F486281

General Info

Members Datasets Scaffolds Average Seq Length
939 383 1878 62

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10944981|Ga0075433_109449813
Length 68
Sequence VDRLRRLGASIRRNIDEAWSELKKVSWPTVLQTRNLTVLVFAVSFGIGVFITFFDSIFLNAVKFLSNG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
124 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
240 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
251 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
252 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
294 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
295 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
296 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
327 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
328 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
331 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
332 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
335 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
336 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
337 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
338 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
345 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
346 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 7.14
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10944981 3300006852 Bacteria 752
2 JGI24752J21851_1060694 3300001976 Bacteria 522
3 JGI24747J21853_1033409 3300001978 Bacteria 594
4 JGI24743J22301_10055653 3300001991 Bacteria 810
5 JGI24738J21930_10125194 3300002075 Bacteria 560
6 JGI24749J21850_1056825 3300002076 Bacteria 590
7 JGI24744J21845_10077481 3300002077 Bacteria 607
8 JGI24033J26618_1036890 3300002155 Bacteria 672
9 JGI24034J26672_10052766 3300002239 Bacteria 702
10 JGI24751J29686_10008660 3300002459 Bacteria 2084
11 JGI24751J29686_10013331 3300002459 Bacteria 1696
12 JGI25406J46586_10009666 3300003203 Bacteria 4312
13 Ga0058859_10030995 3300004798 Bacteria 1123
14 Ga0058859_11829737 3300004798 Bacteria 2189
15 Ga0058861_12053711 3300004800 Bacteria 600
16 Ga0058860_10027684 3300004801 Bacteria 887
17 Ga0058860_10072498 3300004801 Bacteria 2469
18 Ga0058862_10027267 3300004803 Bacteria 872
19 Ga0065704_10372827 3300005289 Bacteria 783
20 Ga0065712_10401795 3300005290 Bacteria 730
21 Ga0065712_10470215 3300005290 Bacteria 671
22 Ga0065715_10635613 3300005293 Bacteria 687
23 Ga0065707_10879597 3300005295 Bacteria 527
24 Ga0070676_10934862 3300005328 Bacteria 647
25 Ga0070683_100507299 3300005329 Bacteria 1152
26 Ga0070683_100736430 3300005329 Bacteria 944
27 Ga0070683_101674936 3300005329 Bacteria 612
28 Ga0070690_100162217 3300005330 Bacteria 1532
29 Ga0070690_100326368 3300005330 Bacteria 1107
30 Ga0070690_100518175 3300005330 Bacteria 894
31 Ga0070690_100838012 3300005330 Bacteria 715
32 Ga0070670_100669920 3300005331 Bacteria 932
33 Ga0070670_100741920 3300005331 Bacteria 884
34 Ga0070670_101323924 3300005331 Bacteria 660
35 Ga0068869_100840343 3300005334 Bacteria 791
36 Ga0068869_101146566 3300005334 Bacteria 681
37 Ga0068869_101365169 3300005334 Bacteria 626
38 Ga0070666_10084589 3300005335 Bacteria 2171
39 Ga0070666_10262112 3300005335 Bacteria 1225
40 Ga0070666_10599745 3300005335 Bacteria 803
41 Ga0070666_11458733 3300005335 Bacteria 512
42 Ga0070680_100020531 3300005336 Bacteria 5243
43 Ga0070680_100321120 3300005336 Bacteria 1314
44 Ga0070680_100576128 3300005336 Bacteria 965
45 Ga0070680_100580712 3300005336 Bacteria 961
46 Ga0070680_100682548 3300005336 Bacteria 883
47 Ga0070680_101458830 3300005336 Bacteria 593
48 Ga0070682_100641078 3300005337 Bacteria 844
49 Ga0070682_100805663 3300005337 Bacteria 763
50 Ga0068868_100325958 3300005338 Bacteria 1309
51 Ga0068868_100349188 3300005338 Bacteria 1266
52 Ga0068868_101244518 3300005338 Bacteria 690
53 Ga0068868_101630724 3300005338 Bacteria 606
54 Ga0068868_102089699 3300005338 Bacteria 539
55 Ga0070689_100304847 3300005340 Bacteria 1326
56 Ga0070689_100493916 3300005340 Bacteria 1047
57 Ga0070689_100541992 3300005340 Bacteria 1001
58 Ga0070689_100917548 3300005340 Bacteria 776
59 Ga0070691_10273603 3300005341 Bacteria 913
60 Ga0070691_10299909 3300005341 Bacteria 877
61 Ga0070691_10350481 3300005341 Bacteria 820
62 Ga0070691_10407414 3300005341 Bacteria 767
63 Ga0070687_100221259 3300005343 Bacteria 1159
64 Ga0070687_100394638 3300005343 Bacteria 905
65 Ga0070687_100641959 3300005343 Bacteria 735
66 Ga0070661_100569102 3300005344 Bacteria 913
67 Ga0070692_10232284 3300005345 Bacteria 1095
68 Ga0070692_10459666 3300005345 Bacteria 816
69 Ga0070692_10943177 3300005345 Bacteria 600
70 Ga0070668_100302628 3300005347 Bacteria 1341
71 Ga0070669_101174249 3300005353 Bacteria 662
72 Ga0070669_101916647 3300005353 Bacteria 518
73 Ga0070669_101924034 3300005353 Bacteria 517
74 Ga0070675_100471991 3300005354 Bacteria 1127
75 Ga0070675_100894687 3300005354 Bacteria 813
76 Ga0070675_101344378 3300005354 Bacteria 659
77 Ga0070675_101519746 3300005354 Bacteria 618
78 Ga0070671_100071958 3300005355 Bacteria 2886
79 Ga0070674_100103993 3300005356 Bacteria 2074
80 Ga0070674_100628650 3300005356 Bacteria 910
81 Ga0070674_101320877 3300005356 Bacteria 644
82 Ga0070673_100076409 3300005364 Bacteria 2704
83 Ga0070673_100839966 3300005364 Bacteria 849
84 Ga0070688_100362033 3300005365 Bacteria 1064
85 Ga0070688_100480838 3300005365 Bacteria 934
86 Ga0070659_100642432 3300005366 Bacteria 914
87 Ga0070659_100729270 3300005366 Bacteria 858
88 Ga0070667_100075769 3300005367 Bacteria 2872
89 Ga0070667_100259161 3300005367 Bacteria 1556
90 Ga0070667_100329789 3300005367 Bacteria 1378
91 Ga0070667_100556519 3300005367 Bacteria 1054
92 Ga0070703_10186047 3300005406 Bacteria 805
93 Ga0070713_101648358 3300005436 Bacteria 623
94 Ga0070710_11343549 3300005437 Bacteria 533
95 Ga0070701_10024455 3300005438 Bacteria 2922
96 Ga0070701_10054367 3300005438 Bacteria 2087
97 Ga0070701_10489370 3300005438 Bacteria 796
98 Ga0070711_100677549 3300005439 Bacteria 866
99 Ga0070705_100028430 3300005440 Bacteria 3062
100 Ga0070705_100280402 3300005440 Bacteria 1184
101 Ga0070705_101054690 3300005440 Bacteria 663
102 Ga0070705_101740219 3300005440 Bacteria 527
103 Ga0070700_100036116 3300005441 Bacteria 2995
104 Ga0070700_100732067 3300005441 Bacteria 789
105 Ga0070700_100773600 3300005441 Bacteria 770
106 Ga0070700_100796730 3300005441 Bacteria 760
107 Ga0070700_100883108 3300005441 Bacteria 727
108 Ga0070700_101261422 3300005441 Bacteria 619
109 Ga0070700_101992676 3300005441 Bacteria 503
110 Ga0070694_100607329 3300005444 Bacteria 881
111 Ga0070694_100678039 3300005444 Bacteria 836
112 Ga0070694_100794457 3300005444 Bacteria 775
113 Ga0070694_101080886 3300005444 Bacteria 668
114 Ga0070694_101422324 3300005444 Bacteria 585
115 Ga0070708_100021693 3300005445 Bacteria 5437
116 Ga0070708_100083016 3300005445 Bacteria 2903
117 Ga0070708_100173962 3300005445 Bacteria 2011
118 Ga0070708_100342283 3300005445 Bacteria 1409
119 Ga0070708_100941451 3300005445 Bacteria 810
120 Ga0070708_101091673 3300005445 Bacteria 747
121 Ga0070708_101173597 3300005445 Bacteria 718
122 Ga0070663_100004558 3300005455 Bacteria 8167
123 Ga0070663_100504094 3300005455 Bacteria 1005
124 Ga0070663_100995753 3300005455 Bacteria 728
125 Ga0070678_100159402 3300005456 Bacteria 1826
126 Ga0070678_100765070 3300005456 Bacteria 874
127 Ga0070678_102065119 3300005456 Bacteria 540
128 Ga0070662_101509288 3300005457 Bacteria 579
129 Ga0070681_10283178 3300005458 Bacteria 1568
130 Ga0070681_11076664 3300005458 Bacteria 724
131 Ga0068867_100260956 3300005459 Bacteria 1412
132 Ga0068867_101750357 3300005459 Bacteria 583
133 Ga0068867_102087865 3300005459 Bacteria 537
134 Ga0068867_102343798 3300005459 Bacteria 508
135 Ga0070685_10336638 3300005466 Bacteria 1028
136 Ga0070685_10438397 3300005466 Bacteria 912
137 Ga0070685_10618241 3300005466 Bacteria 781
138 Ga0070706_100040516 3300005467 Bacteria 4300
139 Ga0070706_100484590 3300005467 Bacteria 1150
140 Ga0070706_100902145 3300005467 Bacteria 816
141 Ga0070706_101628946 3300005467 Bacteria 589
142 Ga0070707_100098692 3300005468 Bacteria 2829
143 Ga0070707_100291996 3300005468 Bacteria 1584
144 Ga0070707_101085172 3300005468 Bacteria 766
145 Ga0070707_101436453 3300005468 Bacteria 656
146 Ga0070707_101628786 3300005468 Bacteria 612
147 Ga0070707_102323121 3300005468 Bacteria 503
148 Ga0070698_100045715 3300005471 Bacteria 4480
149 Ga0070698_100084781 3300005471 Bacteria 3156
150 Ga0070698_100128772 3300005471 Bacteria 2487
151 Ga0070698_100920159 3300005471 Bacteria 820
152 Ga0070698_100926067 3300005471 Bacteria 817
153 Ga0070698_100993079 3300005471 Bacteria 786
154 Ga0070698_101065374 3300005471 Bacteria 756
155 Ga0070698_101118251 3300005471 Bacteria 736
156 Ga0070698_101356538 3300005471 Bacteria 662
157 Ga0070698_101814622 3300005471 Bacteria 563
158 Ga0070699_100077369 3300005518 Bacteria 2896
159 Ga0070699_100181167 3300005518 Bacteria 1869
160 Ga0070699_100773320 3300005518 Bacteria 878
161 Ga0070699_100855497 3300005518 Bacteria 833
162 Ga0070699_100875053 3300005518 Bacteria 823
163 Ga0070699_101092972 3300005518 Bacteria 731
164 Ga0070699_101445732 3300005518 Bacteria 630
165 Ga0070699_101794379 3300005518 Bacteria 561
166 Ga0070699_102051599 3300005518 Bacteria 522
167 Ga0070679_100562028 3300005530 Bacteria 1084
168 Ga0070679_101089076 3300005530 Bacteria 744
169 Ga0070679_101767495 3300005530 Bacteria 567
170 Ga0070679_102106117 3300005530 Bacteria 513
171 Ga0070684_100182697 3300005535 Bacteria 1907
172 Ga0070684_100320665 3300005535 Bacteria 1423
173 Ga0070684_100754584 3300005535 Bacteria 908
174 Ga0070684_101589770 3300005535 Bacteria 617
175 Ga0070697_100012567 3300005536 Bacteria 6633
176 Ga0070697_100081282 3300005536 Bacteria 2670
177 Ga0070697_100105328 3300005536 Bacteria 2346
178 Ga0070697_100184681 3300005536 Bacteria 1768
179 Ga0070697_100481821 3300005536 Bacteria 1083
180 Ga0070697_100723975 3300005536 Bacteria 878
181 Ga0070697_101123849 3300005536 Bacteria 699
182 Ga0070697_101429689 3300005536 Bacteria 618
183 Ga0070697_101653937 3300005536 Bacteria 573
184 Ga0068853_101848543 3300005539 Bacteria 585
185 Ga0070672_101958419 3300005543 Bacteria 527
186 Ga0070686_100117462 3300005544 Bacteria 1821
187 Ga0070686_100240245 3300005544 Bacteria 1318
188 Ga0070686_100521042 3300005544 Bacteria 925
189 Ga0070686_100829016 3300005544 Bacteria 747
190 Ga0070686_101232466 3300005544 Bacteria 622
191 Ga0070686_101609910 3300005544 Bacteria 550
192 Ga0070686_101666956 3300005544 Bacteria 541
193 Ga0070695_100039268 3300005545 Bacteria 2991
194 Ga0070695_100080457 3300005545 Bacteria 2153
195 Ga0070695_100395406 3300005545 Bacteria 1046
196 Ga0070695_100482640 3300005545 Bacteria 955
197 Ga0070695_101218731 3300005545 Bacteria 619
198 Ga0070696_100048649 3300005546 Bacteria 2943
199 Ga0070696_100275622 3300005546 Bacteria 1280
200 Ga0070696_100296747 3300005546 Bacteria 1236
201 Ga0070696_100367818 3300005546 Bacteria 1117
202 Ga0070696_100752543 3300005546 Bacteria 798
203 Ga0070696_100811911 3300005546 Bacteria 770
204 Ga0070696_101222000 3300005546 Bacteria 635
205 Ga0070696_101650052 3300005546 Bacteria 552
206 Ga0070696_101790118 3300005546 Bacteria 530
207 Ga0070693_100448998 3300005547 Bacteria 904
208 Ga0070693_100992972 3300005547 Bacteria 635
209 Ga0070693_101400411 3300005547 Bacteria 543
210 Ga0070704_100202396 3300005549 Bacteria 1603
211 Ga0070704_100338901 3300005549 Bacteria 1265
212 Ga0070704_100439002 3300005549 Bacteria 1121
213 Ga0070704_100842662 3300005549 Bacteria 821
214 Ga0070704_101833780 3300005549 Bacteria 561
215 Ga0070704_101979963 3300005549 Bacteria 540
216 Ga0070704_102071092 3300005549 Bacteria 528
217 Ga0068855_101000371 3300005563 Bacteria 878
218 Ga0070664_100705157 3300005564 Bacteria 940
219 Ga0070664_100724302 3300005564 Bacteria 928
220 Ga0068857_100137897 3300005577 Bacteria 2203
221 Ga0068857_100298521 3300005577 Bacteria 1485
222 Ga0068857_100487636 3300005577 Bacteria 1155
223 Ga0068857_100773477 3300005577 Bacteria 915
224 Ga0068857_101146947 3300005577 Bacteria 751
225 Ga0068854_101023035 3300005578 Bacteria 732
226 Ga0068854_101618104 3300005578 Bacteria 590
227 Ga0068854_101708474 3300005578 Bacteria 575
228 Ga0068854_101956811 3300005578 Bacteria 540
229 Ga0068856_100307662 3300005614 Bacteria 1602
230 Ga0068856_101835619 3300005614 Bacteria 618
231 Ga0068856_102722090 3300005614 Bacteria 500
232 Ga0070702_100086340 3300005615 Bacteria 1892
233 Ga0070702_100366736 3300005615 Bacteria 1019
234 Ga0070702_100421618 3300005615 Bacteria 960
235 Ga0070702_100539905 3300005615 Bacteria 863
236 Ga0070702_101783717 3300005615 Bacteria 513
237 Ga0068852_100217744 3300005616 Bacteria 1814
238 Ga0068852_100866168 3300005616 Bacteria 919
239 Ga0068859_100551157 3300005617 Bacteria 1247
240 Ga0068859_101456537 3300005617 Bacteria 756
241 Ga0068864_100118277 3300005618 Bacteria 2366
242 Ga0068864_100457461 3300005618 Bacteria 1221
243 Ga0068866_10279534 3300005718 Bacteria 1034
244 Ga0068866_11338054 3300005718 Bacteria 522
245 Ga0068861_100043615 3300005719 Bacteria 3368
246 Ga0068861_100485872 3300005719 Bacteria 1113
247 Ga0068861_100724626 3300005719 Bacteria 926
248 Ga0068861_101021100 3300005719 Bacteria 791
249 Ga0068861_101044093 3300005719 Bacteria 782
250 Ga0068861_101214951 3300005719 Bacteria 729
251 Ga0068851_10264226 3300005834 Bacteria 980
252 Ga0068870_10219194 3300005840 Bacteria 1163
253 Ga0068870_10735801 3300005840 Bacteria 684
254 Ga0068863_100982498 3300005841 Bacteria 847
255 Ga0068863_101413859 3300005841 Bacteria 703
256 Ga0068858_100027244 3300005842 Bacteria 5310
257 Ga0068858_100477059 3300005842 Bacteria 1204
258 Ga0068858_101075074 3300005842 Bacteria 789
259 Ga0068858_101514665 3300005842 Bacteria 661
260 Ga0068860_100024658 3300005843 Bacteria 5808
261 Ga0068860_100531553 3300005843 Bacteria 1176
262 Ga0068862_101281327 3300005844 Bacteria 734
263 Ga0081539_10002087 3300005985 Bacteria 29854
264 Ga0081539_10318578 3300005985 Bacteria 662
265 Ga0075365_10279193 3300006038 Bacteria 1175
266 Ga0075364_10962093 3300006051 Bacteria 581
267 Ga0075432_10037946 3300006058 Bacteria 1677
268 Ga0070715_10558793 3300006163 Bacteria 665
269 Ga0070716_100263972 3300006173 Bacteria 1179
270 Ga0070716_101271664 3300006173 Bacteria 594
271 Ga0070716_101721500 3300006173 Bacteria 517
272 Ga0070712_100981020 3300006175 Bacteria 731
273 Ga0097621_100150529 3300006237 Bacteria 1995
274 Ga0097621_100361892 3300006237 Bacteria 1292
275 Ga0097621_100807415 3300006237 Bacteria 869
276 Ga0097621_102328181 3300006237 Bacteria 512
277 Ga0068871_100103647 3300006358 Bacteria 2385
278 Ga0068871_100434328 3300006358 Bacteria 1174
279 Ga0068871_100896880 3300006358 Bacteria 821
280 Ga0075428_100731357 3300006844 Bacteria 1053
281 Ga0075428_101943549 3300006844 Bacteria 611
282 Ga0075431_100254993 3300006847 Bacteria 1781
283 Ga0075433_10019795 3300006852 Bacteria 5616
284 Ga0075433_10163918 3300006852 Bacteria 1978
285 Ga0075433_10271267 3300006852 Bacteria 1503
286 Ga0075434_100807010 3300006871 Bacteria 954
287 Ga0075434_101116554 3300006871 Bacteria 801
288 Ga0068865_100159465 3300006881 Bacteria 1719
289 Ga0068865_100226429 3300006881 Bacteria 1464
290 Ga0068865_100288295 3300006881 Bacteria 1309
291 Ga0068865_100575930 3300006881 Bacteria 948
292 Ga0068865_101826023 3300006881 Bacteria 550
293 Ga0075436_100122500 3300006914 Bacteria 1820
294 Ga0097620_100551131 3300006931 Bacteria 1247
295 Ga0097620_101456521 3300006931 Bacteria 756
296 Ga0075435_100232450 3300007076 Bacteria 1567
297 Ga0075435_100463524 3300007076 Bacteria 1093
298 Ga0075435_100522835 3300007076 Bacteria 1026
299 Ga0075435_100659383 3300007076 Bacteria 908
300 Ga0075435_100756312 3300007076 Bacteria 845
301 Ga0099795_10303707 3300007788 Bacteria 702
302 Ga0105251_10066999 3300009011 Bacteria 1678
303 Ga0105244_10186311 3300009036 Bacteria 983
304 Ga0105250_10605431 3300009092 Bacteria 508
305 Ga0105240_11120153 3300009093 Bacteria 837
306 Ga0105240_11173332 3300009093 Bacteria 814
307 Ga0111539_10628948 3300009094 Bacteria 1250
308 Ga0111539_11331570 3300009094 Bacteria 833
309 Ga0111539_11404096 3300009094 Bacteria 810
310 Ga0111539_12267385 3300009094 Bacteria 630
311 Ga0105245_10220019 3300009098 Bacteria 1832
312 Ga0105245_10746505 3300009098 Bacteria 1014
313 Ga0105245_10755149 3300009098 Bacteria 1009
314 Ga0105245_11166052 3300009098 Bacteria 818
315 Ga0105245_11570092 3300009098 Bacteria 710
316 Ga0105245_13253944 3300009098 Bacteria 503
317 Ga0105247_10170111 3300009101 Bacteria 1448
318 Ga0105247_10861632 3300009101 Bacteria 696
319 Ga0105247_11201884 3300009101 Bacteria 604
320 Ga0105247_11692624 3300009101 Bacteria 523
321 Ga0114129_10181666 3300009147 Bacteria 2862
322 Ga0114129_11118621 3300009147 Bacteria 985
323 Ga0114129_11611101 3300009147 Bacteria 794
324 Ga0114129_12174935 3300009147 Bacteria 668
325 Ga0105243_10585040 3300009148 Bacteria 1072
326 Ga0105243_10637014 3300009148 Bacteria 1031
327 Ga0105243_10781936 3300009148 Bacteria 939
328 Ga0105243_10789027 3300009148 Bacteria 935
329 Ga0105243_11139061 3300009148 Bacteria 790
330 Ga0105243_11924829 3300009148 Bacteria 624
331 Ga0105243_12518553 3300009148 Bacteria 554
332 Ga0105243_12597863 3300009148 Bacteria 546
333 Ga0105241_10558779 3300009174 Bacteria 1029
334 Ga0105241_12571318 3300009174 Bacteria 511
335 Ga0105242_10245777 3300009176 Bacteria 1610
336 Ga0105242_10297351 3300009176 Bacteria 1472
337 Ga0105242_10463114 3300009176 Bacteria 1198
338 Ga0105242_10839274 3300009176 Bacteria 913
339 Ga0105242_11050225 3300009176 Bacteria 826
340 Ga0105242_11318241 3300009176 Bacteria 746
341 Ga0105248_10041220 3300009177 Bacteria 5176
342 Ga0105248_10784244 3300009177 Bacteria 1075
343 Ga0105248_11178129 3300009177 Bacteria 866
344 Ga0105248_11510176 3300009177 Bacteria 761
345 Ga0105248_12261881 3300009177 Bacteria 619
346 Ga0105248_13313266 3300009177 Bacteria 512
347 Ga0105237_10611139 3300009545 Bacteria 1097
348 Ga0105237_10966472 3300009545 Bacteria 859
349 Ga0105238_10328716 3300009551 Bacteria 1515
350 Ga0105238_10825244 3300009551 Bacteria 943
351 Ga0105238_11131346 3300009551 Bacteria 806
352 Ga0105249_10019204 3300009553 Bacteria 6095
353 Ga0105249_10492138 3300009553 Bacteria 1270
354 Ga0105249_11308605 3300009553 Bacteria 796
355 Ga0105249_11369838 3300009553 Bacteria 779
356 Ga0105249_11885749 3300009553 Bacteria 670
357 Ga0105249_12278481 3300009553 Bacteria 614
358 Ga0105249_12829331 3300009553 Bacteria 557
359 Ga0105249_13079667 3300009553 Bacteria 536
360 Ga0105239_10319281 3300010375 Bacteria 1751
361 Ga0105239_11173510 3300010375 Bacteria 885
362 Ga0105239_12166299 3300010375 Bacteria 646
363 Ga0105239_12265214 3300010375 Bacteria 632
364 Ga0105239_12812473 3300010375 Bacteria 568
365 Ga0105246_10041027 3300011119 Bacteria 3127
366 Ga0105246_10329895 3300011119 Bacteria 1243
367 Ga0105246_10942752 3300011119 Bacteria 777
368 Ga0105246_10968939 3300011119 Bacteria 768
369 Ga0105246_11456342 3300011119 Bacteria 641
370 Ga0105246_12110491 3300011119 Bacteria 546
371 Ga0157343_1007894 3300012488 Bacteria 753
372 Ga0157323_1004802 3300012495 Bacteria 880
373 Ga0157371_10337438 3300013102 Bacteria 1096
374 Ga0157370_11061661 3300013104 Bacteria 732
375 Ga0157374_10155022 3300013296 Bacteria 2229
376 Ga0157374_10265742 3300013296 Bacteria 1691
377 Ga0157374_10728428 3300013296 Bacteria 1006
378 Ga0157378_10015276 3300013297 Bacteria 6724
379 Ga0157378_10913110 3300013297 Bacteria 909
380 Ga0157378_11259696 3300013297 Bacteria 780
381 Ga0157378_11553276 3300013297 Bacteria 707
382 Ga0163162_10088800 3300013306 Bacteria 3170
383 Ga0163162_11255603 3300013306 Bacteria 841
384 Ga0163162_11783920 3300013306 Bacteria 703
385 Ga0163162_12848112 3300013306 Bacteria 557
386 Ga0163162_13123335 3300013306 Bacteria 532
387 Ga0157372_10800022 3300013307 Bacteria 1095
388 Ga0157372_11560230 3300013307 Bacteria 760
389 Ga0157375_10912092 3300013308 Bacteria 1022
390 Ga0157375_11151575 3300013308 Bacteria 909
391 Ga0157375_13454274 3300013308 Bacteria 526
392 Ga0157375_13675404 3300013308 Bacteria 510
393 Ga0163163_10259786 3300014325 Bacteria 1788
394 Ga0163163_10526117 3300014325 Bacteria 1245
395 Ga0163163_10743049 3300014325 Bacteria 1044
396 Ga0163163_11444496 3300014325 Bacteria 749
397 Ga0163163_11756174 3300014325 Bacteria 681
398 Ga0163163_11812411 3300014325 Bacteria 670
399 Ga0163163_12069663 3300014325 Bacteria 629
400 Ga0163163_13043396 3300014325 Bacteria 523
401 Ga0157380_10012801 3300014326 Bacteria 6096
402 Ga0157380_11037451 3300014326 Bacteria 856
403 Ga0157380_11040742 3300014326 Bacteria 854
404 Ga0157380_11514832 3300014326 Bacteria 724
405 Ga0157380_12996746 3300014326 Bacteria 538
406 Ga0157380_13364968 3300014326 Bacteria 511
407 Ga0157377_10076167 3300014745 Bacteria 1950
408 Ga0157377_10417560 3300014745 Bacteria 918
409 Ga0157377_10483225 3300014745 Bacteria 862
410 Ga0157379_10549666 3300014968 Bacteria 1074
411 Ga0157379_11122397 3300014968 Bacteria 754
412 Ga0157379_11441509 3300014968 Bacteria 668
413 Ga0157379_11449126 3300014968 Bacteria 667
414 Ga0157376_10148277 3300014969 Bacteria 2113
415 Ga0157376_11024663 3300014969 Bacteria 849
416 Ga0157376_11898288 3300014969 Bacteria 632
417 Ga0163161_10605041 3300017792 Bacteria 904
418 Ga0163161_10623128 3300017792 Bacteria 892
419 Ga0163161_10735802 3300017792 Bacteria 824
420 Ga0206356_10505645 3300020070 Bacteria 746
421 Ga0206352_11256669 3300020078 Bacteria 501
422 Ga0206354_10678292 3300020081 Bacteria 527
423 Ga0207697_10103881 3300025315 Bacteria 1213
424 Ga0207656_10221892 3300025321 Bacteria 919
425 Ga0207713_1061982 3300025735 Bacteria 1420
426 Ga0207653_10063012 3300025885 Bacteria 1254
427 Ga0207653_10158204 3300025885 Bacteria 837
428 Ga0207653_10346741 3300025885 Bacteria 580
429 Ga0207692_11071524 3300025898 Bacteria 533
430 Ga0207710_10551947 3300025900 Bacteria 600
431 Ga0207688_10728680 3300025901 Bacteria 627
432 Ga0207688_10794965 3300025901 Bacteria 599
433 Ga0207680_10238277 3300025903 Bacteria 1253
434 Ga0207680_10345252 3300025903 Bacteria 1045
435 Ga0207647_10022808 3300025904 Bacteria 4152
436 Ga0207685_10132869 3300025905 Bacteria 1107
437 Ga0207645_10140018 3300025907 Bacteria 1576
438 Ga0207645_10472654 3300025907 Bacteria 847
439 Ga0207643_10391655 3300025908 Bacteria 877
440 Ga0207684_10023984 3300025910 Bacteria 5205
441 Ga0207684_10393037 3300025910 Bacteria 1192
442 Ga0207707_10224487 3300025912 Bacteria 1635
443 Ga0207707_10290941 3300025912 Bacteria 1413
444 Ga0207695_10853129 3300025913 Bacteria 791
445 Ga0207671_10281017 3300025914 Bacteria 1313
446 Ga0207693_10691971 3300025915 Bacteria 790
447 Ga0207660_10000002 3300025917 Bacteria 883566
448 Ga0207662_10451250 3300025918 Bacteria 879
449 Ga0207662_10551726 3300025918 Bacteria 798
450 Ga0207657_10381984 3300025919 Bacteria 1109
451 Ga0207649_10417978 3300025920 Bacteria 1006
452 Ga0207649_11343857 3300025920 Bacteria 565
453 Ga0207652_11691138 3300025921 Bacteria 537
454 Ga0207646_10004216 3300025922 Bacteria 15739
455 Ga0207646_10344489 3300025922 Bacteria 1346
456 Ga0207646_10430443 3300025922 Bacteria 1191
457 Ga0207646_10669247 3300025922 Bacteria 929
458 Ga0207646_11308692 3300025922 Bacteria 633
459 Ga0207650_10856254 3300025925 Bacteria 771
460 Ga0207659_10608607 3300025926 Bacteria 932
461 Ga0207659_11055178 3300025926 Bacteria 699
462 Ga0207687_10046120 3300025927 Bacteria 3016
463 Ga0207687_10205866 3300025927 Bacteria 1541
464 Ga0207687_10245227 3300025927 Bacteria 1422
465 Ga0207687_10541964 3300025927 Bacteria 975
466 Ga0207687_10665427 3300025927 Bacteria 882
467 Ga0207644_10066480 3300025931 Bacteria 2625
468 Ga0207644_10855190 3300025931 Bacteria 762
469 Ga0207644_11103092 3300025931 Unclassified 667
470 Ga0207690_10050244 3300025932 Bacteria 2783
471 Ga0207690_11293243 3300025932 Bacteria 609
472 Ga0207706_10046490 3300025933 Bacteria 3842
473 Ga0207706_11053782 3300025933 Bacteria 681
474 Ga0207686_10341698 3300025934 Bacteria 1124
475 Ga0207686_10657768 3300025934 Bacteria 829
476 Ga0207686_10663648 3300025934 Bacteria 826
477 Ga0207709_10010646 3300025935 Bacteria 5066
478 Ga0207709_10080062 3300025935 Bacteria 2102
479 Ga0207709_10969481 3300025935 Bacteria 694
480 Ga0207670_10754289 3300025936 Bacteria 808
481 Ga0207670_11314009 3300025936 Bacteria 613
482 Ga0207669_10005197 3300025937 Bacteria 5815
483 Ga0207669_10022441 3300025937 Bacteria 3353
484 Ga0207669_10737737 3300025937 Bacteria 812
485 Ga0207669_10850612 3300025937 Bacteria 759
486 Ga0207704_10153708 3300025938 Bacteria 1627
487 Ga0207704_10533180 3300025938 Bacteria 951
488 Ga0207704_10825826 3300025938 Bacteria 775
489 Ga0207665_10412618 3300025939 Bacteria 1030
490 Ga0207665_11414374 3300025939 Bacteria 554
491 Ga0207691_11758036 3300025940 Bacteria 501
492 Ga0207711_10059034 3300025941 Bacteria 3302
493 Ga0207711_10408907 3300025941 Bacteria 1261
494 Ga0207689_10662255 3300025942 Bacteria 880
495 Ga0207689_10948874 3300025942 Bacteria 726
496 Ga0207661_10212042 3300025944 Bacteria 1707
497 Ga0207661_10436866 3300025944 Bacteria 1190
498 Ga0207667_10791170 3300025949 Bacteria 946
499 Ga0207651_11479702 3300025960 Bacteria 611
500 Ga0207712_10634298 3300025961 Bacteria 927
501 Ga0207712_11290679 3300025961 Bacteria 652
502 Ga0207712_11451262 3300025961 Bacteria 614
503 Ga0207668_10856634 3300025972 Bacteria 807
504 Ga0207640_10213275 3300025981 Bacteria 1472
505 Ga0207640_11872801 3300025981 Bacteria 543
506 Ga0207658_10302443 3300025986 Bacteria 1378
507 Ga0207658_12070465 3300025986 Bacteria 517
508 Ga0207677_10528251 3300026023 Bacteria 1025
509 Ga0207677_10728964 3300026023 Bacteria 882
510 Ga0207677_11417490 3300026023 Bacteria 640
511 Ga0207703_10065297 3300026035 Bacteria 2990
512 Ga0207703_10886928 3300026035 Bacteria 854
513 Ga0207703_12275174 3300026035 Bacteria 518
514 Ga0207639_10907276 3300026041 Bacteria 824
515 Ga0207639_10971666 3300026041 Bacteria 795
516 Ga0207678_10017028 3300026067 Bacteria 6382
517 Ga0207678_10276342 3300026067 Bacteria 1441
518 Ga0207678_11598135 3300026067 Bacteria 574
519 Ga0207708_10017492 3300026075 Bacteria 5396
520 Ga0207708_10524672 3300026075 Bacteria 996
521 Ga0207708_10856134 3300026075 Bacteria 785
522 Ga0207708_11777193 3300026075 Bacteria 541
523 Ga0207702_10729756 3300026078 Bacteria 977
524 Ga0207702_11057120 3300026078 Bacteria 805
525 Ga0207641_11341754 3300026088 Bacteria 716
526 Ga0207648_10799580 3300026089 Bacteria 878
527 Ga0207676_10243897 3300026095 Bacteria 1613
528 Ga0207676_10508450 3300026095 Bacteria 1145
529 Ga0207676_11361056 3300026095 Bacteria 705
530 Ga0207674_10096522 3300026116 Bacteria 2941
531 Ga0207674_10850537 3300026116 Bacteria 880
532 Ga0207674_11033956 3300026116 Bacteria 791
533 Ga0207675_100573084 3300026118 Bacteria 1130
534 Ga0207675_100822742 3300026118 Bacteria 943
535 Ga0207675_101054815 3300026118 Bacteria 832
536 Ga0207675_101383480 3300026118 Bacteria 724
537 Ga0207683_10114781 3300026121 Bacteria 2414
538 Ga0207683_10486201 3300026121 Bacteria 1140
539 Ga0207683_10807356 3300026121 Bacteria 871
540 Ga0207698_10020697 3300026142 Bacteria 4534
541 Ga0209973_1020358 3300027252 Bacteria 876
542 Ga0209984_1038469 3300027424 Bacteria 686
543 Ga0209968_1005468 3300027526 Bacteria 1911
544 Ga0209982_1006777 3300027552 Bacteria 1670
545 Ga0210002_1049075 3300027617 Bacteria 726
546 Ga0209983_1020600 3300027665 Bacteria 1375
547 Ga0209983_1044215 3300027665 Bacteria 967
548 Ga0209983_1050545 3300027665 Bacteria 910
549 Ga0209971_1019669 3300027682 Bacteria 1603
550 Ga0209971_1179172 3300027682 Bacteria 522
551 Ga0209966_1091951 3300027695 Bacteria 680
552 Ga0209998_10007548 3300027717 Bacteria 2257
553 Ga0209974_10016162 3300027876 Bacteria 2478
554 Ga0209974_10028771 3300027876 Bacteria 1840
555 Ga0209974_10090696 3300027876 Bacteria 1060
556 Ga0209974_10424313 3300027876 Bacteria 525
557 Ga0209974_10429919 3300027876 Bacteria 522
558 Ga0207428_10181308 3300027907 Bacteria 1591
559 Ga0268264_10274106 3300028381 Bacteria 1577
560 Ga0268264_12025853 3300028381 Bacteria 585
561 Ga0268264_12453410 3300028381 Bacteria 527
562 Ga0307408_100041695 3300031548 Bacteria 3255
563 Ga0307408_101944643 3300031548 Bacteria 565
564 Ga0307405_10476490 3300031731 Bacteria 995
565 Ga0307413_10078953 3300031824 Bacteria 2102
566 Ga0307413_10293782 3300031824 Bacteria 1229
567 Ga0307413_11278474 3300031824 Bacteria 641
568 Ga0307410_11539614 3300031852 Bacteria 586
569 Ga0307410_11673601 3300031852 Bacteria 563
570 Ga0307406_11402688 3300031901 Bacteria 612
571 Ga0307407_10154985 3300031903 Bacteria 1493
572 Ga0307412_10158459 3300031911 Bacteria 1679
573 Ga0307409_100044842 3300031995 Bacteria 3333
574 Ga0307409_100318090 3300031995 Bacteria 1455
575 Ga0307409_100852074 3300031995 Bacteria 922
576 Ga0307416_100042187 3300032002 Bacteria 3559
577 Ga0307416_100307797 3300032002 Bacteria 1579
578 Ga0307416_101333408 3300032002 Bacteria 823
579 Ga0307416_102548829 3300032002 Bacteria 609
580 Ga0307414_10782384 3300032004 Bacteria 869
581 Ga0307414_10952636 3300032004 Bacteria 789
582 Ga0307415_100063143 3300032126 Bacteria 2572
583 Ga0307415_100120780 3300032126 Bacteria 1964
584 Ga0307415_101454292 3300032126 Bacteria 654
585 Ga0373948_0167434 3300034817 Bacteria 558
586 Ga0373948_0201665 3300034817 Bacteria 519
587 Ga0373950_0120545 3300034818 Bacteria 580
588 Ga0373958_0041078 3300034819 Bacteria 946
589 Ga0373926_0098127 3300035083 Bacteria 1094
590 Ga0373929_0147805 3300035085 Bacteria 628
591 Ga0373949_0049115 3300035090 Bacteria 1059
592 Ga0373951_0233715 3300035091 Bacteria 547
593 Ga0373932_0103774 3300035112 Bacteria 929
594 Ga0373941_0131513 3300035115 Bacteria 902
595 Ga0373941_0288517 3300035115 Bacteria 651
596 Ga0373941_0392496 3300035115 Bacteria 572
597 Ga0373960_0063732 3300035121 Bacteria 1124
598 Ga0373960_0282269 3300035121 Bacteria 612
599 Ga0373946_0507291 3300035171 Bacteria 619
600 Ga0373955_0332584 3300035172 Bacteria 919
601 Ga0373961_0235479 3300035241 Bacteria 658
602 Ga0373962_0072589 3300035242 Bacteria 1031
603 Ga0373931_0194604 3300035691 Bacteria 1208
604 Ga0373931_1020186 3300035691 Bacteria 561
605 Ga0373933_0757909 3300035724 Bacteria 639
606 Ga0395901_0312615 3300038443 Bacteria 1627
607 Ga0242419_005567 3300038698 Bacteria 900
608 Ga0242420_064558 3300038996 Bacteria 735
609 Ga0439453_0180418 3300041408 Bacteria 515
610 Ga0439466_0041798 3300041411 Bacteria 1528
611 Ga0451807_0415819 3300041486 Bacteria 863
612 Ga0439431_0178426 3300041997 Bacteria 612
613 Ga0450914_034842 3300042118 Bacteria 620
614 Ga0450920_131719 3300042122 Bacteria 527
615 Ga0450923_015004 3300042125 Bacteria 1443
616 Ga0450897_034538 3300042128 Bacteria 582
617 Ga0450906_013042 3300042145 Bacteria 1536
618 Ga0450910_060232 3300042147 Bacteria 640
619 Ga0450910_068298 3300042147 Bacteria 608
620 Ga0450908_044198 3300042184 Bacteria 772
621 Ga0450909_021128 3300042185 Bacteria 972
622 Ga0439434_0085821 3300042435 Bacteria 1003
623 Ga0439434_0088566 3300042435 Bacteria 988
624 Ga0439459_0033618 3300042438 Bacteria 1057
625 Ga0450916_073568 3300042530 Bacteria 574
626 Ga0451577_0060452 3300042876 Bacteria 3378
627 Ga0451577_1377332 3300042876 Bacteria 626
628 Ga0453683_0018052 3300044673 Bacteria 4531
629 Ga0453683_0383037 3300044673 Bacteria 905
630 Ga0453684_0794841 3300044712 Bacteria 1021
631 Ga0453684_1421790 3300044712 Bacteria 718
632 Ga0451576_0040408 3300045051 Bacteria 4937
633 Ga0466967_1874688 3300045976 Bacteria 596
634 Ga0495603_0220251 3300046455 Bacteria 1095
635 Ga0495582_0264675 3300046473 Bacteria 986
636 Ga0495582_0387772 3300046473 Bacteria 805
637 Ga0495662_0258322 3300046476 Bacteria 858
638 Ga0495644_0073999 3300046523 Bacteria 1281
639 Ga0495663_0086016 3300046525 Bacteria 1019
640 Ga0495609_0313839 3300046538 Bacteria 637
641 Ga0495656_0779253 3300046615 Bacteria 516
642 Ga0495611_0230567 3300046648 Bacteria 861
643 Ga0495659_0221644 3300046664 Bacteria 781
644 Ga0495659_0293609 3300046664 Bacteria 685
645 Ga0495647_0122158 3300046681 Bacteria 1096
646 Ga0495658_0951817 3300046683 Bacteria 549
647 Ga0495613_1013100 3300046689 Bacteria 533
648 Ga0495624_0867277 3300046690 Bacteria 532
649 Ga0495649_0236389 3300046694 Bacteria 942
650 Ga0495676_0412536 3300047321 Bacteria 895
651 Ga0495614_0426175 3300048089 Bacteria 626
652 Ga0495614_0652200 3300048089 Bacteria 508
653 Ga0496100_0891638 3300048903 Bacteria 698
654 Ga0496101_0462519 3300048904 Bacteria 1001
655 Ga0496101_0777076 3300048904 Bacteria 755
656 Ga0496101_0844817 3300048904 Bacteria 721
657 Ga0496101_0945591 3300048904 Bacteria 678
658 Ga0496101_1414834 3300048904 Bacteria 542
659 Ga0496102_0221210 3300048905 Bacteria 1785
660 Ga0496102_0406039 3300048905 Bacteria 1280
661 Ga0496102_0765094 3300048905 Bacteria 888
662 Ga0496102_0989738 3300048905 Bacteria 761
663 Ga0496102_1128921 3300048905 Bacteria 703
664 Ga0496103_0011651 3300048906 Bacteria 5215
665 Ga0496103_0511251 3300048906 Bacteria 768
666 Ga0496103_0772581 3300048906 Bacteria 607
667 Ga0496104_0022038 3300048907 Bacteria 5854
668 Ga0496104_0048572 3300048907 Bacteria 4000
669 Ga0496104_0173708 3300048907 Bacteria 2065
670 Ga0496104_0257888 3300048907 Bacteria 1656
671 Ga0496104_0897486 3300048907 Bacteria 791
672 Ga0496105_0079537 3300048908 Bacteria 2707
673 Ga0496105_0202168 3300048908 Bacteria 1621
674 Ga0496105_0326202 3300048908 Bacteria 1229
675 Ga0496106_0189802 3300048909 Bacteria 1633
676 Ga0496106_0244933 3300048909 Bacteria 1432
677 Ga0496106_0245719 3300048909 Bacteria 1430
678 Ga0496106_0787726 3300048909 Bacteria 754
679 Ga0496106_1055409 3300048909 Bacteria 638
680 Ga0496107_0692959 3300048910 Bacteria 749
681 Ga0496107_1042464 3300048910 Bacteria 592
682 Ga0496107_1266685 3300048910 Bacteria 528
683 Ga0496107_1270194 3300048910 Bacteria 527
684 Ga0496108_0005881 3300048911 Bacteria 9945
685 Ga0496108_0021720 3300048911 Bacteria 5277
686 Ga0496108_0133733 3300048911 Bacteria 2132
687 Ga0496108_0152665 3300048911 Bacteria 1993
688 Ga0496109_0007365 3300048912 Bacteria 9312
689 Ga0496109_0069348 3300048912 Bacteria 3233
690 Ga0496109_0122176 3300048912 Bacteria 2426
691 Ga0496109_0416989 3300048912 Bacteria 1268
692 Ga0496109_0724174 3300048912 Bacteria 932
693 Ga0496109_1214845 3300048912 Bacteria 690
694 Ga0496109_1731753 3300048912 Bacteria 558
695 Ga0496110_0032222 3300048913 Bacteria 4525
696 Ga0496110_0032784 3300048913 Bacteria 4490
697 Ga0496110_0411793 3300048913 Bacteria 1232
698 Ga0496110_1577385 3300048913 Bacteria 566
699 Ga0496111_0031782 3300048914 Bacteria 3761
700 Ga0496111_0070108 3300048914 Bacteria 2549
701 Ga0496111_0158088 3300048914 Bacteria 1682
702 Ga0496111_0198587 3300048914 Bacteria 1491
703 Ga0496111_0974252 3300048914 Bacteria 608
704 Ga0496112_0002921 3300048915 Bacteria 13922
705 Ga0496112_0047852 3300048915 Bacteria 4195
706 Ga0496112_0246234 3300048915 Bacteria 1739
707 Ga0496112_0367774 3300048915 Bacteria 1379
708 Ga0496112_0962457 3300048915 Bacteria 774
709 Ga0496112_1342087 3300048915 Bacteria 630
710 Ga0496112_1715513 3300048915 Bacteria 540
711 Ga0496113_0010238 3300048916 Bacteria 6192
712 Ga0496113_0233291 3300048916 Bacteria 1467
713 Ga0496113_0324452 3300048916 Bacteria 1234
714 Ga0496113_0697451 3300048916 Bacteria 810
715 Ga0496114_0165095 3300048917 Bacteria 1927
716 Ga0496114_0182212 3300048917 Bacteria 1835
717 Ga0496114_0689443 3300048917 Bacteria 896
718 Ga0496114_0997559 3300048917 Bacteria 720
719 Ga0501306_039538 3300049127 Bacteria 727
720 Ga0501292_030302 3300049515 Bacteria 907
721 Ga0501297_013444 3300049520 Bacteria 961
722 Ga0501298_138082 3300049521 Bacteria 587
723 Ga0501311_043854 3300049527 Bacteria 685
724 Ga0501316_050421 3300049532 Bacteria 598
725 Ga0501317_007952 3300049533 Bacteria 1210
726 Ga0501318_080817 3300049534 Bacteria 526
727 Ga0501325_008381 3300049541 Bacteria 896
728 Ga0501325_016689 3300049541 Bacteria 736
729 Ga0501031_0012970 3300049568 Bacteria 5439
730 Ga0501031_0197050 3300049568 Bacteria 1314
731 Ga0501031_0324091 3300049568 Bacteria 998
732 Ga0501032_0110492 3300049569 Bacteria 1819
733 Ga0501032_0183002 3300049569 Bacteria 1371
734 Ga0501033_0568113 3300049570 Bacteria 780
735 Ga0501033_0616993 3300049570 Bacteria 743
736 Ga0501034_0276328 3300049571 Bacteria 1620
737 Ga0501036_0013129 3300049572 Bacteria 6880
738 Ga0501036_0165028 3300049572 Bacteria 1867
739 Ga0501036_0462525 3300049572 Bacteria 1056
740 Ga0501036_0550955 3300049572 Bacteria 958
741 Ga0501037_0076034 3300049573 Bacteria 2438
742 Ga0501037_0463857 3300049573 Bacteria 863
743 Ga0501037_0685506 3300049573 Bacteria 683
744 Ga0501038_0059905 3300049574 Bacteria 3259
745 Ga0501038_0699934 3300049574 Bacteria 759
746 Ga0501038_0824239 3300049574 Bacteria 688
747 Ga0501038_0944003 3300049574 Bacteria 635
748 Ga0501039_0069732 3300049575 Bacteria 2730
749 Ga0501039_0511992 3300049575 Bacteria 942
750 Ga0501039_0719628 3300049575 Bacteria 780
751 Ga0501039_0788581 3300049575 Bacteria 741
752 Ga0501039_1067909 3300049575 Bacteria 626
753 Ga0501040_0011743 3300049576 Bacteria 5728
754 Ga0501040_0141185 3300049576 Bacteria 1697
755 Ga0501040_0161072 3300049576 Bacteria 1586
756 Ga0501040_0225921 3300049576 Bacteria 1332
757 Ga0501040_0387918 3300049576 Bacteria 1002
758 Ga0501040_0813457 3300049576 Bacteria 676
759 Ga0501041_0020309 3300049577 Bacteria 3970
760 Ga0501041_0049911 3300049577 Bacteria 2549
761 Ga0501041_0113853 3300049577 Bacteria 1679
762 Ga0501041_0140295 3300049577 Bacteria 1507
763 Ga0501041_0411664 3300049577 Bacteria 857
764 Ga0501041_0671731 3300049577 Bacteria 662
765 Ga0501041_1050999 3300049577 Bacteria 524
766 Ga0501042_0074548 3300049578 Bacteria 2428
767 Ga0501042_0522630 3300049578 Bacteria 862
768 Ga0501042_0542931 3300049578 Bacteria 845
769 Ga0501042_1388916 3300049578 Bacteria 512
770 Ga0501042_1443820 3300049578 Bacteria 502
771 Ga0501043_0831378 3300049579 Bacteria 666
772 Ga0501043_1091685 3300049579 Bacteria 564
773 Ga0501046_0237089 3300049580 Bacteria 1346
774 Ga0501046_0288148 3300049580 Bacteria 1201
775 Ga0501046_0446722 3300049580 Bacteria 930
776 Ga0501046_0586255 3300049580 Bacteria 792
777 Ga0501046_0620260 3300049580 Bacteria 766
778 Ga0501048_0012332 3300049582 Bacteria 6359
779 Ga0501048_0069814 3300049582 Bacteria 2481
780 Ga0501048_0173849 3300049582 Bacteria 1526
781 Ga0501048_0224285 3300049582 Bacteria 1333
782 Ga0501048_0564750 3300049582 Bacteria 817
783 Ga0501067_0011868 3300049583 Bacteria 4829
784 Ga0501067_0358212 3300049583 Bacteria 813
785 Ga0501068_0013746 3300049584 Bacteria 4612
786 Ga0501068_0515690 3300049584 Bacteria 776
787 Ga0501068_0861721 3300049584 Bacteria 595
788 Ga0501068_1139883 3300049584 Bacteria 516
789 Ga0501069_0004365 3300049585 Bacteria 7300
790 Ga0501069_0022378 3300049585 Bacteria 3438
791 Ga0501069_0806667 3300049585 Bacteria 569
792 Ga0501070_0100767 3300049586 Bacteria 2389
793 Ga0501071_0016406 3300049587 Bacteria 5092
794 Ga0501071_0448364 3300049587 Bacteria 987
795 Ga0501071_0855269 3300049587 Bacteria 701
796 Ga0501071_1366397 3300049587 Bacteria 547
797 Ga0501072_0284427 3300049588 Bacteria 1315
798 Ga0501072_0298988 3300049588 Bacteria 1279
799 Ga0501072_0365326 3300049588 Bacteria 1145
800 Ga0501072_0517392 3300049588 Bacteria 943
801 Ga0501072_0897159 3300049588 Bacteria 692
802 Ga0501072_0899607 3300049588 Bacteria 691
803 Ga0501072_1049087 3300049588 Bacteria 635
804 Ga0501072_1149706 3300049588 Bacteria 603
805 Ga0501073_0078522 3300049589 Bacteria 2297
806 Ga0501073_0467456 3300049589 Bacteria 872
807 Ga0501073_0521317 3300049589 Bacteria 821
808 Ga0501074_0074160 3300049590 Bacteria 2443
809 Ga0501074_0939660 3300049590 Bacteria 608
810 Ga0501074_1001522 3300049590 Bacteria 587
811 Ga0501075_0037524 3300049591 Bacteria 3620
812 Ga0501075_0097340 3300049591 Bacteria 2233
813 Ga0501075_0715528 3300049591 Bacteria 762
814 Ga0501075_1304411 3300049591 Bacteria 550
815 Ga0501075_1551587 3300049591 Bacteria 501
816 Ga0501076_0069984 3300049592 Bacteria 2804
817 Ga0501076_0107435 3300049592 Bacteria 2253
818 Ga0501076_0136338 3300049592 Bacteria 1992
819 Ga0501076_0137306 3300049592 Bacteria 1985
820 Ga0501076_0209492 3300049592 Bacteria 1592
821 Ga0501076_0610213 3300049592 Bacteria 900
822 Ga0501076_1595835 3300049592 Bacteria 535
823 Ga0501077_0058278 3300049593 Bacteria 2451
824 Ga0501077_0209806 3300049593 Bacteria 1238
825 Ga0501077_0792412 3300049593 Bacteria 609
826 Ga0501199_048697 3300049650 Bacteria 567
827 Ga0501202_064865 3300049652 Bacteria 832
828 Ga0501208_112977 3300049655 Bacteria 593
829 Ga0501209_056512 3300049656 Bacteria 1084
830 Ga0501211_022121 3300049658 Bacteria 673
831 Ga0501214_073368 3300049659 Bacteria 563
832 Ga0501228_037647 3300049666 Bacteria 618
833 Ga0501233_147379 3300049668 Bacteria 654
834 Ga0501235_052929 3300049669 Bacteria 943
835 Ga0501239_024334 3300049672 Bacteria 762
836 Ga0501239_048475 3300049672 Bacteria 608
837 Ga0501243_016601 3300049675 Bacteria 1189
838 Ga0501251_057662 3300049681 Bacteria 632
839 Ga0501261_037271 3300049690 Bacteria 755
840 Ga0501225_0218887 3300049705 Bacteria 612
841 Ga0501079_0033531 3300049741 Bacteria 3950
842 Ga0501079_0050830 3300049741 Bacteria 3198
843 Ga0501079_1466146 3300049741 Bacteria 537
844 Ga0501080_0090497 3300049742 Bacteria 2842
845 Ga0501080_0248500 3300049742 Bacteria 1622
846 Ga0501080_0401276 3300049742 Bacteria 1233
847 Ga0501081_0025332 3300049743 Bacteria 3990
848 Ga0501081_0026245 3300049743 Bacteria 3926
849 Ga0501081_0094214 3300049743 Bacteria 2109
850 Ga0501081_0428909 3300049743 Bacteria 981
851 Ga0501083_0026775 3300049744 Bacteria 3984
852 Ga0501083_0686370 3300049744 Bacteria 666
853 Ga0501265_036451 3300049762 Bacteria 728
854 Ga0501271_035068 3300049768 Bacteria 634
855 Ga0501275_034329 3300049772 Bacteria 685
856 Ga0501280_112236 3300049776 Bacteria 533
857 Ga0501283_096921 3300049779 Bacteria 570
858 Ga0501035_0026873 3300049822 Bacteria 5263
859 Ga0501044_0998968 3300049823 Bacteria 709
860 Ga0501044_1072297 3300049823 Bacteria 676
861 Ga0501044_1379829 3300049823 Bacteria 570
862 Ga0501045_0096174 3300049824 Bacteria 2191
863 Ga0501045_0103098 3300049824 Bacteria 2112
864 Ga0501045_0163446 3300049824 Bacteria 1657
865 Ga0501045_0179419 3300049824 Bacteria 1578
866 Ga0501045_0289912 3300049824 Bacteria 1218
867 Ga0501045_1050561 3300049824 Bacteria 596
868 Ga0501045_1054204 3300049824 Bacteria 595
869 Ga0501212_022700 3300049851 Bacteria 980
870 nmdc:mga0yw44_337332_c1 3300050492 Bacteria 1014
871 nmdc:mga05p37_254741_c1 3300050507 Bacteria 2104
872 nmdc:mga05p37_609611_c1 3300050507 Bacteria 1231
873 nmdc:mga05p37_866448_c2 3300050507 Bacteria 658
874 nmdc:mga09592_1639545_c1 3300050508 Bacteria 520
875 nmdc:mga06r32_84995_c1 3300050510 Bacteria 3085
876 nmdc:mga08y16_1251634_c1 3300050511 Bacteria 711
877 nmdc:mga08y16_65151_c1 3300050511 Bacteria 3804
878 nmdc:mga08y16_772377_c1 3300050511 Bacteria 956
879 nmdc:mga0n895_1943878_c1 3300050512 Bacteria 547
880 nmdc:mga0n895_2029175_c1 3300050512 Bacteria 533
881 nmdc:mga0n895_220821_c1 3300050512 Bacteria 1924
882 nmdc:mga0n895_426803_c1 3300050512 Bacteria 1340
883 nmdc:mga0rr50_1175421_c1 3300050513 Bacteria 652
884 nmdc:mga0rr50_627379_c1 3300050513 Bacteria 917
885 nmdc:mga0rr50_670906_c1 3300050513 Bacteria 885
886 nmdc:mga08x19_1002929_c1 3300050514 Bacteria 593
887 nmdc:mga08x19_157770_c1 3300050514 Bacteria 1540
888 nmdc:mga08x19_480054_c1 3300050514 Bacteria 876
889 nmdc:mga0a205_143170_c1 3300050515 Bacteria 2291
890 nmdc:mga0a205_182722_c1 3300050515 Bacteria 1991
891 nmdc:mga0a205_456320_c1 3300050515 Bacteria 1138
892 nmdc:mga0a205_62566_c1 3300050515 Bacteria 3596
893 Ga0495601_0183820 3300053077 Bacteria 1366
894 Ga0495595_0469754 3300053084 Bacteria 640
895 Ga0495619_0252467 3300053085 Bacteria 1222
896 Ga0501084_0029119 3300054114 Bacteria 4618
897 Ga0501084_0046030 3300054114 Bacteria 3653
898 Ga0501084_0050245 3300054114 Bacteria 3490
899 Ga0501084_0210828 3300054114 Bacteria 1639
900 Ga0501084_0305614 3300054114 Bacteria 1343
901 Ga0501084_1037797 3300054114 Bacteria 689
902 Ga0501084_1046972 3300054114 Bacteria 685
903 Ga0501084_1375258 3300054114 Bacteria 591
904 Ga0501084_1738268 3300054114 Bacteria 521
905 Ga0590071_000248 3300059421 Bacteria 15569
906 Ga0590075_017008 3300059424 Bacteria 1790
907 Ga0590077_003053 3300059426 Bacteria 3505
908 Ga0587070_107059 3300059491 Bacteria 651
909 Ga0587083_0116511 3300059505 Bacteria 685
910 Ga0587085_015084 3300059506 Bacteria 1099
911 Ga0587085_131928 3300059506 Bacteria 559
912 Ga0587088_180709 3300059508 Bacteria 528
913 Ga0587091_179412 3300059511 Bacteria 556
914 Ga0587115_119155 3300059626 Bacteria 506
915 Ga0587068_056768 3300059641 Bacteria 745
916 Ga0587072_114303 3300059643 Bacteria 619
917 Ga0587075_060704 3300059644 Bacteria 681
918 Ga0587076_031031 3300059645 Bacteria 947
919 Ga0587076_072166 3300059645 Bacteria 719
920 Ga0587105_031174 3300059651 Bacteria 509
921 Ga0587107_077363 3300059652 Bacteria 619
922 Ga0587107_095147 3300059652 Bacteria 581
923 Ga0587107_155323 3300059652 Bacteria 500
924 Ga0587111_0140164 3300060346 Bacteria 640
925 Ga0501082_0036718 3300060353 Bacteria 4221
926 Ga0501082_0168911 3300060353 Bacteria 1901
927 Ga0501082_0208907 3300060353 Bacteria 1698
928 Ga0501082_0316052 3300060353 Bacteria 1360
929 Ga0501082_0390122 3300060353 Bacteria 1215
930 Ga0501082_0458266 3300060353 Bacteria 1114
931 Ga0501082_0605213 3300060353 Bacteria 959
932 Ga0501082_0749769 3300060353 Bacteria 854
933 Ga0501082_1786186 3300060353 Bacteria 536
934 Ga0530510_0009759 3300061734 Bacteria 6736
935 Ga0530510_0011210 3300061734 Bacteria 6290
936 Ga0530510_0015703 3300061734 Bacteria 5352
937 Ga0530510_0118231 3300061734 Bacteria 1944
938 Ga0530510_0491830 3300061734 Bacteria 930
939 Ga0530510_1122535 3300061734 Bacteria 602
940 Ga0075433_10944981
941 JGI24752J21851_1060694
942 JGI24747J21853_1033409
943 JGI24743J22301_10055653
944 JGI24738J21930_10125194
945 JGI24749J21850_1056825
946 JGI24744J21845_10077481
947 JGI24033J26618_1036890
948 JGI24034J26672_10052766
949 JGI24751J29686_10008660
950 JGI24751J29686_10013331
951 JGI25406J46586_10009666
952 Ga0058859_10030995
953 Ga0058859_11829737
954 Ga0058861_12053711
955 Ga0058860_10027684
956 Ga0058860_10072498
957 Ga0058862_10027267
958 Ga0065704_10372827
959 Ga0065712_10401795
960 Ga0065712_10470215
961 Ga0065715_10635613
962 Ga0065707_10879597
963 Ga0070676_10934862
964 Ga0070683_100507299
965 Ga0070683_100736430
966 Ga0070683_101674936
967 Ga0070690_100162217
968 Ga0070690_100326368
969 Ga0070690_100518175
970 Ga0070690_100838012
971 Ga0070670_100669920
972 Ga0070670_100741920
973 Ga0070670_101323924
974 Ga0068869_100840343
975 Ga0068869_101146566
976 Ga0068869_101365169
977 Ga0070666_10084589
978 Ga0070666_10262112
979 Ga0070666_10599745
980 Ga0070666_11458733
981 Ga0070680_100020531
982 Ga0070680_100321120
983 Ga0070680_100576128
984 Ga0070680_100580712
985 Ga0070680_100682548
986 Ga0070680_101458830
987 Ga0070682_100641078
988 Ga0070682_100805663
989 Ga0068868_100325958
990 Ga0068868_100349188
991 Ga0068868_101244518
992 Ga0068868_101630724
993 Ga0068868_102089699
994 Ga0070689_100304847
995 Ga0070689_100493916
996 Ga0070689_100541992
997 Ga0070689_100917548
998 Ga0070691_10273603
999 Ga0070691_10299909
1000 Ga0070691_10350481
1001 Ga0070691_10407414
1002 Ga0070687_100221259
1003 Ga0070687_100394638
1004 Ga0070687_100641959
1005 Ga0070661_100569102
1006 Ga0070692_10232284
1007 Ga0070692_10459666
1008 Ga0070692_10943177
1009 Ga0070668_100302628
1010 Ga0070669_101174249
1011 Ga0070669_101916647
1012 Ga0070669_101924034
1013 Ga0070675_100471991
1014 Ga0070675_100894687
1015 Ga0070675_101344378
1016 Ga0070675_101519746
1017 Ga0070671_100071958
1018 Ga0070674_100103993
1019 Ga0070674_100628650
1020 Ga0070674_101320877
1021 Ga0070673_100076409
1022 Ga0070673_100839966
1023 Ga0070688_100362033
1024 Ga0070688_100480838
1025 Ga0070659_100642432
1026 Ga0070659_100729270
1027 Ga0070667_100075769
1028 Ga0070667_100259161
1029 Ga0070667_100329789
1030 Ga0070667_100556519
1031 Ga0070703_10186047
1032 Ga0070713_101648358
1033 Ga0070710_11343549
1034 Ga0070701_10024455
1035 Ga0070701_10054367
1036 Ga0070701_10489370
1037 Ga0070711_100677549
1038 Ga0070705_100028430
1039 Ga0070705_100280402
1040 Ga0070705_101054690
1041 Ga0070705_101740219
1042 Ga0070700_100036116
1043 Ga0070700_100732067
1044 Ga0070700_100773600
1045 Ga0070700_100796730
1046 Ga0070700_100883108
1047 Ga0070700_101261422
1048 Ga0070700_101992676
1049 Ga0070694_100607329
1050 Ga0070694_100678039
1051 Ga0070694_100794457
1052 Ga0070694_101080886
1053 Ga0070694_101422324
1054 Ga0070708_100021693
1055 Ga0070708_100083016
1056 Ga0070708_100173962
1057 Ga0070708_100342283
1058 Ga0070708_100941451
1059 Ga0070708_101091673
1060 Ga0070708_101173597
1061 Ga0070663_100004558
1062 Ga0070663_100504094
1063 Ga0070663_100995753
1064 Ga0070678_100159402
1065 Ga0070678_100765070
1066 Ga0070678_102065119
1067 Ga0070662_101509288
1068 Ga0070681_10283178
1069 Ga0070681_11076664
1070 Ga0068867_100260956
1071 Ga0068867_101750357
1072 Ga0068867_102087865
1073 Ga0068867_102343798
1074 Ga0070685_10336638
1075 Ga0070685_10438397
1076 Ga0070685_10618241
1077 Ga0070706_100040516
1078 Ga0070706_100484590
1079 Ga0070706_100902145
1080 Ga0070706_101628946
1081 Ga0070707_100098692
1082 Ga0070707_100291996
1083 Ga0070707_101085172
1084 Ga0070707_101436453
1085 Ga0070707_101628786
1086 Ga0070707_102323121
1087 Ga0070698_100045715
1088 Ga0070698_100084781
1089 Ga0070698_100128772
1090 Ga0070698_100920159
1091 Ga0070698_100926067
1092 Ga0070698_100993079
1093 Ga0070698_101065374
1094 Ga0070698_101118251
1095 Ga0070698_101356538
1096 Ga0070698_101814622
1097 Ga0070699_100077369
1098 Ga0070699_100181167
1099 Ga0070699_100773320
1100 Ga0070699_100855497
1101 Ga0070699_100875053
1102 Ga0070699_101092972
1103 Ga0070699_101445732
1104 Ga0070699_101794379
1105 Ga0070699_102051599
1106 Ga0070679_100562028
1107 Ga0070679_101089076
1108 Ga0070679_101767495
1109 Ga0070679_102106117
1110 Ga0070684_100182697
1111 Ga0070684_100320665
1112 Ga0070684_100754584
1113 Ga0070684_101589770
1114 Ga0070697_100012567
1115 Ga0070697_100081282
1116 Ga0070697_100105328
1117 Ga0070697_100184681
1118 Ga0070697_100481821
1119 Ga0070697_100723975
1120 Ga0070697_101123849
1121 Ga0070697_101429689
1122 Ga0070697_101653937
1123 Ga0068853_101848543
1124 Ga0070672_101958419
1125 Ga0070686_100117462
1126 Ga0070686_100240245
1127 Ga0070686_100521042
1128 Ga0070686_100829016
1129 Ga0070686_101232466
1130 Ga0070686_101609910
1131 Ga0070686_101666956
1132 Ga0070695_100039268
1133 Ga0070695_100080457
1134 Ga0070695_100395406
1135 Ga0070695_100482640
1136 Ga0070695_101218731
1137 Ga0070696_100048649
1138 Ga0070696_100275622
1139 Ga0070696_100296747
1140 Ga0070696_100367818
1141 Ga0070696_100752543
1142 Ga0070696_100811911
1143 Ga0070696_101222000
1144 Ga0070696_101650052
1145 Ga0070696_101790118
1146 Ga0070693_100448998
1147 Ga0070693_100992972
1148 Ga0070693_101400411
1149 Ga0070704_100202396
1150 Ga0070704_100338901
1151 Ga0070704_100439002
1152 Ga0070704_100842662
1153 Ga0070704_101833780
1154 Ga0070704_101979963
1155 Ga0070704_102071092
1156 Ga0068855_101000371
1157 Ga0070664_100705157
1158 Ga0070664_100724302
1159 Ga0068857_100137897
1160 Ga0068857_100298521
1161 Ga0068857_100487636
1162 Ga0068857_100773477
1163 Ga0068857_101146947
1164 Ga0068854_101023035
1165 Ga0068854_101618104
1166 Ga0068854_101708474
1167 Ga0068854_101956811
1168 Ga0068856_100307662
1169 Ga0068856_101835619
1170 Ga0068856_102722090
1171 Ga0070702_100086340
1172 Ga0070702_100366736
1173 Ga0070702_100421618
1174 Ga0070702_100539905
1175 Ga0070702_101783717
1176 Ga0068852_100217744
1177 Ga0068852_100866168
1178 Ga0068859_100551157
1179 Ga0068859_101456537
1180 Ga0068864_100118277
1181 Ga0068864_100457461
1182 Ga0068866_10279534
1183 Ga0068866_11338054
1184 Ga0068861_100043615
1185 Ga0068861_100485872
1186 Ga0068861_100724626
1187 Ga0068861_101021100
1188 Ga0068861_101044093
1189 Ga0068861_101214951
1190 Ga0068851_10264226
1191 Ga0068870_10219194
1192 Ga0068870_10735801
1193 Ga0068863_100982498
1194 Ga0068863_101413859
1195 Ga0068858_100027244
1196 Ga0068858_100477059
1197 Ga0068858_101075074
1198 Ga0068858_101514665
1199 Ga0068860_100024658
1200 Ga0068860_100531553
1201 Ga0068862_101281327
1202 Ga0081539_10002087
1203 Ga0081539_10318578
1204 Ga0075365_10279193
1205 Ga0075364_10962093
1206 Ga0075432_10037946
1207 Ga0070715_10558793
1208 Ga0070716_100263972
1209 Ga0070716_101271664
1210 Ga0070716_101721500
1211 Ga0070712_100981020
1212 Ga0097621_100150529
1213 Ga0097621_100361892
1214 Ga0097621_100807415
1215 Ga0097621_102328181
1216 Ga0068871_100103647
1217 Ga0068871_100434328
1218 Ga0068871_100896880
1219 Ga0075428_100731357
1220 Ga0075428_101943549
1221 Ga0075431_100254993
1222 Ga0075433_10019795
1223 Ga0075433_10163918
1224 Ga0075433_10271267
1225 Ga0075434_100807010
1226 Ga0075434_101116554
1227 Ga0068865_100159465
1228 Ga0068865_100226429
1229 Ga0068865_100288295
1230 Ga0068865_100575930
1231 Ga0068865_101826023
1232 Ga0075436_100122500
1233 Ga0097620_100551131
1234 Ga0097620_101456521
1235 Ga0075435_100232450
1236 Ga0075435_100463524
1237 Ga0075435_100522835
1238 Ga0075435_100659383
1239 Ga0075435_100756312
1240 Ga0099795_10303707
1241 Ga0105251_10066999
1242 Ga0105244_10186311
1243 Ga0105250_10605431
1244 Ga0105240_11120153
1245 Ga0105240_11173332
1246 Ga0111539_10628948
1247 Ga0111539_11331570
1248 Ga0111539_11404096
1249 Ga0111539_12267385
1250 Ga0105245_10220019
1251 Ga0105245_10746505
1252 Ga0105245_10755149
1253 Ga0105245_11166052
1254 Ga0105245_11570092
1255 Ga0105245_13253944
1256 Ga0105247_10170111
1257 Ga0105247_10861632
1258 Ga0105247_11201884
1259 Ga0105247_11692624
1260 Ga0114129_10181666
1261 Ga0114129_11118621
1262 Ga0114129_11611101
1263 Ga0114129_12174935
1264 Ga0105243_10585040
1265 Ga0105243_10637014
1266 Ga0105243_10781936
1267 Ga0105243_10789027
1268 Ga0105243_11139061
1269 Ga0105243_11924829
1270 Ga0105243_12518553
1271 Ga0105243_12597863
1272 Ga0105241_10558779
1273 Ga0105241_12571318
1274 Ga0105242_10245777
1275 Ga0105242_10297351
1276 Ga0105242_10463114
1277 Ga0105242_10839274
1278 Ga0105242_11050225
1279 Ga0105242_11318241
1280 Ga0105248_10041220
1281 Ga0105248_10784244
1282 Ga0105248_11178129
1283 Ga0105248_11510176
1284 Ga0105248_12261881
1285 Ga0105248_13313266
1286 Ga0105237_10611139
1287 Ga0105237_10966472
1288 Ga0105238_10328716
1289 Ga0105238_10825244
1290 Ga0105238_11131346
1291 Ga0105249_10019204
1292 Ga0105249_10492138
1293 Ga0105249_11308605
1294 Ga0105249_11369838
1295 Ga0105249_11885749
1296 Ga0105249_12278481
1297 Ga0105249_12829331
1298 Ga0105249_13079667
1299 Ga0105239_10319281
1300 Ga0105239_11173510
1301 Ga0105239_12166299
1302 Ga0105239_12265214
1303 Ga0105239_12812473
1304 Ga0105246_10041027
1305 Ga0105246_10329895
1306 Ga0105246_10942752
1307 Ga0105246_10968939
1308 Ga0105246_11456342
1309 Ga0105246_12110491
1310 Ga0157343_1007894
1311 Ga0157323_1004802
1312 Ga0157371_10337438
1313 Ga0157370_11061661
1314 Ga0157374_10155022
1315 Ga0157374_10265742
1316 Ga0157374_10728428
1317 Ga0157378_10015276
1318 Ga0157378_10913110
1319 Ga0157378_11259696
1320 Ga0157378_11553276
1321 Ga0163162_10088800
1322 Ga0163162_11255603
1323 Ga0163162_11783920
1324 Ga0163162_12848112
1325 Ga0163162_13123335
1326 Ga0157372_10800022
1327 Ga0157372_11560230
1328 Ga0157375_10912092
1329 Ga0157375_11151575
1330 Ga0157375_13454274
1331 Ga0157375_13675404
1332 Ga0163163_10259786
1333 Ga0163163_10526117
1334 Ga0163163_10743049
1335 Ga0163163_11444496
1336 Ga0163163_11756174
1337 Ga0163163_11812411
1338 Ga0163163_12069663
1339 Ga0163163_13043396
1340 Ga0157380_10012801
1341 Ga0157380_11037451
1342 Ga0157380_11040742
1343 Ga0157380_11514832
1344 Ga0157380_12996746
1345 Ga0157380_13364968
1346 Ga0157377_10076167
1347 Ga0157377_10417560
1348 Ga0157377_10483225
1349 Ga0157379_10549666
1350 Ga0157379_11122397
1351 Ga0157379_11441509
1352 Ga0157379_11449126
1353 Ga0157376_10148277
1354 Ga0157376_11024663
1355 Ga0157376_11898288
1356 Ga0163161_10605041
1357 Ga0163161_10623128
1358 Ga0163161_10735802
1359 Ga0206356_10505645
1360 Ga0206352_11256669
1361 Ga0206354_10678292
1362 Ga0207697_10103881
1363 Ga0207656_10221892
1364 Ga0207713_1061982
1365 Ga0207653_10063012
1366 Ga0207653_10158204
1367 Ga0207653_10346741
1368 Ga0207692_11071524
1369 Ga0207710_10551947
1370 Ga0207688_10728680
1371 Ga0207688_10794965
1372 Ga0207680_10238277
1373 Ga0207680_10345252
1374 Ga0207647_10022808
1375 Ga0207685_10132869
1376 Ga0207645_10140018
1377 Ga0207645_10472654
1378 Ga0207643_10391655
1379 Ga0207684_10023984
1380 Ga0207684_10393037
1381 Ga0207707_10224487
1382 Ga0207707_10290941
1383 Ga0207695_10853129
1384 Ga0207671_10281017
1385 Ga0207693_10691971
1386 Ga0207660_10000002
1387 Ga0207662_10451250
1388 Ga0207662_10551726
1389 Ga0207657_10381984
1390 Ga0207649_10417978
1391 Ga0207649_11343857
1392 Ga0207652_11691138
1393 Ga0207646_10004216
1394 Ga0207646_10344489
1395 Ga0207646_10430443
1396 Ga0207646_10669247
1397 Ga0207646_11308692
1398 Ga0207650_10856254
1399 Ga0207659_10608607
1400 Ga0207659_11055178
1401 Ga0207687_10046120
1402 Ga0207687_10205866
1403 Ga0207687_10245227
1404 Ga0207687_10541964
1405 Ga0207687_10665427
1406 Ga0207644_10066480
1407 Ga0207644_10855190
1408 Ga0207644_11103092
1409 Ga0207690_10050244
1410 Ga0207690_11293243
1411 Ga0207706_10046490
1412 Ga0207706_11053782
1413 Ga0207686_10341698
1414 Ga0207686_10657768
1415 Ga0207686_10663648
1416 Ga0207709_10010646
1417 Ga0207709_10080062
1418 Ga0207709_10969481
1419 Ga0207670_10754289
1420 Ga0207670_11314009
1421 Ga0207669_10005197
1422 Ga0207669_10022441
1423 Ga0207669_10737737
1424 Ga0207669_10850612
1425 Ga0207704_10153708
1426 Ga0207704_10533180
1427 Ga0207704_10825826
1428 Ga0207665_10412618
1429 Ga0207665_11414374
1430 Ga0207691_11758036
1431 Ga0207711_10059034
1432 Ga0207711_10408907
1433 Ga0207689_10662255
1434 Ga0207689_10948874
1435 Ga0207661_10212042
1436 Ga0207661_10436866
1437 Ga0207667_10791170
1438 Ga0207651_11479702
1439 Ga0207712_10634298
1440 Ga0207712_11290679
1441 Ga0207712_11451262
1442 Ga0207668_10856634
1443 Ga0207640_10213275
1444 Ga0207640_11872801
1445 Ga0207658_10302443
1446 Ga0207658_12070465
1447 Ga0207677_10528251
1448 Ga0207677_10728964
1449 Ga0207677_11417490
1450 Ga0207703_10065297
1451 Ga0207703_10886928
1452 Ga0207703_12275174
1453 Ga0207639_10907276
1454 Ga0207639_10971666
1455 Ga0207678_10017028
1456 Ga0207678_10276342
1457 Ga0207678_11598135
1458 Ga0207708_10017492
1459 Ga0207708_10524672
1460 Ga0207708_10856134
1461 Ga0207708_11777193
1462 Ga0207702_10729756
1463 Ga0207702_11057120
1464 Ga0207641_11341754
1465 Ga0207648_10799580
1466 Ga0207676_10243897
1467 Ga0207676_10508450
1468 Ga0207676_11361056
1469 Ga0207674_10096522
1470 Ga0207674_10850537
1471 Ga0207674_11033956
1472 Ga0207675_100573084
1473 Ga0207675_100822742
1474 Ga0207675_101054815
1475 Ga0207675_101383480
1476 Ga0207683_10114781
1477 Ga0207683_10486201
1478 Ga0207683_10807356
1479 Ga0207698_10020697
1480 Ga0209973_1020358
1481 Ga0209984_1038469
1482 Ga0209968_1005468
1483 Ga0209982_1006777
1484 Ga0210002_1049075
1485 Ga0209983_1020600
1486 Ga0209983_1044215
1487 Ga0209983_1050545
1488 Ga0209971_1019669
1489 Ga0209971_1179172
1490 Ga0209966_1091951
1491 Ga0209998_10007548
1492 Ga0209974_10016162
1493 Ga0209974_10028771
1494 Ga0209974_10090696
1495 Ga0209974_10424313
1496 Ga0209974_10429919
1497 Ga0207428_10181308
1498 Ga0268264_10274106
1499 Ga0268264_12025853
1500 Ga0268264_12453410
1501 Ga0307408_100041695
1502 Ga0307408_101944643
1503 Ga0307405_10476490
1504 Ga0307413_10078953
1505 Ga0307413_10293782
1506 Ga0307413_11278474
1507 Ga0307410_11539614
1508 Ga0307410_11673601
1509 Ga0307406_11402688
1510 Ga0307407_10154985
1511 Ga0307412_10158459
1512 Ga0307409_100044842
1513 Ga0307409_100318090
1514 Ga0307409_100852074
1515 Ga0307416_100042187
1516 Ga0307416_100307797
1517 Ga0307416_101333408
1518 Ga0307416_102548829
1519 Ga0307414_10782384
1520 Ga0307414_10952636
1521 Ga0307415_100063143
1522 Ga0307415_100120780
1523 Ga0307415_101454292
1524 Ga0373948_0167434
1525 Ga0373948_0201665
1526 Ga0373950_0120545
1527 Ga0373958_0041078
1528 Ga0373926_0098127
1529 Ga0373929_0147805
1530 Ga0373949_0049115
1531 Ga0373951_0233715
1532 Ga0373932_0103774
1533 Ga0373941_0131513
1534 Ga0373941_0288517
1535 Ga0373941_0392496
1536 Ga0373960_0063732
1537 Ga0373960_0282269
1538 Ga0373946_0507291
1539 Ga0373955_0332584
1540 Ga0373961_0235479
1541 Ga0373962_0072589
1542 Ga0373931_0194604
1543 Ga0373931_1020186
1544 Ga0373933_0757909
1545 Ga0395901_0312615
1546 Ga0242419_005567
1547 Ga0242420_064558
1548 Ga0439453_0180418
1549 Ga0439466_0041798
1550 Ga0451807_0415819
1551 Ga0439431_0178426
1552 Ga0450914_034842
1553 Ga0450920_131719
1554 Ga0450923_015004
1555 Ga0450897_034538
1556 Ga0450906_013042
1557 Ga0450910_060232
1558 Ga0450910_068298
1559 Ga0450908_044198
1560 Ga0450909_021128
1561 Ga0439434_0085821
1562 Ga0439434_0088566
1563 Ga0439459_0033618
1564 Ga0450916_073568
1565 Ga0451577_0060452
1566 Ga0451577_1377332
1567 Ga0453683_0018052
1568 Ga0453683_0383037
1569 Ga0453684_0794841
1570 Ga0453684_1421790
1571 Ga0451576_0040408
1572 Ga0466967_1874688
1573 Ga0495603_0220251
1574 Ga0495582_0264675
1575 Ga0495582_0387772
1576 Ga0495662_0258322
1577 Ga0495644_0073999
1578 Ga0495663_0086016
1579 Ga0495609_0313839
1580 Ga0495656_0779253
1581 Ga0495611_0230567
1582 Ga0495659_0221644
1583 Ga0495659_0293609
1584 Ga0495647_0122158
1585 Ga0495658_0951817
1586 Ga0495613_1013100
1587 Ga0495624_0867277
1588 Ga0495649_0236389
1589 Ga0495676_0412536
1590 Ga0495614_0426175
1591 Ga0495614_0652200
1592 Ga0496100_0891638
1593 Ga0496101_0462519
1594 Ga0496101_0777076
1595 Ga0496101_0844817
1596 Ga0496101_0945591
1597 Ga0496101_1414834
1598 Ga0496102_0221210
1599 Ga0496102_0406039
1600 Ga0496102_0765094
1601 Ga0496102_0989738
1602 Ga0496102_1128921
1603 Ga0496103_0011651
1604 Ga0496103_0511251
1605 Ga0496103_0772581
1606 Ga0496104_0022038
1607 Ga0496104_0048572
1608 Ga0496104_0173708
1609 Ga0496104_0257888
1610 Ga0496104_0897486
1611 Ga0496105_0079537
1612 Ga0496105_0202168
1613 Ga0496105_0326202
1614 Ga0496106_0189802
1615 Ga0496106_0244933
1616 Ga0496106_0245719
1617 Ga0496106_0787726
1618 Ga0496106_1055409
1619 Ga0496107_0692959
1620 Ga0496107_1042464
1621 Ga0496107_1266685
1622 Ga0496107_1270194
1623 Ga0496108_0005881
1624 Ga0496108_0021720
1625 Ga0496108_0133733
1626 Ga0496108_0152665
1627 Ga0496109_0007365
1628 Ga0496109_0069348
1629 Ga0496109_0122176
1630 Ga0496109_0416989
1631 Ga0496109_0724174
1632 Ga0496109_1214845
1633 Ga0496109_1731753
1634 Ga0496110_0032222
1635 Ga0496110_0032784
1636 Ga0496110_0411793
1637 Ga0496110_1577385
1638 Ga0496111_0031782
1639 Ga0496111_0070108
1640 Ga0496111_0158088
1641 Ga0496111_0198587
1642 Ga0496111_0974252
1643 Ga0496112_0002921
1644 Ga0496112_0047852
1645 Ga0496112_0246234
1646 Ga0496112_0367774
1647 Ga0496112_0962457
1648 Ga0496112_1342087
1649 Ga0496112_1715513
1650 Ga0496113_0010238
1651 Ga0496113_0233291
1652 Ga0496113_0324452
1653 Ga0496113_0697451
1654 Ga0496114_0165095
1655 Ga0496114_0182212
1656 Ga0496114_0689443
1657 Ga0496114_0997559
1658 Ga0501306_039538
1659 Ga0501292_030302
1660 Ga0501297_013444
1661 Ga0501298_138082
1662 Ga0501311_043854
1663 Ga0501316_050421
1664 Ga0501317_007952
1665 Ga0501318_080817
1666 Ga0501325_008381
1667 Ga0501325_016689
1668 Ga0501031_0012970
1669 Ga0501031_0197050
1670 Ga0501031_0324091
1671 Ga0501032_0110492
1672 Ga0501032_0183002
1673 Ga0501033_0568113
1674 Ga0501033_0616993
1675 Ga0501034_0276328
1676 Ga0501036_0013129
1677 Ga0501036_0165028
1678 Ga0501036_0462525
1679 Ga0501036_0550955
1680 Ga0501037_0076034
1681 Ga0501037_0463857
1682 Ga0501037_0685506
1683 Ga0501038_0059905
1684 Ga0501038_0699934
1685 Ga0501038_0824239
1686 Ga0501038_0944003
1687 Ga0501039_0069732
1688 Ga0501039_0511992
1689 Ga0501039_0719628
1690 Ga0501039_0788581
1691 Ga0501039_1067909
1692 Ga0501040_0011743
1693 Ga0501040_0141185
1694 Ga0501040_0161072
1695 Ga0501040_0225921
1696 Ga0501040_0387918
1697 Ga0501040_0813457
1698 Ga0501041_0020309
1699 Ga0501041_0049911
1700 Ga0501041_0113853
1701 Ga0501041_0140295
1702 Ga0501041_0411664
1703 Ga0501041_0671731
1704 Ga0501041_1050999
1705 Ga0501042_0074548
1706 Ga0501042_0522630
1707 Ga0501042_0542931
1708 Ga0501042_1388916
1709 Ga0501042_1443820
1710 Ga0501043_0831378
1711 Ga0501043_1091685
1712 Ga0501046_0237089
1713 Ga0501046_0288148
1714 Ga0501046_0446722
1715 Ga0501046_0586255
1716 Ga0501046_0620260
1717 Ga0501048_0012332
1718 Ga0501048_0069814
1719 Ga0501048_0173849
1720 Ga0501048_0224285
1721 Ga0501048_0564750
1722 Ga0501067_0011868
1723 Ga0501067_0358212
1724 Ga0501068_0013746
1725 Ga0501068_0515690
1726 Ga0501068_0861721
1727 Ga0501068_1139883
1728 Ga0501069_0004365
1729 Ga0501069_0022378
1730 Ga0501069_0806667
1731 Ga0501070_0100767
1732 Ga0501071_0016406
1733 Ga0501071_0448364
1734 Ga0501071_0855269
1735 Ga0501071_1366397
1736 Ga0501072_0284427
1737 Ga0501072_0298988
1738 Ga0501072_0365326
1739 Ga0501072_0517392
1740 Ga0501072_0897159
1741 Ga0501072_0899607
1742 Ga0501072_1049087
1743 Ga0501072_1149706
1744 Ga0501073_0078522
1745 Ga0501073_0467456
1746 Ga0501073_0521317
1747 Ga0501074_0074160
1748 Ga0501074_0939660
1749 Ga0501074_1001522
1750 Ga0501075_0037524
1751 Ga0501075_0097340
1752 Ga0501075_0715528
1753 Ga0501075_1304411
1754 Ga0501075_1551587
1755 Ga0501076_0069984
1756 Ga0501076_0107435
1757 Ga0501076_0136338
1758 Ga0501076_0137306
1759 Ga0501076_0209492
1760 Ga0501076_0610213
1761 Ga0501076_1595835
1762 Ga0501077_0058278
1763 Ga0501077_0209806
1764 Ga0501077_0792412
1765 Ga0501199_048697
1766 Ga0501202_064865
1767 Ga0501208_112977
1768 Ga0501209_056512
1769 Ga0501211_022121
1770 Ga0501214_073368
1771 Ga0501228_037647
1772 Ga0501233_147379
1773 Ga0501235_052929
1774 Ga0501239_024334
1775 Ga0501239_048475
1776 Ga0501243_016601
1777 Ga0501251_057662
1778 Ga0501261_037271
1779 Ga0501225_0218887
1780 Ga0501079_0033531
1781 Ga0501079_0050830
1782 Ga0501079_1466146
1783 Ga0501080_0090497
1784 Ga0501080_0248500
1785 Ga0501080_0401276
1786 Ga0501081_0025332
1787 Ga0501081_0026245
1788 Ga0501081_0094214
1789 Ga0501081_0428909
1790 Ga0501083_0026775
1791 Ga0501083_0686370
1792 Ga0501265_036451
1793 Ga0501271_035068
1794 Ga0501275_034329
1795 Ga0501280_112236
1796 Ga0501283_096921
1797 Ga0501035_0026873
1798 Ga0501044_0998968
1799 Ga0501044_1072297
1800 Ga0501044_1379829
1801 Ga0501045_0096174
1802 Ga0501045_0103098
1803 Ga0501045_0163446
1804 Ga0501045_0179419
1805 Ga0501045_0289912
1806 Ga0501045_1050561
1807 Ga0501045_1054204
1808 Ga0501212_022700
1809 nmdc:mga0yw44_337332_c1
1810 nmdc:mga05p37_254741_c1
1811 nmdc:mga05p37_609611_c1
1812 nmdc:mga05p37_866448_c2
1813 nmdc:mga09592_1639545_c1
1814 nmdc:mga06r32_84995_c1
1815 nmdc:mga08y16_1251634_c1
1816 nmdc:mga08y16_65151_c1
1817 nmdc:mga08y16_772377_c1
1818 nmdc:mga0n895_1943878_c1
1819 nmdc:mga0n895_2029175_c1
1820 nmdc:mga0n895_220821_c1
1821 nmdc:mga0n895_426803_c1
1822 nmdc:mga0rr50_1175421_c1
1823 nmdc:mga0rr50_627379_c1
1824 nmdc:mga0rr50_670906_c1
1825 nmdc:mga08x19_1002929_c1
1826 nmdc:mga08x19_157770_c1
1827 nmdc:mga08x19_480054_c1
1828 nmdc:mga0a205_143170_c1
1829 nmdc:mga0a205_182722_c1
1830 nmdc:mga0a205_456320_c1
1831 nmdc:mga0a205_62566_c1
1832 Ga0495601_0183820
1833 Ga0495595_0469754
1834 Ga0495619_0252467
1835 Ga0501084_0029119
1836 Ga0501084_0046030
1837 Ga0501084_0050245
1838 Ga0501084_0210828
1839 Ga0501084_0305614
1840 Ga0501084_1037797
1841 Ga0501084_1046972
1842 Ga0501084_1375258
1843 Ga0501084_1738268
1844 Ga0590071_000248
1845 Ga0590075_017008
1846 Ga0590077_003053
1847 Ga0587070_107059
1848 Ga0587083_0116511
1849 Ga0587085_015084
1850 Ga0587085_131928
1851 Ga0587088_180709
1852 Ga0587091_179412
1853 Ga0587115_119155
1854 Ga0587068_056768
1855 Ga0587072_114303
1856 Ga0587075_060704
1857 Ga0587076_031031
1858 Ga0587076_072166
1859 Ga0587105_031174
1860 Ga0587107_077363
1861 Ga0587107_095147
1862 Ga0587107_155323
1863 Ga0587111_0140164
1864 Ga0501082_0036718
1865 Ga0501082_0168911
1866 Ga0501082_0208907
1867 Ga0501082_0316052
1868 Ga0501082_0390122
1869 Ga0501082_0458266
1870 Ga0501082_0605213
1871 Ga0501082_0749769
1872 Ga0501082_1786186
1873 Ga0530510_0009759
1874 Ga0530510_0011210
1875 Ga0530510_0015703
1876 Ga0530510_0118231
1877 Ga0530510_0491830
1878 Ga0530510_1122535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

12

66

0.96

Map