0496115_0004346 | |||
| 1661 | Ga0496115_0061463 | |||
| 1662 | Ga0496115_0093219 | |||
| 1663 | Ga0496116_0000297 | |||
| 1664 | Ga0496116_0005593 | |||
| 1665 | Ga0496116_0076529 | |||
| 1666 | Ga0496117_0000039 | |||
| 1667 | Ga0496117_0001007 | |||
| 1668 | Ga0496118_0000035 | |||
| 1669 | Ga0496118_0000857 | |||
| 1670 | Ga0496118_0001227 | |||
| 1671 | Ga0496118_0001272 | |||
| 1672 | Ga0496119_0000286 | |||
| 1673 | Ga0496119_0001211 | |||
| 1674 | Ga0496119_0006092 | |||
| 1675 | Ga0496119_0013479 | |||
| 1676 | Ga0496120_0001566 | |||
| 1677 | Ga0496120_0032496 | |||
| 1678 | Ga0496121_0000014 | |||
| 1679 | Ga0496121_0000425 | |||
| 1680 | Ga0496121_0001945 | |||
| 1681 | Ga0496121_0033354 | |||
| 1682 | Ga0496122_0000132 | |||
| 1683 | Ga0496122_0021059 | |||
| 1684 | Ga0496123_0006535 | |||
| 1685 | Ga0496123_0009503 | |||
| 1686 | Ga0496123_0031449 | |||
| 1687 | Ga0496124_0000106 | |||
| 1688 | Ga0496124_0049234 | |||
| 1689 | Ga0496124_0119605 | |||
| 1690 | Ga0496125_0000014 | |||
| 1691 | Ga0496125_0005528 | |||
| 1692 | Ga0496126_0000017 | |||
| 1693 | Ga0496126_0000666 | |||
| 1694 | Ga0496126_0002345 | |||
| 1695 | Ga0496126_0002811 | |||
| 1696 | Ga0496126_0030074 | |||
| 1697 | Ga0496126_0127491 | |||
| 1698 | Ga0496126_0132159 | |||
| 1699 | Ga0501031_0000115 | |||
| 1700 | Ga0501031_0000689 | |||
| 1701 | Ga0501032_0000052 | |||
| 1702 | Ga0501032_0003025 | |||
| 1703 | Ga0501033_0003226 | |||
| 1704 | Ga0501033_0081573 | |||
| 1705 | Ga0501034_0003913 | |||
| 1706 | Ga0501034_0007479 | |||
| 1707 | Ga0501034_0007562 | |||
| 1708 | Ga0501034_0009939 | |||
| 1709 | Ga0501034_0018093 | |||
| 1710 | Ga0501034_0042719 | |||
| 1711 | Ga0501034_0077054 | |||
| 1712 | Ga0501036_0000061 | |||
| 1713 | Ga0501036_0007304 | |||
| 1714 | Ga0501036_0007724 | |||
| 1715 | Ga0501037_0000046 | |||
| 1716 | Ga0501037_0000759 | |||
| 1717 | Ga0501037_0009351 | |||
| 1718 | Ga0501037_0032693 | |||
| 1719 | Ga0501038_0000068 | |||
| 1720 | Ga0501038_0001047 | |||
| 1721 | Ga0501038_0037505 | |||
| 1722 | Ga0501039_0000292 | |||
| 1723 | Ga0501039_0007114 | |||
| 1724 | Ga0501039_0015833 | |||
| 1725 | Ga0501039_0017339 | |||
| 1726 | Ga0501039_0089429 | |||
| 1727 | Ga0501039_0125632 | |||
| 1728 | Ga0501041_0018231 | |||
| 1729 | Ga0501041_0089571 | |||
| 1730 | Ga0501042_0083451 | |||
| 1731 | Ga0501043_0000340 | |||
| 1732 | Ga0501043_0006218 | |||
| 1733 | Ga0501043_0012119 | |||
| 1734 | Ga0501043_0019541 | |||
| 1735 | Ga0501043_0119895 | |||
| 1736 | Ga0501046_0000102 | |||
| 1737 | Ga0501046_0000695 | |||
| 1738 | Ga0501046_0013449 | |||
| 1739 | Ga0501047_0001039 | |||
| 1740 | Ga0501047_0005250 | |||
| 1741 | Ga0501047_0006620 | |||
| 1742 | Ga0501048_0000006 | |||
| 1743 | Ga0501048_0001635 | |||
| 1744 | Ga0501048_0086500 | |||
| 1745 | Ga0501067_0001571 | |||
| 1746 | Ga0501067_0008217 | |||
| 1747 | Ga0501068_0014755 | |||
| 1748 | Ga0501068_0021950 | |||
| 1749 | Ga0501069_0005606 | |||
| 1750 | Ga0501069_0052816 | |||
| 1751 | Ga0501070_0000139 | |||
| 1752 | Ga0501070_0001449 | |||
| 1753 | Ga0501071_0028813 | |||
| 1754 | Ga0501071_0048989 | |||
| 1755 | Ga0501072_0001960 | |||
| 1756 | Ga0501072_0005664 | |||
| 1757 | Ga0501074_0000256 | |||
| 1758 | Ga0501074_0007580 | |||
| 1759 | Ga0501075_0013424 | |||
| 1760 | Ga0501076_0001319 | |||
| 1761 | Ga0501076_0124969 | |||
| 1762 | Ga0501077_0002277 | |||
| 1763 | Ga0501079_0003278 | |||
| 1764 | Ga0501080_0000051 | |||
| 1765 | Ga0501081_0007069 | |||
| 1766 | Ga0501081_0009280 | |||
| 1767 | Ga0501083_0002108 | |||
| 1768 | Ga0501035_0000321 | |||
| 1769 | Ga0501035_0021506 | |||
| 1770 | Ga0501035_0137976 | |||
| 1771 | Ga0501044_0000137 | |||
| 1772 | Ga0501044_0014259 | |||
| 1773 | Ga0501044_0093370 | |||
| 1774 | Ga0501044_0098533 | |||
| 1775 | Ga0501045_0000759 | |||
| 1776 | Ga0501045_0004172 | |||
| 1777 | nmdc:mga03n38_2544_c1 | |||
| 1778 | nmdc:mga03n38_2774_c1 | |||
| 1779 | nmdc:mga03n38_43742_c1 | |||
| 1780 | nmdc:mga00v17_1112_c1 | |||
| 1781 | nmdc:mga00v17_1395_c1 | |||
| 1782 | nmdc:mga00v17_18036_c1 | |||
| 1783 | nmdc:mga00v17_21287_c1 | |||
| 1784 | nmdc:mga00v17_26340_c1 | |||
| 1785 | nmdc:mga00v17_55615_c1 | |||
| 1786 | nmdc:mga0yw44_17378_c1 | |||
| 1787 | nmdc:mga0yw44_1762_c1 | |||
| 1788 | nmdc:mga0yw44_3292_c1 | |||
| 1789 | nmdc:mga0yw44_34620_c1 | |||
| 1790 | nmdc:mga0yw44_4326_c1 | |||
| 1791 | nmdc:mga0yw44_4737_c1 | |||
| 1792 | nmdc:mga06z11_10749_c1 | |||
| 1793 | nmdc:mga04h51_21315_c1 | |||
| 1794 | nmdc:mga07m45_23424_c1 | |||
| 1795 | nmdc:mga07m45_41212_c1 | |||
| 1796 | nmdc:mga07m45_6183_c1 | |||
| 1797 | nmdc:mga07m45_8326_c1 | |||
| 1798 | nmdc:mga05p37_22514_c1 | |||
| 1799 | nmdc:mga05p37_60697_c1 | |||
| 1800 | nmdc:mga09592_105574_c1 | |||
| 1801 | nmdc:mga06r32_166033_c1 | |||
| 1802 | nmdc:mga06r32_181758_c1 | |||
| 1803 | nmdc:mga06r32_25842_c1 | |||
| 1804 | nmdc:mga06r32_36408_c1 | |||
| 1805 | nmdc:mga06r32_6628_c1 | |||
| 1806 | nmdc:mga08y16_101120_c1 | |||
| 1807 | nmdc:mga08y16_132329_c1 | |||
| 1808 | nmdc:mga08y16_6449_c1 | |||
| 1809 | nmdc:mga08y16_7008_c1 | |||
| 1810 | nmdc:mga08y16_80980_c1 | |||
| 1811 | nmdc:mga0n895_70602_c1 | |||
| 1812 | nmdc:mga0n895_74334_c1 | |||
| 1813 | nmdc:mga0n895_8375_c1 | |||
| 1814 | nmdc:mga0rr50_1370_c1 | |||
| 1815 | nmdc:mga0rr50_42753_c1 | |||
| 1816 | nmdc:mga08x19_1536_c1 | |||
| 1817 | nmdc:mga08x19_51315_c1 | |||
| 1818 | nmdc:mga0a205_34993_c1 | |||
| 1819 | nmdc:mga0a205_783_c2 | |||
| 1820 | nmdc:mga0sz30_1720_c1 | |||
| 1821 | nmdc:mga0sz30_31391_c1 | |||
| 1822 | nmdc:mga0sz30_9291_c1 | |||
| 1823 | Ga0495601_0000029 | |||
| 1824 | Ga0500610_0001987 | |||
| 1825 | Ga0495655_0000010 | |||
| 1826 | Ga0500641_0000526 | |||
| 1827 | Ga0500641_0004436 | |||
| 1828 | Ga0500562_001179 | |||
| 1829 | Ga0500628_000024 | |||
| 1830 | Ga0500568_0000039 | |||
| 1831 | Ga0500616_0000535 | |||
| 1832 | Ga0500616_0002876 | |||
| 1833 | Ga0500616_0007902 | |||
| 1834 | Ga0500616_0038579 | |||
| 1835 | Ga0500645_000063 | |||
| 1836 | Ga0501084_0001328 | |||
| 1837 | Ga0501084_0116680 | |||
| 1838 | Ga0501082_0003048 | |||
| 1839 | Ga0501082_0065353 | |||
| 1840 | Ga0466962_0014986 | |||
| 1841 | 2643851843 | |||
| 1842 | 2644137568 | |||
| 1843 | 2644456039 | |||
| 1844 | 2644491205 | |||
| 1845 | 2644538700 | |||
| 1846 | 2644609989 | |||
| 1847 | 2644636617 | |||
| 1848 | 2645720701 | |||
| 1849 | 2645723719 | |||
| 1850 | 2731909430 | |||
| 1851 | 2738666841 | |||
| 1852 | 2739145685 | |||
| 1853 | 2774395152 | |||
| 1854 | 2799186767 | |||
| 1855 | 2809194013 | |||
| 1856 | 2812348750 | |||
| 1857 | 2816427141 | |||
| 1858 | 2852643855 | |||
| 1859 | 2870782933 | |||
| 1860 | 2883825819 | |||
| 1861 | 2891973486 | |||
| 1862 | 2902797317 | |||
| 1863 | 2902814579 | |||
| 1864 | 2902843024 | |||
| 1865 | 2904769979 | |||
| 1866 | 2904771171 | |||
| 1867 | 2908815215 | |||
| 1868 | 2919423334 | |||
| 1869 | 2919435942 | |||
| 1870 | 2919448712 | |||
| 1871 | 2929218388 | |||
| 1872 | 2939585034 | |||
| 1873 | 2966923363 | |||
| 1874 | 2974318556 | |||
| 1875 | 2984526767 | |||
| 1876 | 2984578042 | |||
| 1877 | 2984593939 | |||
| 1878 | 2990257556 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8797 | 27 | 499 |
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8704 | 27 | 499 |
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8639 | 27 | 500 |
| 4lgv-assembly1.cif.gz_A | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8612 | 27 | 499 |
| 5aq1-assembly1.cif.gz_B | trypanosoma cruzi glucose-6-phosphate dehydrogenase in complex with g6p and nadph | 0.8549 | 25 | 499 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IPN1_4_105_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8784 | 124 | 208 | 3.40.50.720 |
| af_P9WN73_32_206_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8663 | 33 | 207 | 3.40.50.720 |
| 4lgvC02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8654 | 211 | 500 | 3.30.360.10 |
| 4lgvD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8602 | 27 | 204 | 3.40.50.720 |
| af_Q10M94_152_326_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8568 | 28 | 204 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534WCE8-F1-model_v4 | Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) | 0.9758 | 28 | 197 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A6N9V909-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9737 | 245 | 359 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A0R3WUZ6-F1-model_v4 | glucose-6-phosphate dehydrogenase (NADP(+)) (EC 1.1.1.49) | 0.9698 | 226 | 355 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-T1B9F9-F1-model_v4 | Glucose-6-phosphate 1-dehydrogenase | 0.9615 | 216 | 372 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A2M7FSM5-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9545 | 232 | 372 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |