metagRoot

F486282

General Info

Members	Datasets	Scaffolds	Average Seq Length
939	581	907	153

Family's Representative Sequence

Representative Sequence	3300011119\|Ga0105246_10382467\|Ga0105246_103824672
Length	185
Sequence	MEFAPANPGGASSRSGPAGRTFLHVAQGGYAMRTFDLAPLYRSTVGFDRLFSMLDGAGFDSSAPTYPPYNIERTGENAYRISIAVAGFADADLAIEVKENTLTVRGEKQEKAGEKPGEVLYQGIAARAFERRFQLADYVQVSGAQLANGLLHVELVREIPEAKKPRQIPIGNGKASAQVLEAKAA

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
3	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
4	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
5	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
6	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
7	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
8	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
9	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
10	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
11	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
12	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
13	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
14	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
15	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
16	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
17	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
18	2922368715
19	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
20	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
21	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
22	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
23	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
24	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
25	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
26	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
27	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
28	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
29	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
30	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
31	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
32	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
33	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
34	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
35	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
36	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
37	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
38	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
39	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
40	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
41	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
42	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
43	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
44	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
45	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
46	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
47	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
48	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
49	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
50	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
51	3300003162	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
52	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
53	3300003305	Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
54	3300003308	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
55	3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Metagenome	Rhizosphere
56	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
57	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
58	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
59	3300003568	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
60	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
61	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
62	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
63	3300003735	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
64	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
65	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
66	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
67	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
68	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
69	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
70	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
71	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
72	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
73	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
74	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
75	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
76	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
77	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
78	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
79	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
80	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
81	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
82	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
83	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
84	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
85	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
86	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
87	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
88	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
89	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
90	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
91	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
92	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
93	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
94	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
95	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
96	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
97	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
98	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
99	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
100	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
101	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
102	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
103	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
104	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
105	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
106	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
107	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
108	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
109	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
110	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
111	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
112	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
113	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
114	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
115	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
116	3300005507	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2)	Metagenome	Rhizosphere
117	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
118	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
119	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
120	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
121	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
122	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
123	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
124	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
125	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
126	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
127	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
128	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
129	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
130	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
131	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
132	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
133	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
134	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
135	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
136	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
137	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
138	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
139	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
140	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
141	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
142	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
143	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
144	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
145	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
146	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
147	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
148	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
149	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
150	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
151	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
152	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
153	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
154	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
155	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
156	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
157	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
158	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
159	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
160	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
161	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
162	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
163	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
164	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
165	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
166	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
167	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
168	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
169	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
170	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
171	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
172	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
173	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
174	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
175	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
176	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
177	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
178	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
179	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
180	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
181	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
182	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
183	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
184	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
185	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
186	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
187	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
188	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
189	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
190	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
191	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
192	3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Metagenome	Rhizosphere
193	3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Metagenome	Rhizosphere
194	3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Metagenome	Rhizosphere
195	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
196	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
197	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
198	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
199	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
200	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
201	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
202	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
203	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
204	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
205	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
206	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
207	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
208	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
209	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
210	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
211	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
212	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
213	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
214	3300019161	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
215	3300019166	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
216	3300019176	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
217	3300019177	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
218	3300019179	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
219	3300019181	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
220	3300019182	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
221	3300019183	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
222	3300019190	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
223	3300019192	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
224	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
225	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
226	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
227	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
228	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
229	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
230	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
231	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
232	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
233	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
234	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
235	3300023536	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
236	3300023547	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
237	3300023552	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
238	3300023660	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
239	3300023672	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
240	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
241	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
244	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
245	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
312	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
313	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
314	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
328	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300029285	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1	Metatranscriptome	Rhizosphere
332	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
333	3300030762	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
334	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
335	3300030877	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
336	3300030880	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
337	3300031632	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
338	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
339	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
340	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
341	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
342	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
343	3300032120	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
344	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
345	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
346	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
347	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
348	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
349	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
350	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
351	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
352	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
353	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
354	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
355	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
356	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
357	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
358	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
359	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
360	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
361	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
362	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
363	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
364	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
365	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
366	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
367	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
368	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
369	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
370	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
371	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
372	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
373	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
374	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
375	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
376	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
377	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
378	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
379	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
380	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
381	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
382	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
383	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
384	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
385	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
386	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
387	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
388	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
389	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
390	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
391	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
392	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
393	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
394	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
395	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
396	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
397	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
398	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
399	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
400	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
401	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
402	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
403	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
404	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
405	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
406	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
407	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
408	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
409	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
410	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
411	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
412	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
413	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
414	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
415	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
416	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
417	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
418	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
419	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
420	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
421	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
422	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
423	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
424	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
425	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
426	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
427	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
428	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
429	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
430	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
431	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
432	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
433	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
434	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
435	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
436	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
437	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
438	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
439	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
440	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
441	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
442	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
443	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
444	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
445	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
446	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
447	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
448	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
449	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
450	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
451	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
452	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
453	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
454	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
455	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
456	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
457	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
458	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
459	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
460	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
461	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
462	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
463	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
464	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
465	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
466	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
467	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
468	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
469	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
470	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
471	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
472	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
473	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
474	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
475	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
476	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
477	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
478	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
479	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
480	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
481	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
482	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
483	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
484	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
485	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
486	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
487	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
488	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
489	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
490	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
491	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
492	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
493	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
494	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
495	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
496	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
497	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
498	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
499	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
500	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
501	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
502	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
503	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
504	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
505	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
510	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
511	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
512	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
513	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
514	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
515	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
516	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
517	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
518	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
519	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
522	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
523	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
525	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
526	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
527	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
528	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
529	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
530	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
531	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
532	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
533	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
534	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
535	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
536	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
537	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
538	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
539	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
540	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
541	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
542	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
543	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
544	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
545	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
546	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
547	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
548	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
549	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
550	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
551	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
552	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
553	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
554	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
555	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
556	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
557	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
558	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
559	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
560	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
561	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
562	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
563	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
564	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
565	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
566	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
567	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
568	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
569	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
570	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
571	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
572	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
573	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
574	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
575	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
576	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
577	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
578	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
579	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
580	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
581	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	87.95
Metatranscriptomes	8.74
Isolates	3.3

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.79
Nodule	2.88
Rhizoplane	3.3
Rhizosphere	85.94
Stem	0
Stem Tuber	0
Unclassified	3.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214884082	2209111006	Bacteria	7738
2	ARcpr5oldR_c000550	3300000041	Bacteria	4663
3	ARSoilYngRDRAFT_c00162	3300000042	Bacteria	11484
4	ARcpr5yngRDRAFT_c000013	3300000043	Bacteria	32932
5	ARSoilOldRDRAFT_c000029	3300000044	Bacteria	31962
6	ARCol0yngRDRAFT_1000528	3300000652	Bacteria	4414
7	JGI24032J14994_101255	3300001430	Bacteria	1109
8	JGI24741J21665_1009003	3300001915	Bacteria	1854
9	JGI24752J21851_1006775	3300001976	Bacteria	1498
10	JGI24746J21847_1000267	3300001977	Bacteria	7352
11	JGI24747J21853_1001317	3300001978	Bacteria	1834
12	JGI24739J22299_10019642	3300001989	Bacteria	2417
13	JGI24737J22298_10001023	3300001990	Bacteria	9900
14	JGI24737J22298_10049278	3300001990	Bacteria	1281
15	JGI24743J22301_10040988	3300001991	Bacteria	930
16	JGI24750J21931_1000585	3300002070	Bacteria	5558
17	JGI24750J21931_1069550	3300002070	Bacteria	573
18	JGI24745J21846_1000082	3300002073	Bacteria	6844
19	JGI24748J21848_1000312	3300002074	Bacteria	5658
20	JGI24738J21930_10002656	3300002075	Bacteria	4613
21	JGI24749J21850_1000328	3300002076	Bacteria	7202
22	JGI24744J21845_10006624	3300002077	Bacteria	2400
23	JGI24035J26624_1000763	3300002126	Bacteria	3023
24	JGI24033J26618_1006887	3300002155	Bacteria	1284
25	JGI24034J26672_10001849	3300002239	Bacteria	2855
26	JGI24742J22300_10000452	3300002244	Bacteria	6065
27	Ga0006778J45830_1059919	3300003162	Bacteria	603
28	Ga0006759J45824_1028391	3300003163	Bacteria	564
29	Ga0006759J45824_1030682	3300003163	Bacteria	520
30	Ga0006770J48903_1012985	3300003305	Bacteria	551
31	Ga0006770J48903_1025145	3300003305	Bacteria	554
32	Ga0006770J48903_1053544	3300003305	Bacteria	560
33	Ga0006777J48905_1004867	3300003308	Bacteria	548
34	Ga0006777J48905_1015450	3300003308	Bacteria	574
35	JGI26128J50194_1006838	3300003347	Bacteria	742
36	JGI25160J50197_1009383	3300003354	Bacteria	3633
37	JGI26145J50221_1006481	3300003371	Bacteria	981
38	Ga0007417J51691_1022949	3300003544	Bacteria	534
39	Ga0007417J51691_1061499	3300003544	Bacteria	561
40	Ga0006781J51513_1006973	3300003568	Bacteria	564
41	Ga0007410J51695_1022396	3300003574	Bacteria	568
42	Ga0007429J51699_1021290	3300003579	Bacteria	573
43	Ga0007429J51699_1040932	3300003579	Bacteria	604
44	Ga0032354_1002506	3300003693	Bacteria	547
45	Ga0032354_1008050	3300003693	Bacteria	564
46	Ga0032354_1028872	3300003693	Bacteria	573
47	Ga0006780_1005027	3300003735	Bacteria	551
48	Ga0006780_1016131	3300003735	Bacteria	574
49	Ga0006780_1031263	3300003735	Bacteria	558
50	Ga0058859_11834964	3300004798	Bacteria	600
51	Ga0058860_12191008	3300004801	Bacteria	711
52	Ga0065717_1005603	3300005276	Bacteria	869
53	Ga0065716_1000028	3300005277	Bacteria	4667
54	Ga0065704_10799314	3300005289	Bacteria	525
55	Ga0065712_10202863	3300005290	Bacteria	1101
56	Ga0065715_10099927	3300005293	Bacteria	3355
57	Ga0065715_10349433	3300005293	Bacteria	953
58	Ga0065707_10181128	3300005295	Bacteria	1418
59	Ga0070676_10001293	3300005328	Bacteria	12588
60	Ga0070676_10139297	3300005328	Bacteria	1543
61	Ga0070676_11098427	3300005328	Bacteria	601
62	Ga0070683_100000173	3300005329	Bacteria	42675
63	Ga0070690_100010450	3300005330	Bacteria	5403
64	Ga0070690_100034289	3300005330	Bacteria	3180
65	Ga0070670_100003033	3300005331	Bacteria	13893
66	Ga0070677_10000466	3300005333	Bacteria	13872
67	Ga0068869_100000425	3300005334	Bacteria	23052
68	Ga0070666_10010906	3300005335	Bacteria	5693
69	Ga0070666_10155820	3300005335	Bacteria	1595
70	Ga0070680_100002814	3300005336	Bacteria	12921
71	Ga0070680_100210924	3300005336	Bacteria	1638
72	Ga0070682_100000375	3300005337	Bacteria	30011
73	Ga0068868_100000176	3300005338	Bacteria	42456
74	Ga0068868_101987542	3300005338	Bacteria	552
75	Ga0070660_100000590	3300005339	Bacteria	24348
76	Ga0070660_100032225	3300005339	Bacteria	3942
77	Ga0070689_100000116	3300005340	Bacteria	45723
78	Ga0070689_100127808	3300005340	Bacteria	2035
79	Ga0070689_100320887	3300005340	Bacteria	1293
80	Ga0070689_101427057	3300005340	Bacteria	626
81	Ga0070691_10000584	3300005341	Bacteria	13958
82	Ga0070691_10087609	3300005341	Bacteria	1531
83	Ga0070687_100001023	3300005343	Bacteria	9532
84	Ga0070687_100059829	3300005343	Bacteria	2007
85	Ga0070661_100000934	3300005344	Bacteria	20884
86	Ga0070692_10010539	3300005345	Bacteria	4212
87	Ga0070692_10022178	3300005345	Bacteria	3099
88	Ga0070668_100000814	3300005347	Bacteria	21494
89	Ga0070668_100113204	3300005347	Bacteria	2161
90	Ga0070669_100000723	3300005353	Bacteria	24116
91	Ga0070669_100259723	3300005353	Bacteria	1386
92	Ga0070675_100002974	3300005354	Bacteria	12797
93	Ga0070675_100189594	3300005354	Bacteria	1781
94	Ga0070675_100700210	3300005354	Bacteria	922
95	Ga0070671_100012154	3300005355	Bacteria	6929
96	Ga0070671_101214613	3300005355	Bacteria	664
97	Ga0070674_100081002	3300005356	Bacteria	2319
98	Ga0070674_100688665	3300005356	Bacteria	873
99	Ga0070673_100013022	3300005364	Bacteria	5736
100	Ga0070673_100190289	3300005364	Bacteria	1762
101	Ga0070688_100004867	3300005365	Bacteria	7025
102	Ga0070688_100189185	3300005365	Bacteria	1433
103	Ga0070688_100240134	3300005365	Bacteria	1285
104	Ga0070659_100023122	3300005366	Bacteria	4752
105	Ga0070659_100255990	3300005366	Bacteria	1451
106	Ga0070667_100000973	3300005367	Bacteria	26335
107	Ga0070667_100801250	3300005367	Bacteria	875
108	Ga0070667_100848811	3300005367	Bacteria	849
109	Ga0070703_10079299	3300005406	Bacteria	1115
110	Ga0070709_10010265	3300005434	Bacteria	5177
111	Ga0070714_100094196	3300005435	Bacteria	2629
112	Ga0070714_100332711	3300005435	Bacteria	1423
113	Ga0070714_101424836	3300005435	Bacteria	676
114	Ga0070714_102056891	3300005435	Bacteria	557
115	Ga0070713_100316685	3300005436	Bacteria	1440
116	Ga0070713_101780263	3300005436	Bacteria	598
117	Ga0070710_10010597	3300005437	Bacteria	4531
118	Ga0070710_10042679	3300005437	Bacteria	2509
119	Ga0070701_10002456	3300005438	Bacteria	7152
120	Ga0070701_10205446	3300005438	Bacteria	1167
121	Ga0070711_100170882	3300005439	Bacteria	1657
122	Ga0070705_100005712	3300005440	Bacteria	6075
123	Ga0070705_100083713	3300005440	Bacteria	1966
124	Ga0070700_100011354	3300005441	Bacteria	4932
125	Ga0070700_100026320	3300005441	Bacteria	3434
126	Ga0070694_100012237	3300005444	Bacteria	5330
127	Ga0070694_100024089	3300005444	Bacteria	3926
128	Ga0070708_100206184	3300005445	Bacteria	1842
129	Ga0070663_101196479	3300005455	Bacteria	668
130	Ga0070678_100009102	3300005456	Bacteria	5991
131	Ga0070678_100673723	3300005456	Bacteria	930
132	Ga0070662_100001872	3300005457	Bacteria	12889
133	Ga0070662_100346923	3300005457	Bacteria	1215
134	Ga0070681_10001649	3300005458	Bacteria	19921
135	Ga0070681_10099631	3300005458	Bacteria	2851
136	Ga0070681_10516487	3300005458	Bacteria	1108
137	Ga0068867_100023270	3300005459	Bacteria	4435
138	Ga0068867_101254408	3300005459	Bacteria	683
139	Ga0070685_10003195	3300005466	Bacteria	8339
140	Ga0070685_10156784	3300005466	Bacteria	1447
141	Ga0070707_100600845	3300005468	Bacteria	1063
142	Ga0070698_100936011	3300005471	Bacteria	813
143	Ga0070698_101066522	3300005471	Bacteria	756
144	Ga0074259_10954145	3300005507	Bacteria	1111
145	Ga0070699_100298695	3300005518	Bacteria	1445
146	Ga0070679_100019945	3300005530	Bacteria	6530
147	Ga0070679_100925213	3300005530	Bacteria	815
148	Ga0070684_100000146	3300005535	Bacteria	47523
149	Ga0070684_100024765	3300005535	Bacteria	5037
150	Ga0070697_100039969	3300005536	Bacteria	3794
151	Ga0068853_100009850	3300005539	Bacteria	7712
152	Ga0068853_100977314	3300005539	Bacteria	815
153	Ga0070672_100000063	3300005543	Bacteria	49365
154	Ga0070672_100193102	3300005543	Bacteria	1701
155	Ga0070672_101293790	3300005543	Bacteria	651
156	Ga0070686_100000498	3300005544	Bacteria	23629
157	Ga0070686_100016322	3300005544	Bacteria	4318
158	Ga0070686_100024534	3300005544	Bacteria	3615
159	Ga0070686_100276922	3300005544	Bacteria	1236
160	Ga0070695_100000044	3300005545	Bacteria	47690
161	Ga0070695_100029947	3300005545	Bacteria	3385
162	Ga0070696_100007162	3300005546	Bacteria	7447
163	Ga0070696_100392499	3300005546	Bacteria	1084
164	Ga0070693_100001749	3300005547	Bacteria	9893
165	Ga0070693_100543486	3300005547	Bacteria	830
166	Ga0070665_100073862	3300005548	Bacteria	3416
167	Ga0070665_100109425	3300005548	Bacteria	2765
168	Ga0070665_100514567	3300005548	Bacteria	1208
169	Ga0070665_100555294	3300005548	Bacteria	1161
170	Ga0070665_100956846	3300005548	Bacteria	869
171	Ga0070665_101616619	3300005548	Bacteria	656
172	Ga0070704_100000125	3300005549	Bacteria	27958
173	Ga0070704_100009894	3300005549	Bacteria	5785
174	Ga0070704_101023807	3300005549	Bacteria	748
175	Ga0068855_100003481	3300005563	Bacteria	19272
176	Ga0070664_100023525	3300005564	Bacteria	5090
177	Ga0070664_100279069	3300005564	Bacteria	1506
178	Ga0070664_100486943	3300005564	Bacteria	1135
179	Ga0068857_100002070	3300005577	Bacteria	16294
180	Ga0068857_100134787	3300005577	Bacteria	2230
181	Ga0068854_100006766	3300005578	Bacteria	7304
182	Ga0068856_100001419	3300005614	Bacteria	25131
183	Ga0070702_100000992	3300005615	Bacteria	11209
184	Ga0068852_100025419	3300005616	Bacteria	4798
185	Ga0068852_100291883	3300005616	Bacteria	1576
186	Ga0068852_101209725	3300005616	Bacteria	777
187	Ga0068859_100001728	3300005617	Bacteria	22271
188	Ga0068859_100049711	3300005617	Bacteria	4211
189	Ga0068859_100405244	3300005617	Bacteria	1460
190	Ga0068864_100779173	3300005618	Bacteria	939
191	Ga0068866_10004751	3300005718	Bacteria	5573
192	Ga0068866_10023447	3300005718	Bacteria	2872
193	Ga0068866_10866606	3300005718	Bacteria	633
194	Ga0068861_100006229	3300005719	Bacteria	8116
195	Ga0068861_100045771	3300005719	Bacteria	3296
196	Ga0068870_10005931	3300005840	Bacteria	5366
197	Ga0068863_100000334	3300005841	Bacteria	47864
198	Ga0068863_100750270	3300005841	Bacteria	972
199	Ga0068858_100059409	3300005842	Bacteria	3534
200	Ga0068858_100063599	3300005842	Bacteria	3414
201	Ga0068858_100620760	3300005842	Bacteria	1049
202	Ga0068858_101038762	3300005842	Bacteria	803
203	Ga0068860_100005103	3300005843	Bacteria	13358
204	Ga0068860_100276228	3300005843	Bacteria	1641
205	Ga0068862_100013798	3300005844	Bacteria	6697
206	Ga0068862_100168839	3300005844	Bacteria	1957
207	Ga0068862_100326576	3300005844	Bacteria	1417
208	Ga0068862_100975963	3300005844	Bacteria	837
209	Ga0081455_10000101	3300005937	Bacteria	94120
210	Ga0081455_10011688	3300005937	Bacteria	8803
211	Ga0081538_10032979	3300005981	Bacteria	3457
212	Ga0081540_1033335	3300005983	Bacteria	2798
213	Ga0070717_10286168	3300006028	Bacteria	1463
214	Ga0070717_10938564	3300006028	Bacteria	788
215	Ga0075368_10092183	3300006042	Bacteria	1239
216	Ga0075368_10139272	3300006042	Bacteria	1011
217	Ga0075363_100052299	3300006048	Bacteria	2180
218	Ga0075364_10052100	3300006051	Bacteria	2673
219	Ga0075432_10001203	3300006058	Bacteria	8325
220	Ga0070715_10000561	3300006163	Bacteria	9783
221	Ga0070715_10025862	3300006163	Bacteria	2329
222	Ga0070716_100096046	3300006173	Bacteria	1805
223	Ga0070716_100311171	3300006173	Bacteria	1100
224	Ga0070712_100004486	3300006175	Bacteria	8618
225	Ga0070712_100637543	3300006175	Bacteria	904
226	Ga0070712_100975458	3300006175	Bacteria	733
227	Ga0075367_10007473	3300006178	Bacteria	5597
228	Ga0075367_10178514	3300006178	Bacteria	1324
229	Ga0075369_10066655	3300006186	Bacteria	1579
230	Ga0075427_10005139	3300006194	Bacteria	1858
231	Ga0075366_10054349	3300006195	Bacteria	2378
232	Ga0097621_100000019	3300006237	Bacteria	88022
233	Ga0097621_100089774	3300006237	Bacteria	2570
234	Ga0075370_10124199	3300006353	Bacteria	1504
235	Ga0068871_100002255	3300006358	Bacteria	13109
236	Ga0068871_100116334	3300006358	Bacteria	2254
237	Ga0075428_100023204	3300006844	Bacteria	6862
238	Ga0075428_100038288	3300006844	Bacteria	5277
239	Ga0075428_101092756	3300006844	Bacteria	842
240	Ga0075430_100000427	3300006846	Bacteria	31285
241	Ga0075430_100034373	3300006846	Bacteria	4302
242	Ga0075430_100103386	3300006846	Bacteria	2378
243	Ga0075430_100655460	3300006846	Bacteria	866
244	Ga0075431_100029253	3300006847	Bacteria	5669
245	Ga0075431_100060310	3300006847	Bacteria	3914
246	Ga0075431_100956158	3300006847	Bacteria	825
247	Ga0075433_10031568	3300006852	Bacteria	4529
248	Ga0075433_10781635	3300006852	Bacteria	834
249	Ga0075434_100003647	3300006871	Bacteria	13747
250	Ga0075434_100004469	3300006871	Bacteria	12614
251	Ga0075434_100005647	3300006871	Bacteria	11413
252	Ga0075434_100013101	3300006871	Bacteria	7874
253	Ga0075434_100697826	3300006871	Bacteria	1032
254	Ga0075429_100001540	3300006880	Bacteria	18885
255	Ga0075429_100223689	3300006880	Bacteria	1648
256	Ga0075429_100424383	3300006880	Bacteria	1165
257	Ga0068865_100001204	3300006881	Bacteria	15063
258	Ga0068865_100369621	3300006881	Bacteria	1167
259	Ga0075436_100014032	3300006914	Bacteria	5483
260	Ga0075436_100022941	3300006914	Bacteria	4288
261	Ga0075436_100349738	3300006914	Bacteria	1065
262	Ga0097620_100001728	3300006931	Bacteria	22271
263	Ga0097620_100049713	3300006931	Bacteria	4211
264	Ga0097620_100405245	3300006931	Bacteria	1460
265	Ga0099824_1017855	3300006942	Bacteria	6007
266	Ga0075435_100239292	3300007076	Bacteria	1543
267	Ga0075435_100252416	3300007076	Bacteria	1502
268	Ga0075435_100301647	3300007076	Bacteria	1370
269	Ga0075435_100418657	3300007076	Bacteria	1154
270	Ga0099794_10014846	3300007265	Bacteria	3423
271	Ga0099795_10144877	3300007788	Bacteria	969
272	Ga0105244_10020183	3300009036	Bacteria	3704
273	Ga0105244_10101301	3300009036	Bacteria	1408
274	Ga0105240_10157152	3300009093	Bacteria	2703
275	Ga0105240_10723991	3300009093	Bacteria	1084
276	Ga0105240_11332673	3300009093	Bacteria	756
277	Ga0111539_10003096	3300009094	Bacteria	22052
278	Ga0111539_10029632	3300009094	Bacteria	6662
279	Ga0105245_10003197	3300009098	Bacteria	14656
280	Ga0105245_10012576	3300009098	Bacteria	7367
281	Ga0105245_10018285	3300009098	Bacteria	6128
282	Ga0105247_10010378	3300009101	Bacteria	5634
283	Ga0105247_10082797	3300009101	Bacteria	2025
284	Ga0114129_10148356	3300009147	Bacteria	3211
285	Ga0105243_10000376	3300009148	Bacteria	47951
286	Ga0105243_10120093	3300009148	Bacteria	2214
287	Ga0105241_10536338	3300009174	Bacteria	1048
288	Ga0105241_11192594	3300009174	Bacteria	721
289	Ga0105242_10013774	3300009176	Bacteria	6258
290	Ga0105248_10024674	3300009177	Bacteria	6686
291	Ga0105248_10075360	3300009177	Bacteria	3792
292	Ga0105248_10298509	3300009177	Bacteria	1814
293	Ga0105248_13463501	3300009177	Bacteria	501
294	Ga0105237_10022580	3300009545	Bacteria	6454
295	Ga0105237_10274457	3300009545	Bacteria	1689
296	Ga0105238_10024948	3300009551	Bacteria	6094
297	Ga0105238_10653394	3300009551	Bacteria	1062
298	Ga0105249_10000752	3300009553	Bacteria	29130
299	Ga0105249_10018458	3300009553	Bacteria	6207
300	Ga0105249_10917320	3300009553	Bacteria	943
301	Ga0099796_10106464	3300010159	Bacteria	1062
302	Ga0105239_10004996	3300010375	Bacteria	15663
303	Ga0105239_10093495	3300010375	Bacteria	3320
304	Ga0105246_10006514	3300011119	Bacteria	7127
305	Ga0105246_10382467	3300011119	Bacteria	1163
306	Ga0105246_10602509	3300011119	Bacteria	949
307	Ga0105246_10617625	3300011119	Bacteria	939
308	Ga0157328_1007357	3300012478	Bacteria	694
309	Ga0157337_1010050	3300012483	Bacteria	725
310	Ga0157343_1000627	3300012488	Bacteria	1472
311	Ga0157323_1000631	3300012495	Bacteria	1572
312	Ga0157345_1006169	3300012498	Bacteria	947
313	Ga0157338_1000288	3300012515	Bacteria	2724
314	Ga0157373_10105312	3300013100	Bacteria	1984
315	Ga0157371_10010064	3300013102	Bacteria	7393
316	Ga0157371_10374010	3300013102	Bacteria	1040
317	Ga0157370_10949784	3300013104	Bacteria	779
318	Ga0157369_10621177	3300013105	Bacteria	1115
319	Ga0157374_10013009	3300013296	Bacteria	7255
320	Ga0157374_10489957	3300013296	Bacteria	1233
321	Ga0157378_10039951	3300013297	Bacteria	4161
322	Ga0157378_10261517	3300013297	Bacteria	1661
323	Ga0157378_10420888	3300013297	Bacteria	1320
324	Ga0157378_13063859	3300013297	Bacteria	519
325	Ga0163162_10015688	3300013306	Bacteria	7402
326	Ga0157372_10210195	3300013307	Bacteria	2255
327	Ga0157375_10000293	3300013308	Bacteria	45355
328	Ga0157375_11001303	3300013308	Bacteria	975
329	Ga0157375_11007681	3300013308	Bacteria	972
330	Ga0163163_10031177	3300014325	Bacteria	5144
331	Ga0163163_11554591	3300014325	Bacteria	723
332	Ga0157380_10000307	3300014326	Bacteria	29534
333	Ga0157380_10051102	3300014326	Bacteria	3267
334	Ga0157380_10256396	3300014326	Bacteria	1586
335	Ga0157377_10005217	3300014745	Bacteria	6084
336	Ga0157379_10001189	3300014968	Bacteria	21190
337	Ga0157376_10003167	3300014969	Bacteria	11303
338	Ga0157376_10777361	3300014969	Bacteria	969
339	Ga0182007_10131527	3300015262	Bacteria	842
340	Ga0163161_10004010	3300017792	Bacteria	10302
341	Ga0184602_102328	3300019161	Bacteria	569
342	Ga0184602_130594	3300019161	Bacteria	539
343	Ga0184595_120395	3300019166	Bacteria	700
344	Ga0184596_111329	3300019176	Bacteria	559
345	Ga0184592_114053	3300019177	Bacteria	538
346	Ga0184593_108137	3300019179	Bacteria	567
347	Ga0184593_122013	3300019179	Bacteria	556
348	Ga0184594_104424	3300019181	Bacteria	550
349	Ga0184598_141614	3300019182	Bacteria	570
350	Ga0184601_110026	3300019183	Bacteria	559
351	Ga0184600_133141	3300019190	Bacteria	581
352	Ga0184603_100565	3300019192	Bacteria	564
353	Ga0197907_11073341	3300020069	Bacteria	567
354	Ga0206356_10666507	3300020070	Bacteria	509
355	Ga0206356_11161563	3300020070	Bacteria	546
356	Ga0206349_1382233	3300020075	Bacteria	590
357	Ga0206355_1491439	3300020076	Bacteria	539
358	Ga0206351_10033281	3300020077	Bacteria	585
359	Ga0206351_10494624	3300020077	Bacteria	551
360	Ga0206352_10624303	3300020078	Bacteria	555
361	Ga0206350_10379565	3300020080	Bacteria	542
362	Ga0206354_10233150	3300020081	Bacteria	533
363	Ga0206354_11517375	3300020081	Bacteria	689
364	Ga0206353_10520278	3300020082	Bacteria	571
365	Ga0206353_12015128	3300020082	Bacteria	628
366	Ga0154015_1532670	3300020610	Bacteria	547
367	Ga0224712_10460855	3300022467	Bacteria	611
368	Ga0224712_10509906	3300022467	Bacteria	582
369	Ga0247552_103330	3300023536	Bacteria	551
370	Ga0247554_104601	3300023547	Bacteria	569
371	Ga0247551_102715	3300023552	Bacteria	657
372	Ga0247551_103015	3300023552	Bacteria	635
373	Ga0247550_103729	3300023660	Bacteria	563
374	Ga0247550_103785	3300023660	Bacteria	561
375	Ga0247553_108886	3300023672	Bacteria	564
376	Ga0247553_109927	3300023672	Bacteria	544
377	Ga0209148_1000316	3300025254	Bacteria	68104
378	Ga0207666_1000288	3300025271	Bacteria	7186
379	Ga0207666_1009266	3300025271	Bacteria	1328
380	Ga0209455_1007806	3300025272	Bacteria	2978
381	Ga0209455_1021308	3300025272	Bacteria	1260
382	Ga0207673_1000437	3300025290	Bacteria	4311
383	Ga0209758_1001012	3300025297	Bacteria	37211
384	Ga0207697_10002308	3300025315	Bacteria	9940
385	Ga0207697_10010802	3300025315	Bacteria	3886
386	Ga0207653_10028594	3300025885	Bacteria	1794
387	Ga0207682_10000876	3300025893	Bacteria	13973
388	Ga0207692_10048471	3300025898	Bacteria	2138
389	Ga0207692_10822519	3300025898	Bacteria	608
390	Ga0207642_10000445	3300025899	Bacteria	12539
391	Ga0207710_10003413	3300025900	Bacteria	7101
392	Ga0207688_10010307	3300025901	Bacteria	5088
393	Ga0207680_10006408	3300025903	Bacteria	5689
394	Ga0207680_10128880	3300025903	Bacteria	1665
395	Ga0207647_10010736	3300025904	Bacteria	6450
396	Ga0207647_10017195	3300025904	Bacteria	4920
397	Ga0207647_10485829	3300025904	Bacteria	689
398	Ga0207685_10004589	3300025905	Bacteria	3537
399	Ga0207685_10386822	3300025905	Bacteria	714
400	Ga0207699_10041611	3300025906	Bacteria	2655
401	Ga0207699_10064480	3300025906	Bacteria	2216
402	Ga0207699_10076711	3300025906	Bacteria	2059
403	Ga0207699_10524588	3300025906	Bacteria	857
404	Ga0207645_10000291	3300025907	Bacteria	42040
405	Ga0207645_10289745	3300025907	Bacteria	1088
406	Ga0207645_10654056	3300025907	Bacteria	714
407	Ga0207643_10000373	3300025908	Bacteria	30112
408	Ga0207705_11393238	3300025909	Bacteria	533
409	Ga0207654_10003302	3300025911	Bacteria	8155
410	Ga0207654_10331278	3300025911	Bacteria	1043
411	Ga0207707_10004766	3300025912	Bacteria	11893
412	Ga0207707_10005748	3300025912	Bacteria	10847
413	Ga0207695_10225842	3300025913	Bacteria	1779
414	Ga0207671_10016742	3300025914	Bacteria	5686
415	Ga0207671_10942619	3300025914	Bacteria	682
416	Ga0207693_10005265	3300025915	Bacteria	10819
417	Ga0207693_10193070	3300025915	Bacteria	1602
418	Ga0207663_10237415	3300025916	Bacteria	1335
419	Ga0207663_10277750	3300025916	Bacteria	1243
420	Ga0207660_10006704	3300025917	Bacteria	7458
421	Ga0207660_10080308	3300025917	Bacteria	2394
422	Ga0207662_10000803	3300025918	Bacteria	14466
423	Ga0207662_10005017	3300025918	Bacteria	7009
424	Ga0207662_10024699	3300025918	Bacteria	3459
425	Ga0207657_10001716	3300025919	Bacteria	23620
426	Ga0207657_10117849	3300025919	Bacteria	2187
427	Ga0207657_10499430	3300025919	Bacteria	953
428	Ga0207649_10000204	3300025920	Bacteria	49651
429	Ga0207652_10007413	3300025921	Bacteria	8847
430	Ga0207652_10766636	3300025921	Bacteria	858
431	Ga0207681_10000066	3300025923	Bacteria	98794
432	Ga0207681_10259654	3300025923	Bacteria	1359
433	Ga0207694_10038045	3300025924	Bacteria	3699
434	Ga0207694_10461017	3300025924	Bacteria	1062
435	Ga0207650_10443165	3300025925	Bacteria	1080
436	Ga0207659_10000273	3300025926	Bacteria	31488
437	Ga0207659_10074185	3300025926	Bacteria	2493
438	Ga0207659_11064037	3300025926	Bacteria	696
439	Ga0207687_10000052	3300025927	Bacteria	90736
440	Ga0207687_10004880	3300025927	Bacteria	8912
441	Ga0207687_11192636	3300025927	Bacteria	654
442	Ga0207700_10312070	3300025928	Bacteria	1360
443	Ga0207700_10564065	3300025928	Bacteria	1011
444	Ga0207664_10233726	3300025929	Bacteria	1599
445	Ga0207664_10235685	3300025929	Bacteria	1592
446	Ga0207664_10876410	3300025929	Bacteria	806
447	Ga0207644_10003722	3300025931	Bacteria	9882
448	Ga0207690_10000187	3300025932	Bacteria	47796
449	Ga0207690_10365136	3300025932	Bacteria	1144
450	Ga0207690_10946460	3300025932	Bacteria	715
451	Ga0207706_10027464	3300025933	Bacteria	5088
452	Ga0207706_10216748	3300025933	Bacteria	1677
453	Ga0207706_10396085	3300025933	Bacteria	1197
454	Ga0207706_10563631	3300025933	Bacteria	980
455	Ga0207686_10008244	3300025934	Bacteria	5622
456	Ga0207686_10734954	3300025934	Bacteria	787
457	Ga0207709_10004618	3300025935	Bacteria	7920
458	Ga0207709_10057734	3300025935	Bacteria	2408
459	Ga0207709_10228101	3300025935	Bacteria	1348
460	Ga0207670_10000140	3300025936	Bacteria	47642
461	Ga0207670_10270270	3300025936	Bacteria	1321
462	Ga0207669_10004921	3300025937	Bacteria	5939
463	Ga0207669_10076746	3300025937	Bacteria	2122
464	Ga0207704_10000108	3300025938	Bacteria	45380
465	Ga0207704_10023964	3300025938	Bacteria	3300
466	Ga0207665_10141256	3300025939	Bacteria	1717
467	Ga0207665_11235118	3300025939	Bacteria	596
468	Ga0207691_10012798	3300025940	Bacteria	8031
469	Ga0207691_11087813	3300025940	Bacteria	665
470	Ga0207711_10031782	3300025941	Bacteria	4459
471	Ga0207711_10173475	3300025941	Bacteria	1958
472	Ga0207711_10606204	3300025941	Bacteria	1022
473	Ga0207689_10000233	3300025942	Bacteria	49558
474	Ga0207661_10000230	3300025944	Bacteria	36712
475	Ga0207679_10000052	3300025945	Bacteria	110612
476	Ga0207679_10265905	3300025945	Bacteria	1465
477	Ga0207667_10596700	3300025949	Bacteria	1114
478	Ga0207651_10000482	3300025960	Bacteria	16769
479	Ga0207651_10093549	3300025960	Bacteria	2208
480	Ga0207712_10000265	3300025961	Bacteria	50879
481	Ga0207712_10022187	3300025961	Bacteria	4177
482	Ga0207712_10113748	3300025961	Bacteria	2034
483	Ga0207668_10000151	3300025972	Bacteria	47939
484	Ga0207668_10302967	3300025972	Bacteria	1319
485	Ga0207640_10001417	3300025981	Bacteria	12974
486	Ga0207640_10444327	3300025981	Bacteria	1067
487	Ga0207658_10000807	3300025986	Bacteria	26349
488	Ga0207658_10761639	3300025986	Bacteria	877
489	Ga0207677_10005185	3300026023	Bacteria	7051
490	Ga0207703_10010332	3300026035	Bacteria	7307
491	Ga0207703_10038469	3300026035	Bacteria	3817
492	Ga0207703_10964192	3300026035	Bacteria	818
493	Ga0207639_10008165	3300026041	Bacteria	7160
494	Ga0207639_10010933	3300026041	Bacteria	6294
495	Ga0207678_10005081	3300026067	Bacteria	11795
496	Ga0207678_10310939	3300026067	Bacteria	1355
497	Ga0207708_10018213	3300026075	Bacteria	5287
498	Ga0207708_10593789	3300026075	Bacteria	937
499	Ga0207708_10715581	3300026075	Bacteria	857
500	Ga0207702_10003970	3300026078	Bacteria	13283
501	Ga0207641_10000468	3300026088	Bacteria	45600
502	Ga0207648_10057846	3300026089	Bacteria	3382
503	Ga0207648_10341094	3300026089	Bacteria	1349
504	Ga0207676_11001141	3300026095	Bacteria	823
505	Ga0207674_10019995	3300026116	Bacteria	7245
506	Ga0207674_10059559	3300026116	Bacteria	3864
507	Ga0207674_10271002	3300026116	Bacteria	1645
508	Ga0207675_100064021	3300026118	Bacteria	3436
509	Ga0207683_10000048	3300026121	Bacteria	88501
510	Ga0207698_10002688	3300026142	Bacteria	10577
511	Ga0209973_1013584	3300027252	Bacteria	1005
512	Ga0209389_1000027	3300027296	Bacteria	146917
513	Ga0209589_1000031	3300027357	Bacteria	147054
514	Ga0209489_100057	3300027361	Bacteria	147398
515	Ga0209996_1022112	3300027395	Bacteria	899
516	Ga0209179_1158919	3300027512	Bacteria	505
517	Ga0209968_1047241	3300027526	Bacteria	743
518	Ga0209968_1056923	3300027526	Bacteria	685
519	Ga0209982_1014615	3300027552	Bacteria	1187
520	Ga0209970_1025559	3300027614	Bacteria	1012
521	Ga0210002_1000997	3300027617	Bacteria	3918
522	Ga0210002_1013919	3300027617	Bacteria	1259
523	Ga0209983_1031424	3300027665	Bacteria	1133
524	Ga0209588_1116411	3300027671	Bacteria	857
525	Ga0209971_1009281	3300027682	Bacteria	2331
526	Ga0209966_1002373	3300027695	Bacteria	3135
527	Ga0209998_10002648	3300027717	Bacteria	4053
528	Ga0209813_10092237	3300027866	Bacteria	1018
529	Ga0209813_10197907	3300027866	Bacteria	743
530	Ga0209974_10005215	3300027876	Bacteria	4586
531	Ga0207428_10000247	3300027907	Bacteria	73484
532	Ga0207428_10000287	3300027907	Bacteria	68018
533	Ga0207428_10000784	3300027907	Bacteria	35988
534	Ga0207428_10042142	3300027907	Bacteria	3692
535	Ga0207428_10118980	3300027907	Bacteria	2027
536	Ga0268266_10013890	3300028379	Bacteria	6934
537	Ga0268266_10285948	3300028379	Bacteria	1534
538	Ga0268266_10312653	3300028379	Bacteria	1468
539	Ga0268266_10568432	3300028379	Bacteria	1087
540	Ga0268265_10008060	3300028380	Bacteria	7116
541	Ga0268265_10336080	3300028380	Bacteria	1373
542	Ga0268265_10906392	3300028380	Bacteria	866
543	Ga0268265_11057283	3300028380	Bacteria	804
544	Ga0268264_10005848	3300028381	Bacteria	10421
545	Ga0268264_10297648	3300028381	Bacteria	1518
546	Ga0268264_10528798	3300028381	Bacteria	1154
547	Ga0268264_11680830	3300028381	Bacteria	645
548	Ga0310981_1039850	3300029285	Bacteria	618
549	Ga0265762_1131948	3300030760	Bacteria	580
550	Ga0265775_111388	3300030762	Bacteria	568
551	Ga0265763_1038264	3300030763	Bacteria	570
552	Ga0265777_116428	3300030877	Bacteria	585
553	Ga0265776_100753	3300030880	Bacteria	1233
554	Ga0310102_107499	3300031632	Bacteria	581
555	Ga0265342_10028732	3300031712	Bacteria	3460
556	Ga0307516_10052151	3300031730	Bacteria	4006
557	Ga0307516_10327985	3300031730	Bacteria	1200
558	Ga0307406_12080105	3300031901	Bacteria	508
559	Ga0307416_101866918	3300032002	Bacteria	704
560	Ga0307414_10681264	3300032004	Bacteria	929
561	Ga0316053_110945	3300032120	Bacteria	636
562	Ga0316053_118763	3300032120	Bacteria	532
563	Ga0316593_10392570	3300032168	Bacteria	535
564	Ga0316596_1159898	3300033541	Bacteria	620
565	Ga0373930_0000140	3300034816	Bacteria	8116
566	Ga0373948_0001192	3300034817	Bacteria	3536
567	Ga0373948_0001283	3300034817	Bacteria	3437
568	Ga0373958_0000497	3300034819	Bacteria	4852
569	Ga0373958_0007079	3300034819	Bacteria	1773
570	Ga0373938_0000282	3300034957	Bacteria	8135
571	Ga0373938_0007960	3300034957	Bacteria	1882
572	Ga0373928_0012923	3300035084	Bacteria	1671
573	Ga0373928_0128860	3300035084	Bacteria	684
574	Ga0373929_0001241	3300035085	Bacteria	4938
575	Ga0373929_0074090	3300035085	Bacteria	819
576	Ga0373934_0222026	3300035086	Bacteria	779
577	Ga0373940_0000844	3300035088	Bacteria	5122
578	Ga0373944_0067206	3300035089	Bacteria	1161
579	Ga0373949_0001347	3300035090	Bacteria	7072
580	Ga0373951_0002181	3300035091	Bacteria	4984
581	Ga0373951_0003150	3300035091	Bacteria	4059
582	Ga0373951_0111806	3300035091	Bacteria	736
583	Ga0373952_0000008	3300035092	Bacteria	33020
584	Ga0373923_0000040	3300035111	Bacteria	19635
585	Ga0373932_0000925	3300035112	Bacteria	8576
586	Ga0373932_0002073	3300035112	Bacteria	5226
587	Ga0373936_0001013	3300035113	Bacteria	10045
588	Ga0373939_0002358	3300035114	Bacteria	4466
589	Ga0373941_0009266	3300035115	Bacteria	2473
590	Ga0373941_0015316	3300035115	Bacteria	2064
591	Ga0373941_0053931	3300035115	Bacteria	1287
592	Ga0373941_0233942	3300035115	Bacteria	711
593	Ga0373945_0013564	3300035116	Bacteria	2721
594	Ga0373945_0018945	3300035116	Bacteria	2346
595	Ga0373953_0013384	3300035117	Bacteria	2929
596	Ga0373953_0049001	3300035117	Bacteria	1703
597	Ga0373954_0089971	3300035118	Bacteria	1473
598	Ga0373954_0160461	3300035118	Bacteria	1100
599	Ga0373956_0380344	3300035119	Bacteria	673
600	Ga0373957_0006265	3300035120	Bacteria	3740
601	Ga0373957_0023932	3300035120	Bacteria	2189
602	Ga0373960_0000401	3300035121	Bacteria	8455
603	Ga0373943_0001030	3300035170	Bacteria	12370
604	Ga0373943_0290814	3300035170	Bacteria	926
605	Ga0373946_0007377	3300035171	Bacteria	4016
606	Ga0373946_0338565	3300035171	Unclassified	750
607	Ga0373955_0002459	3300035172	Bacteria	8092
608	Ga0373955_0034069	3300035172	Bacteria	2686
609	Ga0373942_0001070	3300035207	Bacteria	7348
610	Ga0373961_0003204	3300035241	Bacteria	4083
611	Ga0373961_0199286	3300035241	Bacteria	705
612	Ga0373962_0087129	3300035242	Bacteria	956
613	Ga0373924_0001493	3300035410	Bacteria	7616
614	Ga0373931_0000174	3300035691	Bacteria	28172
615	Ga0373931_0187968	3300035691	Bacteria	1227
616	Ga0373931_0304793	3300035691	Bacteria	985
617	Ga0373931_0331062	3300035691	Bacteria	948
618	Ga0373935_0000027	3300035692	Bacteria	58804
619	Ga0373927_0007994	3300035695	Bacteria	7144
620	Ga0373927_0011189	3300035695	Bacteria	5975
621	Ga0373927_0014418	3300035695	Bacteria	5233
622	Ga0373927_0236285	3300035695	Bacteria	1201
623	Ga0373927_0536766	3300035695	Bacteria	773
624	Ga0373933_0001137	3300035724	Bacteria	15800
625	Ga0373933_0419413	3300035724	Bacteria	874
626	Ga0373947_0060479	3300035725	Unclassified	2300
627	Ga0373937_0004818	3300036401	Bacteria	11468
628	Ga0265778_031004	3300036457	Bacteria	691
629	Ga0373925_0000036	3300037068	Bacteria	143388
630	Ga0373925_0128182	3300037068	Bacteria	1976
631	Ga0373925_0137597	3300037068	Unclassified	1909
632	Ga0395899_0119869	3300037312	Bacteria	1886
633	Ga0395900_1080954	3300037418	Bacteria	720
634	Ga0395905_0030267	3300037471	Bacteria	5102
635	Ga0436364_0010740	3300037853	Bacteria	1242
636	Ga0436365_1240839	3300039437	Bacteria	1214
637	Ga0436365_1760388	3300039437	Bacteria	2068
638	Ga0436360_0150359	3300039438	Bacteria	758
639	Ga0436362_1120259	3300039453	Bacteria	846
640	Ga0439453_0000015	3300041408	Bacteria	10794
641	Ga0451791_0828778	3300041451	Bacteria	1186
642	Ga0451800_0993481	3300041459	Bacteria	645
643	Ga0451802_1792545	3300041460	Bacteria	1803
644	Ga0451833_0416176	3300041491	Bacteria	644
645	Ga0451839_0025233	3300041496	Bacteria	1051
646	Ga0451853_1376500	3300041512	Bacteria	1511
647	Ga0439448_0031086	3300042005	Bacteria	1696
648	Ga0439455_0030214	3300042012	Bacteria	1343
649	Ga0439458_0055768	3300042157	Bacteria	981
650	Ga0439464_0146730	3300042439	Bacteria	737
651	Ga0439460_0010313	3300042461	Bacteria	2388
652	Ga0451577_0098393	3300042876	Bacteria	2613
653	Ga0439440_0036579	3300042993	Bacteria	1182
654	Ga0466972_0315481	3300044658	Bacteria	730
655	Ga0466966_0104435	3300044684	Bacteria	1750
656	Ga0466957_0012605	3300044842	Bacteria	4894
657	Ga0466957_0406270	3300044842	Bacteria	932
658	Ga0466959_0140729	3300045049	Bacteria	1705
659	Ga0451576_0089285	3300045051	Bacteria	3205
660	Ga0466967_0271856	3300045976	Bacteria	1624
661	Ga0495617_013842	3300046452	Bacteria	2743
662	Ga0495592_0000018	3300046454	Bacteria	140962
663	Ga0495592_0446433	3300046454	Bacteria	811
664	Ga0495603_0008860	3300046455	Bacteria	6082
665	Ga0495638_0139891	3300046460	Bacteria	1414
666	Ga0495651_0000568	3300046462	Bacteria	28603
667	Ga0495653_0000069	3300046463	Bacteria	89715
668	Ga0495580_0195200	3300046472	Bacteria	1396
669	Ga0495580_0543154	3300046472	Bacteria	772
670	Ga0495582_0088984	3300046473	Unclassified	1720
671	Ga0495582_0386110	3300046473	Bacteria	807
672	Ga0495639_0279466	3300046475	Bacteria	829
673	Ga0495639_0718863	3300046475	Bacteria	516
674	Ga0495662_0007827	3300046476	Bacteria	5260
675	Ga0495664_0000010	3300046477	Bacteria	268381
676	Ga0495584_0076280	3300046491	Bacteria	1686
677	Ga0495584_0092559	3300046491	Bacteria	1525
678	Ga0495584_0125057	3300046491	Bacteria	1303
679	Ga0495584_0187926	3300046491	Bacteria	1050
680	Ga0495585_0037511	3300046492	Bacteria	2729
681	Ga0495585_0165719	3300046492	Bacteria	1144
682	Ga0495585_0206735	3300046492	Bacteria	997
683	Ga0495585_0209726	3300046492	Bacteria	988
684	Ga0495594_0015448	3300046499	Bacteria	4011
685	Ga0495596_0116895	3300046500	Bacteria	1036
686	Ga0495607_0172324	3300046501	Bacteria	1092
687	Ga0495606_0002692	3300046507	Bacteria	20068
688	Ga0495608_0000008	3300046511	Bacteria	268629
689	Ga0495610_0074410	3300046512	Bacteria	1576
690	Ga0495616_0091788	3300046513	Bacteria	1436
691	Ga0495618_0000002	3300046514	Bacteria	271353
692	Ga0495628_0000009	3300046516	Bacteria	237611
693	Ga0495630_0009570	3300046517	Bacteria	6968
694	Ga0495630_0572019	3300046517	Bacteria	866
695	Ga0495631_0057142	3300046518	Bacteria	1698
696	Ga0495632_0077564	3300046519	Bacteria	1588
697	Ga0495637_0120404	3300046520	Bacteria	1010
698	Ga0495644_0012613	3300046523	Bacteria	3250
699	Ga0495644_0092841	3300046523	Bacteria	1140
700	Ga0495666_0316615	3300046526	Bacteria	704
701	Ga0495652_0000011	3300046529	Bacteria	255329
702	Ga0495654_0330385	3300046530	Bacteria	617
703	Ga0495665_0192867	3300046531	Bacteria	1057
704	Ga0495640_0000009	3300046533	Bacteria	217086
705	Ga0495587_0000006	3300046536	Bacteria	310070
706	Ga0495598_0037678	3300046537	Bacteria	1396
707	Ga0495598_0088861	3300046537	Bacteria	1004
708	Ga0495609_0115557	3300046538	Bacteria	1156
709	Ga0495609_0128929	3300046538	Bacteria	1084
710	Ga0495621_0033678	3300046539	Bacteria	1767
711	Ga0495621_0051831	3300046539	Bacteria	1469
712	Ga0495645_0000010	3300046543	Bacteria	238337
713	Ga0495633_0068134	3300046558	Bacteria	1661
714	Ga0495667_0000005	3300046559	Bacteria	268252
715	Ga0495656_0005884	3300046615	Bacteria	4266
716	Ga0495656_0014228	3300046615	Bacteria	2979
717	Ga0495634_0000283	3300046642	Bacteria	48551
718	Ga0495625_0188629	3300046660	Bacteria	1367
719	Ga0495635_0000008	3300046663	Bacteria	268349
720	Ga0495635_0851339	3300046663	Bacteria	586
721	Ga0495659_0011582	3300046664	Bacteria	2841
722	Ga0495659_0029790	3300046664	Bacteria	1896
723	Ga0495659_0034259	3300046664	Bacteria	1785
724	Ga0495588_0025303	3300046674	Bacteria	2956
725	Ga0495657_0000856	3300046675	Bacteria	26832
726	Ga0495599_0000007	3300046678	Bacteria	236638
727	Ga0495623_0000004	3300046679	Bacteria	142249
728	Ga0495646_0000094	3300046680	Bacteria	43394
729	Ga0495647_0055637	3300046681	Unclassified	1549
730	Ga0495658_0005102	3300046683	Bacteria	6453
731	Ga0495658_0522111	3300046683	Bacteria	760
732	Ga0495669_0010604	3300046684	Bacteria	3896
733	Ga0495669_0127707	3300046684	Bacteria	1195
734	Ga0495613_0029423	3300046689	Bacteria	4084
735	Ga0495613_0072860	3300046689	Bacteria	2504
736	Ga0495613_0516506	3300046689	Bacteria	803
737	Ga0495624_0045189	3300046690	Bacteria	2805
738	Ga0495670_0037974	3300046691	Bacteria	2400
739	Ga0495670_0043819	3300046691	Bacteria	2233
740	Ga0495671_0295462	3300046692	Bacteria	779
741	Ga0495649_0250569	3300046694	Bacteria	910
742	Ga0495600_0000001	3300046809	Bacteria	214870
743	Ga0495600_0220870	3300046809	Bacteria	1212
744	Ga0495581_0023317	3300047315	Bacteria	3586
745	Ga0495581_0324591	3300047315	Bacteria	899
746	Ga0495581_0824501	3300047315	Bacteria	532
747	Ga0495604_0000012	3300047317	Bacteria	268341
748	Ga0495636_0547493	3300047318	Bacteria	562
749	Ga0495674_0000011	3300047319	Bacteria	270911
750	Ga0495672_0288913	3300047320	Bacteria	781
751	Ga0495676_0055509	3300047321	Bacteria	3140
752	Ga0495680_0000045	3300047322	Bacteria	96890
753	Ga0495683_0292919	3300047323	Bacteria	701
754	Ga0495675_0000110	3300047444	Bacteria	59086
755	Ga0495677_0112112	3300047445	Bacteria	1037
756	Ga0495673_0004092	3300047469	Bacteria	9261
757	Ga0495684_0000014	3300047471	Bacteria	172111
758	Ga0495593_0003176	3300047673	Bacteria	9865
759	Ga0495602_0000019	3300048088	Bacteria	170922
760	Ga0495615_0029432	3300048090	Bacteria	1303
761	Ga0496100_0006382	3300048903	Bacteria	6427
762	Ga0496100_0175968	3300048903	Bacteria	1545
763	Ga0496101_0000317	3300048904	Bacteria	33300
764	Ga0496101_0656816	3300048904	Bacteria	828
765	Ga0496102_0010330	3300048905	Bacteria	8028
766	Ga0496102_0176814	3300048905	Bacteria	2010
767	Ga0496102_0250038	3300048905	Bacteria	1671
768	Ga0496103_0004965	3300048906	Bacteria	8025
769	Ga0496104_1293361	3300048907	Bacteria	632
770	Ga0496106_0003930	3300048909	Bacteria	11103
771	Ga0496106_0010150	3300048909	Bacteria	6957
772	Ga0496106_0260272	3300048909	Bacteria	1388
773	Ga0496107_0003258	3300048910	Bacteria	10811
774	Ga0496107_0120188	3300048910	Bacteria	1935
775	Ga0496108_0044373	3300048911	Bacteria	3711
776	Ga0496108_0402053	3300048911	Bacteria	1196
777	Ga0496109_0000686	3300048912	Bacteria	28223
778	Ga0496109_0511227	3300048912	Bacteria	1134
779	Ga0496110_0010632	3300048913	Bacteria	7493
780	Ga0496110_0369444	3300048913	Bacteria	1307
781	Ga0496114_0105254	3300048917	Bacteria	2413
782	Ga0496114_0228964	3300048917	Bacteria	1633
783	Ga0496114_0244342	3300048917	Bacteria	1579
784	Ga0496114_0280569	3300048917	Bacteria	1469
785	Ga0496114_1397325	3300048917	Bacteria	587
786	Ga0496115_0008430	3300048918	Bacteria	7628
787	Ga0496115_0032084	3300048918	Bacteria	4143
788	Ga0496115_0220138	3300048918	Bacteria	1566
789	Ga0496116_0171352	3300048919	Bacteria	1175
790	Ga0496119_0012375	3300048922	Bacteria	6937
791	Ga0496119_0022613	3300048922	Bacteria	4493
792	Ga0496121_0000254	3300048924	Bacteria	113314
793	Ga0496122_0032171	3300048925	Bacteria	4343
794	Ga0496123_0001150	3300048926	Bacteria	39462
795	Ga0496124_0351565	3300048927	Bacteria	1042
796	Ga0496125_0312699	3300048928	Bacteria	956
797	Ga0496126_0038428	3300048929	Bacteria	4454
798	Ga0501307_051049	3300049162	Bacteria	622
799	Ga0501031_0016725	3300049568	Bacteria	4765
800	Ga0501032_0017757	3300049569	Bacteria	4993
801	Ga0501032_0220848	3300049569	Bacteria	1233
802	Ga0501033_0000672	3300049570	Bacteria	31550
803	Ga0501034_0923885	3300049571	Bacteria	759
804	Ga0501034_0946777	3300049571	Bacteria	747
805	Ga0501036_0030610	3300049572	Bacteria	4545
806	Ga0501037_0001059	3300049573	Bacteria	20381
807	Ga0501038_0023061	3300049574	Bacteria	5569
808	Ga0501039_0014332	3300049575	Bacteria	6069
809	Ga0501039_0561504	3300049575	Bacteria	895
810	Ga0501039_0813747	3300049575	Bacteria	728
811	Ga0501042_0167071	3300049578	Bacteria	1587
812	Ga0501042_0563597	3300049578	Bacteria	828
813	Ga0501043_0007234	3300049579	Bacteria	8815
814	Ga0501046_0151465	3300049580	Bacteria	1749
815	Ga0501046_0265002	3300049580	Bacteria	1261
816	Ga0501068_0409105	3300049584	Bacteria	875
817	Ga0501070_0475986	3300049586	Bacteria	1005
818	Ga0501071_0567859	3300049587	Bacteria	872
819	Ga0501073_0026366	3300049589	Bacteria	4165
820	Ga0501073_0155617	3300049589	Bacteria	1584
821	Ga0501074_0750159	3300049590	Bacteria	688
822	Ga0501075_0014121	3300049591	Bacteria	5722
823	Ga0501075_0807014	3300049591	Bacteria	714
824	Ga0501076_0072435	3300049592	Bacteria	2757
825	Ga0501076_0396336	3300049592	Bacteria	1135
826	Ga0501077_0004383	3300049593	Bacteria	8563
827	Ga0501233_148473	3300049668	Bacteria	652
828	Ga0501081_0956218	3300049743	Bacteria	647
829	Ga0501035_0431910	3300049822	Bacteria	1092
830	Ga0501035_0688434	3300049822	Bacteria	825
831	Ga0501044_0019722	3300049823	Bacteria	7205
832	Ga0501044_0651315	3300049823	Bacteria	942
833	nmdc:mga00v17_52748_c1	3300050491	Bacteria	2476
834	nmdc:mga00v17_77093_c1	3300050491	Bacteria	2075
835	nmdc:mga0yw44_218864_c1	3300050492	Bacteria	1261
836	nmdc:mga0yw44_490139_c1	3300050492	Bacteria	834
837	nmdc:mga0k408_60216_c1	3300050493	Bacteria	1847
838	nmdc:mga06z11_168596_c1	3300050494	Bacteria	1256
839	nmdc:mga04h51_511492_c1	3300050495	Bacteria	514
840	nmdc:mga07m45_198879_c1	3300050496	Bacteria	1166
841	nmdc:mga07m45_366613_c1	3300050496	Bacteria	837
842	nmdc:mga05p37_20147_c1	3300050507	Bacteria	8072
843	nmdc:mga05p37_688786_c1	3300050507	Bacteria	1138
844	nmdc:mga05p37_69_c2	3300050507	Bacteria	32137
845	nmdc:mga09592_1149540_c1	3300050508	Bacteria	643
846	nmdc:mga09592_548_c1	3300050508	Bacteria	28519
847	nmdc:mga0qj67_101885_c1	3300050509	Bacteria	2315
848	nmdc:mga0qj67_6073_c1	3300050509	Bacteria	8849
849	nmdc:mga06r32_468_c1	3300050510	Bacteria	34583
850	nmdc:mga06r32_56945_c1	3300050510	Bacteria	3754
851	nmdc:mga06r32_891130_c1	3300050510	Bacteria	846
852	nmdc:mga08y16_14578_c1	3300050511	Bacteria	8267
853	nmdc:mga08y16_146485_c1	3300050511	Bacteria	2455
854	nmdc:mga08y16_196728_c1	3300050511	Bacteria	2089
855	nmdc:mga08y16_52826_c1	3300050511	Bacteria	4251
856	nmdc:mga08y16_624_c1	3300050511	Bacteria	33091
857	nmdc:mga0n895_1034_c1	3300050512	Bacteria	20235
858	nmdc:mga0n895_2476_c1	3300050512	Bacteria	14436
859	nmdc:mga0n895_369284_c1	3300050512	Bacteria	1453
860	nmdc:mga0n895_44_c1	3300050512	Bacteria	74241
861	nmdc:mga0rr50_598548_c1	3300050513	Bacteria	940
862	nmdc:mga0rr50_8463_c2	3300050513	Bacteria	6005
863	nmdc:mga08x19_185762_c1	3300050514	Bacteria	1420
864	nmdc:mga08x19_28993_c1	3300050514	Bacteria	3471
865	nmdc:mga0a205_247_c1	3300050515	Bacteria	38521
866	nmdc:mga0a205_29907_c1	3300050515	Bacteria	5213
867	nmdc:mga0a205_45994_c1	3300050515	Bacteria	4209
868	nmdc:mga0sz30_349353_c1	3300050516	Bacteria	661
869	nmdc:mga0sz30_44797_c1	3300050516	Bacteria	1865
870	Ga0495601_0000009	3300053077	Bacteria	270622
871	Ga0495612_0000021	3300053078	Bacteria	130528
872	Ga0495655_0042235	3300053083	Bacteria	1170
873	Ga0495595_0000060	3300053084	Bacteria	56423
874	Ga0495595_0106838	3300053084	Bacteria	1355
875	Ga0495619_0000012	3300053085	Bacteria	268349
876	Ga0500646_0095738	3300053090	Bacteria	925
877	Ga0500566_0011017	3300053094	Bacteria	5327
878	Ga0500641_0017132	3300053096	Bacteria	2705
879	Ga0500556_0000116	3300053104	Bacteria	69618
880	Ga0500593_296043	3300053117	Bacteria	520
881	Ga0500595_004352	3300053119	Bacteria	6371
882	Ga0500658_0091828	3300053134	Bacteria	1314
883	Ga0500568_0248475	3300053139	Bacteria	648
884	Ga0500577_0277728	3300053142	Bacteria	730
885	Ga0500603_044206	3300053150	Bacteria	1198
886	Ga0500603_111362	3300053150	Bacteria	822
887	Ga0500604_0111003	3300053151	Bacteria	910
888	Ga0500619_226054	3300053154	Bacteria	622
889	Ga0500627_0072760	3300053158	Bacteria	1524
890	Ga0500638_012405	3300053162	Bacteria	3816
891	Ga0500637_0001280	3300053178	Bacteria	10539
892	Ga0500611_136251	3300053727	Bacteria	665
893	Ga0500645_005794	3300053730	Bacteria	4492
894	Ga0501084_0009791	3300054114	Bacteria	7924
895	Ga0501084_0084977	3300054114	Bacteria	2657
896	Ga0587066_187337	3300059490	Bacteria	537
897	Ga0587073_0213350	3300059492	Bacteria	586
898	Ga0587082_104458	3300059504	Bacteria	621
899	Ga0587088_133352	3300059508	Bacteria	586
900	Ga0587128_118284	3300059630	Bacteria	574
901	Ga0587128_124274	3300059630	Bacteria	565
902	Ga0587075_105839	3300059644	Bacteria	567
903	Ga0587079_157997	3300059647	Bacteria	591
904	Ga0587107_069835	3300059652	Bacteria	639
905	Ga0587071_159681	3300060344	Bacteria	566
906	Ga0587071_161744	3300060344	Bacteria	564
907	Ga0501082_0022461	3300060353	Bacteria	5434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006871	Ga0075434_100005647	Ga0075434_1000056479	137
2	3300007076	Ga0075435_100301647	Ga0075435_1003016472	137
3	3300027907	Ga0207428_10042142	Ga0207428_100421422	137
4	iso_pu_bacteria	2842038055	2842041780	143
5	iso_pu_bacteria	2842045827	2842049822	143
6	iso_pu_bacteria	2848992105	2848996891	143
7	iso_pu_bacteria	2855872281	2855877114	143
8	iso_pu_bacteria	2855872281	2855878290	143
9	iso_pu_bacteria	2881665667	2881669316	143
10	iso_pu_bacteria	3005594810	3005601688	143
11	3300039438	Ga0436360_0150359	Ga0436360_0150359_117_569	144
12	3300047320	Ga0495672_0288913	Ga0495672_0288913_130_594	144
13	iso_pu_bacteria	2513237087	2513591311	144
14	iso_pu_bacteria	2513237101	2513697538	144
15	iso_pu_bacteria	2528768022	2528850394	144
16	iso_pu_bacteria	2721755755	2723842579	144
17	iso_pu_bacteria	2844315083	2844321336	144
18	iso_pu_bacteria	2874604998	2874606737	144
19	iso_pu_bacteria	2889033259	2889034136	144
20	iso_pu_bacteria	2903727486	2903731474	144
21	iso_pu_bacteria	2906602504	2906607950	144
22	iso_pu_bacteria	2922361189	2922367534	144
23	iso_pu_bacteria	2922368715	2922376618	144
24	iso_pu_bacteria	2922386360	2922391509	144
25	iso_pu_bacteria	2932794094	2932796654	144
26	iso_pu_bacteria	2932801729	2932802566	144
27	iso_pu_bacteria	2935810662	2935817562	144
28	iso_pu_bacteria	2935883170	2935886994	144
29	iso_pu_bacteria	2936037263	2936044359	144
30	iso_pu_bacteria	3005710791	3005717425	144
31	iso_pu_bacteria	3005718088	3005724370	144
32	iso_pu_bacteria	8006964411	8006965878	144
33	iso_pu_bacteria	8006994254	8006999144	144
34	iso_pu_bacteria	8019648815	8019651552	144
35	iso_pu_bacteria	8056967851	8056976140	144
36	3300005435	Ga0070714_102056891	Ga0070714_1020568911	145
37	3300006175	Ga0070712_100637543	Ga0070712_1006375431	145
38	3300006914	Ga0075436_100349738	Ga0075436_1003497382	145
39	3300020070	Ga0206356_10666507	Ga0206356_106665071	145
40	3300020070	Ga0206356_11161563	Ga0206356_111615631	145
41	3300020076	Ga0206355_1491439	Ga0206355_14914391	145
42	3300020077	Ga0206351_10494624	Ga0206351_104946241	145
43	3300020078	Ga0206352_10624303	Ga0206352_106243031	145
44	3300020080	Ga0206350_10379565	Ga0206350_103795651	145
45	3300020610	Ga0154015_1532670	Ga0154015_15326701	145
46	3300022467	Ga0224712_10460855	Ga0224712_104608551	145
47	3300044684	Ga0466966_0104435	Ga0466966_0104435_448_903	145
48	3300044842	Ga0466957_0012605	Ga0466957_0012605_1350_1805	145
49	3300045049	Ga0466959_0140729	Ga0466959_0140729_13_468	145
50	3300045976	Ga0466967_0271856	Ga0466967_0271856_821_1276	145
51	3300059630	Ga0587128_124274	Ga0587128_124274_15_470	145
52	3300059652	Ga0587107_069835	Ga0587107_069835_73_528	145
53	iso_pu_bacteria	2508501128	2509151302	145
54	iso_pu_bacteria	8001845381	8001845809	145
55	3300003735	Ga0006780_1031263	Ga0006780_10312631	146
56	3300004798	Ga0058859_11834964	Ga0058859_118349641	146
57	3300004801	Ga0058860_12191008	Ga0058860_121910081	146
58	3300005436	Ga0070713_101780263	Ga0070713_1017802631	146
59	3300005548	Ga0070665_100956846	Ga0070665_1009568461	146
60	3300019161	Ga0184602_130594	Ga0184602_1305941	146
61	3300019166	Ga0184595_120395	Ga0184595_1203951	146
62	3300020075	Ga0206349_1382233	Ga0206349_13822331	146
63	3300020077	Ga0206351_10033281	Ga0206351_100332811	146
64	3300035115	Ga0373941_0053931	Ga0373941_0053931_93_557	146
65	3300035171	Ga0373946_0338565	Ga0373946_0338565_213_677	146
66	3300046491	Ga0495584_0187926	Ga0495584_0187926_177_641	146
67	3300046492	Ga0495585_0209726	Ga0495585_0209726_480_971	146
68	3300046530	Ga0495654_0330385	Ga0495654_0330385_142_606	146
69	3300046537	Ga0495598_0037678	Ga0495598_0037678_541_1005	146
70	3300048911	Ga0496108_0402053	Ga0496108_0402053_578_1039	146
71	3300048912	Ga0496109_0511227	Ga0496109_0511227_533_994	146
72	3300048917	Ga0496114_0244342	Ga0496114_0244342_85_546	146
73	3300048917	Ga0496114_0280569	Ga0496114_0280569_348_809	146
74	3300048919	Ga0496116_0171352	Ga0496116_0171352_634_1095	146
75	3300049568	Ga0501031_0016725	Ga0501031_0016725_4227_4688	146
76	3300049569	Ga0501032_0017757	Ga0501032_0017757_4184_4645	146
77	3300049569	Ga0501032_0220848	Ga0501032_0220848_239_700	146
78	3300049570	Ga0501033_0000672	Ga0501033_0000672_10295_10756	146
79	3300049571	Ga0501034_0923885	Ga0501034_0923885_156_617	146
80	3300049572	Ga0501036_0030610	Ga0501036_0030610_2088_2549	146
81	3300049573	Ga0501037_0001059	Ga0501037_0001059_18497_18958	146
82	3300049574	Ga0501038_0023061	Ga0501038_0023061_596_1057	146
83	3300049575	Ga0501039_0014332	Ga0501039_0014332_3855_4316	146
84	3300049575	Ga0501039_0561504	Ga0501039_0561504_393_854	146
85	3300049575	Ga0501039_0813747	Ga0501039_0813747_112_573	146
86	3300049578	Ga0501042_0167071	Ga0501042_0167071_683_1144	146
87	3300049579	Ga0501043_0007234	Ga0501043_0007234_3032_3493	146
88	3300049580	Ga0501046_0151465	Ga0501046_0151465_886_1347	146
89	3300049580	Ga0501046_0265002	Ga0501046_0265002_109_570	146
90	3300049584	Ga0501068_0409105	Ga0501068_0409105_396_857	146
91	3300049586	Ga0501070_0475986	Ga0501070_0475986_346_807	146
92	3300049589	Ga0501073_0155617	Ga0501073_0155617_901_1362	146
93	3300049822	Ga0501035_0688434	Ga0501035_0688434_256_717	146
94	3300049823	Ga0501044_0019722	Ga0501044_0019722_4220_4681	146
95	3300049823	Ga0501044_0651315	Ga0501044_0651315_38_499	146
96	3300003354	JGI25160J50197_1009383	JGI25160J50197_10093834	147
97	3300005335	Ga0070666_10155820	Ga0070666_101558201	147
98	3300005338	Ga0068868_101987542	Ga0068868_1019875421	147
99	3300005340	Ga0070689_101427057	Ga0070689_1014270571	147
100	3300005364	Ga0070673_100190289	Ga0070673_1001902891	147
101	3300005367	Ga0070667_100848811	Ga0070667_1008488111	147
102	3300005434	Ga0070709_10010265	Ga0070709_100102654	147
103	3300005435	Ga0070714_100094196	Ga0070714_1000941963	147
104	3300005435	Ga0070714_101424836	Ga0070714_1014248361	147
105	3300005437	Ga0070710_10042679	Ga0070710_100426792	147
106	3300005439	Ga0070711_100170882	Ga0070711_1001708823	147
107	3300005544	Ga0070686_100016322	Ga0070686_1000163225	147
108	3300005718	Ga0068866_10023447	Ga0068866_100234473	147
109	3300005842	Ga0068858_100059409	Ga0068858_1000594091	147
110	3300006163	Ga0070715_10025862	Ga0070715_100258621	147
111	3300006173	Ga0070716_100096046	Ga0070716_1000960462	147
112	3300006237	Ga0097621_100089774	Ga0097621_1000897743	147
113	3300006358	Ga0068871_100116334	Ga0068871_1001163343	147
114	3300006914	Ga0075436_100014032	Ga0075436_1000140325	147
115	3300006942	Ga0099824_1017855	Ga0099824_10178554	147
116	3300009098	Ga0105245_10003197	Ga0105245_100031977	147
117	3300009174	Ga0105241_11192594	Ga0105241_111925942	147
118	3300009177	Ga0105248_10075360	Ga0105248_100753604	147
119	3300009551	Ga0105238_10024948	Ga0105238_100249482	147
120	3300010375	Ga0105239_10093495	Ga0105239_100934954	147
121	3300011119	Ga0105246_10602509	Ga0105246_106025091	147
122	3300013297	Ga0157378_13063859	Ga0157378_130638591	147
123	3300013308	Ga0157375_11007681	Ga0157375_110076812	147
124	3300015262	Ga0182007_10131527	Ga0182007_101315272	147
125	3300019177	Ga0184592_114053	Ga0184592_1140531	147
126	3300019179	Ga0184593_108137	Ga0184593_1081371	147
127	3300019181	Ga0184594_104424	Ga0184594_1044241	147
128	3300019182	Ga0184598_141614	Ga0184598_1416141	147
129	3300019190	Ga0184600_133141	Ga0184600_1331411	147
130	3300020069	Ga0197907_11073341	Ga0197907_110733411	147
131	3300020081	Ga0206354_11517375	Ga0206354_115173751	147
132	3300022467	Ga0224712_10509906	Ga0224712_105099061	147
133	3300023536	Ga0247552_103330	Ga0247552_1033301	147
134	3300023552	Ga0247551_102715	Ga0247551_1027151	147
135	3300023552	Ga0247551_103015	Ga0247551_1030151	147
136	3300023660	Ga0247550_103785	Ga0247550_1037851	147
137	3300023672	Ga0247553_109927	Ga0247553_1099271	147
138	3300025898	Ga0207692_10822519	Ga0207692_108225191	147
139	3300025903	Ga0207680_10128880	Ga0207680_101288802	147
140	3300025906	Ga0207699_10064480	Ga0207699_100644803	147
141	3300025906	Ga0207699_10524588	Ga0207699_105245882	147
142	3300025911	Ga0207654_10331278	Ga0207654_103312781	147
143	3300025924	Ga0207694_10038045	Ga0207694_100380451	147
144	3300025927	Ga0207687_10004880	Ga0207687_100048801	147
145	3300025928	Ga0207700_10564065	Ga0207700_105640651	147
146	3300025929	Ga0207664_10233726	Ga0207664_102337263	147
147	3300025929	Ga0207664_10235685	Ga0207664_102356852	147
148	3300025939	Ga0207665_11235118	Ga0207665_112351181	147
149	3300025949	Ga0207667_10596700	Ga0207667_105967002	147
150	3300025960	Ga0207651_10093549	Ga0207651_100935492	147
151	3300026035	Ga0207703_10038469	Ga0207703_100384693	147
152	3300026095	Ga0207676_11001141	Ga0207676_110011411	147
153	3300027296	Ga0209389_1000027	Ga0209389_100002771	147
154	3300027357	Ga0209589_1000031	Ga0209589_100003183	147
155	3300027361	Ga0209489_100057	Ga0209489_10005764	147
156	3300030760	Ga0265762_1131948	Ga0265762_11319481	147
157	3300030762	Ga0265775_111388	Ga0265775_1113881	147
158	3300030877	Ga0265777_116428	Ga0265777_1164281	147
159	3300032120	Ga0316053_110945	Ga0316053_1109451	147
160	3300035695	Ga0373927_0536766	Ga0373927_0536766_54_539	147
161	3300037853	Ga0436364_0010740	Ga0436364_0010740_215_676	147
162	3300039437	Ga0436365_1240839	Ga0436365_1240839_388_849	147
163	3300039437	Ga0436365_1760388	Ga0436365_1760388_507_968	147
164	3300039453	Ga0436362_1120259	Ga0436362_1120259_243_704	147
165	3300048922	Ga0496119_0012375	Ga0496119_0012375_5110_5568	147
166	3300048925	Ga0496122_0032171	Ga0496122_0032171_788_1246	147
167	3300048926	Ga0496123_0001150	Ga0496123_0001150_18751_19209	147
168	3300049743	Ga0501081_0956218	Ga0501081_0956218_33_497	147
169	3300050493	nmdc:mga0k408_60216_c1	nmdc:mga0k408_60216_c1_602_1069	147
170	3300050514	nmdc:mga08x19_28993_c1	nmdc:mga08x19_28993_c1_2832_3290	147
171	3300050516	nmdc:mga0sz30_349353_c1	nmdc:mga0sz30_349353_c1_80_547	147
172	3300053104	Ga0500556_0000116	Ga0500556_0000116_55717_56175	147
173	3300053730	Ga0500645_005794	Ga0500645_005794_187_648	147
174	3300059490	Ga0587066_187337	Ga0587066_187337_38_490	147
175	3300005355	Ga0070671_101214613	Ga0070671_1012146131	148
176	3300005435	Ga0070714_100332711	Ga0070714_1003327112	148
177	3300005437	Ga0070710_10010597	Ga0070710_100105973	148
178	3300005455	Ga0070663_101196479	Ga0070663_1011964791	148
179	3300005471	Ga0070698_100936011	Ga0070698_1009360112	148
180	3300005543	Ga0070672_101293790	Ga0070672_1012937902	148
181	3300005548	Ga0070665_100514567	Ga0070665_1005145672	148
182	3300005616	Ga0068852_101209725	Ga0068852_1012097251	148
183	3300005844	Ga0068862_100975963	Ga0068862_1009759631	148
184	3300005981	Ga0081538_10032979	Ga0081538_100329793	148
185	3300006028	Ga0070717_10286168	Ga0070717_102861682	148
186	3300006028	Ga0070717_10938564	Ga0070717_109385642	148
187	3300006042	Ga0075368_10139272	Ga0075368_101392721	148
188	3300006051	Ga0075364_10052100	Ga0075364_100521004	148
189	3300006163	Ga0070715_10000561	Ga0070715_100005615	148
190	3300006173	Ga0070716_100311171	Ga0070716_1003111711	148
191	3300006175	Ga0070712_100004486	Ga0070712_10000448614	148
192	3300006175	Ga0070712_100975458	Ga0070712_1009754581	148
193	3300006178	Ga0075367_10007473	Ga0075367_100074735	148
194	3300006186	Ga0075369_10066655	Ga0075369_100666552	148
195	3300006195	Ga0075366_10054349	Ga0075366_100543493	148
196	3300006844	Ga0075428_100023204	Ga0075428_1000232044	148
197	3300006844	Ga0075428_101092756	Ga0075428_1010927561	148
198	3300006846	Ga0075430_100034373	Ga0075430_1000343731	148
199	3300006846	Ga0075430_100103386	Ga0075430_1001033863	148
200	3300006847	Ga0075431_100029253	Ga0075431_1000292534	148
201	3300006847	Ga0075431_100060310	Ga0075431_1000603104	148
202	3300006871	Ga0075434_100004469	Ga0075434_10000446910	148
203	3300006871	Ga0075434_100697826	Ga0075434_1006978261	148
204	3300006880	Ga0075429_100223689	Ga0075429_1002236892	148
205	3300006914	Ga0075436_100022941	Ga0075436_1000229411	148
206	3300007076	Ga0075435_100239292	Ga0075435_1002392922	148
207	3300007265	Ga0099794_10014846	Ga0099794_100148464	148
208	3300007788	Ga0099795_10144877	Ga0099795_101448771	148
209	3300009036	Ga0105244_10101301	Ga0105244_101013011	148
210	3300009093	Ga0105240_10723991	Ga0105240_107239912	148
211	3300009147	Ga0114129_10148356	Ga0114129_101483562	148
212	3300009174	Ga0105241_10536338	Ga0105241_105363382	148
213	3300009553	Ga0105249_10917320	Ga0105249_109173202	148
214	3300013297	Ga0157378_10420888	Ga0157378_104208882	148
215	3300014326	Ga0157380_10256396	Ga0157380_102563962	148
216	3300014969	Ga0157376_10777361	Ga0157376_107773612	148
217	3300019161	Ga0184602_102328	Ga0184602_1023281	148
218	3300019176	Ga0184596_111329	Ga0184596_1113291	148
219	3300019179	Ga0184593_122013	Ga0184593_1220131	148
220	3300019183	Ga0184601_110026	Ga0184601_1100261	148
221	3300019192	Ga0184603_100565	Ga0184603_1005651	148
222	3300020081	Ga0206354_10233150	Ga0206354_102331501	148
223	3300020082	Ga0206353_10520278	Ga0206353_105202781	148
224	3300023547	Ga0247554_104601	Ga0247554_1046011	148
225	3300023660	Ga0247550_103729	Ga0247550_1037291	148
226	3300023672	Ga0247553_108886	Ga0247553_1088861	148
227	3300025254	Ga0209148_1000316	Ga0209148_100031662	148
228	3300025272	Ga0209455_1007806	Ga0209455_10078063	148
229	3300025272	Ga0209455_1021308	Ga0209455_10213082	148
230	3300025297	Ga0209758_1001012	Ga0209758_10010124	148
231	3300025885	Ga0207653_10028594	Ga0207653_100285941	148
232	3300025898	Ga0207692_10048471	Ga0207692_100484711	148
233	3300025905	Ga0207685_10004589	Ga0207685_100045891	148
234	3300025905	Ga0207685_10386822	Ga0207685_103868221	148
235	3300025906	Ga0207699_10041611	Ga0207699_100416112	148
236	3300025906	Ga0207699_10076711	Ga0207699_100767113	148
237	3300025907	Ga0207645_10289745	Ga0207645_102897452	148
238	3300025909	Ga0207705_11393238	Ga0207705_113932381	148
239	3300025915	Ga0207693_10005265	Ga0207693_100052652	148
240	3300025915	Ga0207693_10193070	Ga0207693_101930701	148
241	3300025916	Ga0207663_10237415	Ga0207663_102374152	148
242	3300025916	Ga0207663_10277750	Ga0207663_102777501	148
243	3300025919	Ga0207657_10499430	Ga0207657_104994301	148
244	3300025927	Ga0207687_11192636	Ga0207687_111926361	148
245	3300025929	Ga0207664_10876410	Ga0207664_108764101	148
246	3300025932	Ga0207690_10946460	Ga0207690_109464601	148
247	3300025934	Ga0207686_10734954	Ga0207686_107349541	148
248	3300025935	Ga0207709_10228101	Ga0207709_102281012	148
249	3300025937	Ga0207669_10076746	Ga0207669_100767463	148
250	3300025938	Ga0207704_10023964	Ga0207704_100239643	148
251	3300025939	Ga0207665_10141256	Ga0207665_101412562	148
252	3300025940	Ga0207691_11087813	Ga0207691_110878131	148
253	3300025981	Ga0207640_10444327	Ga0207640_104443271	148
254	3300026067	Ga0207678_10310939	Ga0207678_103109392	148
255	3300026075	Ga0207708_10593789	Ga0207708_105937892	148
256	3300026116	Ga0207674_10271002	Ga0207674_102710022	148
257	3300027512	Ga0209179_1158919	Ga0209179_11589191	148
258	3300027866	Ga0209813_10197907	Ga0209813_101979071	148
259	3300028379	Ga0268266_10013890	Ga0268266_100138902	148
260	3300028379	Ga0268266_10285948	Ga0268266_102859482	148
261	3300028379	Ga0268266_10312653	Ga0268266_103126532	148
262	3300028380	Ga0268265_10336080	Ga0268265_103360802	148
263	3300028380	Ga0268265_11057283	Ga0268265_110572831	148
264	3300028381	Ga0268264_10528798	Ga0268264_105287981	148
265	3300029285	Ga0310981_1039850	Ga0310981_10398501	148
266	3300030763	Ga0265763_1038264	Ga0265763_10382641	148
267	3300030880	Ga0265776_100753	Ga0265776_1007531	148
268	3300031632	Ga0310102_107499	Ga0310102_1074991	148
269	3300031712	Ga0265342_10028732	Ga0265342_100287324	148
270	3300031730	Ga0307516_10327985	Ga0307516_103279852	148
271	3300031901	Ga0307406_12080105	Ga0307406_120801051	148
272	3300032004	Ga0307414_10681264	Ga0307414_106812642	148
273	3300032120	Ga0316053_118763	Ga0316053_1187631	148
274	3300035085	Ga0373929_0074090	Ga0373929_0074090_327_797	148
275	3300035086	Ga0373934_0222026	Ga0373934_0222026_25_489	148
276	3300035089	Ga0373944_0067206	Ga0373944_0067206_80_547	148
277	3300035091	Ga0373951_0111806	Ga0373951_0111806_103_573	148
278	3300035111	Ga0373923_0000040	Ga0373923_0000040_12935_13399	148
279	3300035113	Ga0373936_0001013	Ga0373936_0001013_5978_6442	148
280	3300035115	Ga0373941_0233942	Ga0373941_0233942_207_677	148
281	3300035116	Ga0373945_0018945	Ga0373945_0018945_773_1237	148
282	3300035117	Ga0373953_0013384	Ga0373953_0013384_1223_1687	148
283	3300035117	Ga0373953_0049001	Ga0373953_0049001_1009_1473	148
284	3300035118	Ga0373954_0089971	Ga0373954_0089971_286_750	148
285	3300035118	Ga0373954_0160461	Ga0373954_0160461_344_808	148
286	3300035120	Ga0373957_0006265	Ga0373957_0006265_301_765	148
287	3300035120	Ga0373957_0023932	Ga0373957_0023932_737_1201	148
288	3300035170	Ga0373943_0001030	Ga0373943_0001030_6252_6716	148
289	3300035170	Ga0373943_0290814	Ga0373943_0290814_356_823	148
290	3300035171	Ga0373946_0007377	Ga0373946_0007377_1584_2048	148
291	3300035172	Ga0373955_0002459	Ga0373955_0002459_5640_6104	148
292	3300035172	Ga0373955_0034069	Ga0373955_0034069_2208_2672	148
293	3300035410	Ga0373924_0001493	Ga0373924_0001493_4607_5071	148
294	3300035691	Ga0373931_0187968	Ga0373931_0187968_599_1069	148
295	3300035692	Ga0373935_0000027	Ga0373935_0000027_52207_52671	148
296	3300035695	Ga0373927_0007994	Ga0373927_0007994_5948_6421	148
297	3300035695	Ga0373927_0011189	Ga0373927_0011189_4779_5246	148
298	3300035695	Ga0373927_0014418	Ga0373927_0014418_4418_4882	148
299	3300035695	Ga0373927_0236285	Ga0373927_0236285_204_674	148
300	3300035724	Ga0373933_0001137	Ga0373933_0001137_5566_6030	148
301	3300035725	Ga0373947_0060479	Ga0373947_0060479_445_912	148
302	3300036401	Ga0373937_0004818	Ga0373937_0004818_7410_7874	148
303	3300036457	Ga0265778_031004	Ga0265778_031004_164_628	148
304	3300037068	Ga0373925_0000036	Ga0373925_0000036_85931_86395	148
305	3300037068	Ga0373925_0128182	Ga0373925_0128182_484_948	148
306	3300037068	Ga0373925_0137597	Ga0373925_0137597_809_1276	148
307	3300037418	Ga0395900_1080954	Ga0395900_1080954_177_692	148
308	3300041451	Ga0451791_0828778	Ga0451791_0828778_624_1106	148
309	3300041460	Ga0451802_1792545	Ga0451802_1792545_165_647	148
310	3300041491	Ga0451833_0416176	Ga0451833_0416176_157_624	148
311	3300041496	Ga0451839_0025233	Ga0451839_0025233_296_763	148
312	3300041512	Ga0451853_1376500	Ga0451853_1376500_228_695	148
313	3300044658	Ga0466972_0315481	Ga0466972_0315481_16_477	148
314	3300046452	Ga0495617_013842	Ga0495617_013842_122_589	148
315	3300046454	Ga0495592_0000018	Ga0495592_0000018_106256_106720	148
316	3300046454	Ga0495592_0446433	Ga0495592_0446433_166_630	148
317	3300046455	Ga0495603_0008860	Ga0495603_0008860_3382_3849	148
318	3300046460	Ga0495638_0139891	Ga0495638_0139891_278_745	148
319	3300046462	Ga0495651_0000568	Ga0495651_0000568_732_1196	148
320	3300046463	Ga0495653_0000069	Ga0495653_0000069_83590_84054	148
321	3300046472	Ga0495580_0195200	Ga0495580_0195200_831_1298	148
322	3300046472	Ga0495580_0543154	Ga0495580_0543154_90_557	148
323	3300046473	Ga0495582_0088984	Ga0495582_0088984_733_1200	148
324	3300046473	Ga0495582_0386110	Ga0495582_0386110_11_484	148
325	3300046475	Ga0495639_0279466	Ga0495639_0279466_326_799	148
326	3300046475	Ga0495639_0718863	Ga0495639_0718863_28_495	148
327	3300046476	Ga0495662_0007827	Ga0495662_0007827_970_1434	148
328	3300046477	Ga0495664_0000010	Ga0495664_0000010_98882_99346	148
329	3300046491	Ga0495584_0092559	Ga0495584_0092559_858_1325	148
330	3300046491	Ga0495584_0125057	Ga0495584_0125057_278_748	148
331	3300046492	Ga0495585_0037511	Ga0495585_0037511_2228_2695	148
332	3300046492	Ga0495585_0165719	Ga0495585_0165719_653_1120	148
333	3300046492	Ga0495585_0206735	Ga0495585_0206735_58_516	148
334	3300046499	Ga0495594_0015448	Ga0495594_0015448_2287_2754	148
335	3300046500	Ga0495596_0116895	Ga0495596_0116895_162_629	148
336	3300046501	Ga0495607_0172324	Ga0495607_0172324_472_939	148
337	3300046511	Ga0495608_0000008	Ga0495608_0000008_169303_169767	148
338	3300046513	Ga0495616_0091788	Ga0495616_0091788_438_905	148
339	3300046514	Ga0495618_0000002	Ga0495618_0000002_101155_101619	148
340	3300046516	Ga0495628_0000009	Ga0495628_0000009_98910_99374	148
341	3300046517	Ga0495630_0009570	Ga0495630_0009570_2878_3342	148
342	3300046517	Ga0495630_0572019	Ga0495630_0572019_287_751	148
343	3300046518	Ga0495631_0057142	Ga0495631_0057142_1029_1496	148
344	3300046519	Ga0495632_0077564	Ga0495632_0077564_423_890	148
345	3300046523	Ga0495644_0012613	Ga0495644_0012613_1755_2222	148
346	3300046523	Ga0495644_0092841	Ga0495644_0092841_399_866	148
347	3300046526	Ga0495666_0316615	Ga0495666_0316615_223_690	148
348	3300046529	Ga0495652_0000011	Ga0495652_0000011_168993_169457	148
349	3300046531	Ga0495665_0192867	Ga0495665_0192867_58_525	148
350	3300046533	Ga0495640_0000009	Ga0495640_0000009_117745_118209	148
351	3300046536	Ga0495587_0000006	Ga0495587_0000006_212628_213092	148
352	3300046537	Ga0495598_0088861	Ga0495598_0088861_89_547	148
353	3300046538	Ga0495609_0115557	Ga0495609_0115557_82_549	148
354	3300046539	Ga0495621_0033678	Ga0495621_0033678_994_1461	148
355	3300046539	Ga0495621_0051831	Ga0495621_0051831_138_605	148
356	3300046543	Ga0495645_0000010	Ga0495645_0000010_138366_138830	148
357	3300046558	Ga0495633_0068134	Ga0495633_0068134_751_1218	148
358	3300046559	Ga0495667_0000005	Ga0495667_0000005_98910_99374	148
359	3300046615	Ga0495656_0005884	Ga0495656_0005884_331_798	148
360	3300046615	Ga0495656_0014228	Ga0495656_0014228_1751_2218	148
361	3300046642	Ga0495634_0000283	Ga0495634_0000283_9050_9514	148
362	3300046660	Ga0495625_0188629	Ga0495625_0188629_703_1170	148
363	3300046663	Ga0495635_0000008	Ga0495635_0000008_168976_169440	148
364	3300046663	Ga0495635_0851339	Ga0495635_0851339_66_533	148
365	3300046664	Ga0495659_0011582	Ga0495659_0011582_162_629	148
366	3300046664	Ga0495659_0029790	Ga0495659_0029790_710_1177	148
367	3300046664	Ga0495659_0034259	Ga0495659_0034259_100_570	148
368	3300046674	Ga0495588_0025303	Ga0495588_0025303_1098_1565	148
369	3300046675	Ga0495657_0000856	Ga0495657_0000856_5812_6276	148
370	3300046678	Ga0495599_0000007	Ga0495599_0000007_168993_169457	148
371	3300046679	Ga0495623_0000004	Ga0495623_0000004_134575_135039	148
372	3300046680	Ga0495646_0000094	Ga0495646_0000094_15426_15890	148
373	3300046681	Ga0495647_0055637	Ga0495647_0055637_539_1006	148
374	3300046683	Ga0495658_0005102	Ga0495658_0005102_1556_2023	148
375	3300046683	Ga0495658_0522111	Ga0495658_0522111_247_720	148
376	3300046684	Ga0495669_0010604	Ga0495669_0010604_595_1062	148
377	3300046684	Ga0495669_0127707	Ga0495669_0127707_167_634	148
378	3300046689	Ga0495613_0029423	Ga0495613_0029423_2132_2596	148
379	3300046689	Ga0495613_0072860	Ga0495613_0072860_1742_2209	148
380	3300046689	Ga0495613_0516506	Ga0495613_0516506_186_659	148
381	3300046690	Ga0495624_0045189	Ga0495624_0045189_922_1386	148
382	3300046691	Ga0495670_0037974	Ga0495670_0037974_852_1319	148
383	3300046691	Ga0495670_0043819	Ga0495670_0043819_1708_2175	148
384	3300046692	Ga0495671_0295462	Ga0495671_0295462_113_580	148
385	3300046809	Ga0495600_0000001	Ga0495600_0000001_168993_169457	148
386	3300047315	Ga0495581_0023317	Ga0495581_0023317_622_1086	148
387	3300047315	Ga0495581_0324591	Ga0495581_0324591_74_535	148
388	3300047315	Ga0495581_0824501	Ga0495581_0824501_19_486	148
389	3300047317	Ga0495604_0000012	Ga0495604_0000012_98897_99361	148
390	3300047318	Ga0495636_0547493	Ga0495636_0547493_20_487	148
391	3300047319	Ga0495674_0000011	Ga0495674_0000011_101183_101647	148
392	3300047321	Ga0495676_0055509	Ga0495676_0055509_166_633	148
393	3300047322	Ga0495680_0000045	Ga0495680_0000045_69522_69986	148
394	3300047323	Ga0495683_0292919	Ga0495683_0292919_93_560	148
395	3300047444	Ga0495675_0000110	Ga0495675_0000110_4461_4925	148
396	3300047445	Ga0495677_0112112	Ga0495677_0112112_519_986	148
397	3300047471	Ga0495684_0000014	Ga0495684_0000014_98899_99363	148
398	3300047673	Ga0495593_0003176	Ga0495593_0003176_3753_4217	148
399	3300048088	Ga0495602_0000019	Ga0495602_0000019_98875_99339	148
400	3300048090	Ga0495615_0029432	Ga0495615_0029432_481_948	148
401	3300048903	Ga0496100_0175968	Ga0496100_0175968_540_989	148
402	3300048904	Ga0496101_0656816	Ga0496101_0656816_142_591	148
403	3300048905	Ga0496102_0176814	Ga0496102_0176814_1130_1579	148
404	3300048907	Ga0496104_1293361	Ga0496104_1293361_23_493	148
405	3300048909	Ga0496106_0010150	Ga0496106_0010150_3681_4130	148
406	3300048909	Ga0496106_0260272	Ga0496106_0260272_250_717	148
407	3300048913	Ga0496110_0369444	Ga0496110_0369444_10_480	148
408	3300048917	Ga0496114_0105254	Ga0496114_0105254_1031_1492	148
409	3300048917	Ga0496114_1397325	Ga0496114_1397325_40_507	148
410	3300048918	Ga0496115_0032084	Ga0496115_0032084_2849_3310	148
411	3300048918	Ga0496115_0220138	Ga0496115_0220138_766_1215	148
412	3300048922	Ga0496119_0022613	Ga0496119_0022613_1555_2022	148
413	3300048927	Ga0496124_0351565	Ga0496124_0351565_393_860	148
414	3300048928	Ga0496125_0312699	Ga0496125_0312699_27_494	148
415	3300048929	Ga0496126_0038428	Ga0496126_0038428_3441_3908	148
416	3300049162	Ga0501307_051049	Ga0501307_051049_133_600	148
417	3300049589	Ga0501073_0026366	Ga0501073_0026366_2357_2824	148
418	3300049591	Ga0501075_0014121	Ga0501075_0014121_3359_3826	148
419	3300049591	Ga0501075_0807014	Ga0501075_0807014_146_613	148
420	3300049592	Ga0501076_0072435	Ga0501076_0072435_2218_2685	148
421	3300049593	Ga0501077_0004383	Ga0501077_0004383_240_707	148
422	3300049668	Ga0501233_148473	Ga0501233_148473_151_618	148
423	3300049822	Ga0501035_0431910	Ga0501035_0431910_516_995	148
424	3300050491	nmdc:mga00v17_52748_c1	nmdc:mga00v17_52748_c1_1445_1912	148
425	3300050491	nmdc:mga00v17_77093_c1	nmdc:mga00v17_77093_c1_1110_1577	148
426	3300050492	nmdc:mga0yw44_218864_c1	nmdc:mga0yw44_218864_c1_36_503	148
427	3300050492	nmdc:mga0yw44_490139_c1	nmdc:mga0yw44_490139_c1_192_659	148
428	3300050496	nmdc:mga07m45_198879_c1	nmdc:mga07m45_198879_c1_217_684	148
429	3300050507	nmdc:mga05p37_20147_c1	nmdc:mga05p37_20147_c1_5302_5751	148
430	3300050507	nmdc:mga05p37_688786_c1	nmdc:mga05p37_688786_c1_510_977	148
431	3300050509	nmdc:mga0qj67_101885_c1	nmdc:mga0qj67_101885_c1_1368_1817	148
432	3300050510	nmdc:mga06r32_56945_c1	nmdc:mga06r32_56945_c1_1795_2244	148
433	3300050510	nmdc:mga06r32_891130_c1	nmdc:mga06r32_891130_c1_189_656	148
434	3300050511	nmdc:mga08y16_196728_c1	nmdc:mga08y16_196728_c1_1170_1637	148
435	3300050512	nmdc:mga0n895_2476_c1	nmdc:mga0n895_2476_c1_4035_4496	148
436	3300050512	nmdc:mga0n895_369284_c1	nmdc:mga0n895_369284_c1_873_1322	148
437	3300050513	nmdc:mga0rr50_598548_c1	nmdc:mga0rr50_598548_c1_279_728	148
438	3300050516	nmdc:mga0sz30_44797_c1	nmdc:mga0sz30_44797_c1_1244_1711	148
439	3300053077	Ga0495601_0000009	Ga0495601_0000009_168976_169440	148
440	3300053078	Ga0495612_0000021	Ga0495612_0000021_98789_99253	148
441	3300053084	Ga0495595_0000060	Ga0495595_0000060_5428_5892	148
442	3300053084	Ga0495595_0106838	Ga0495595_0106838_610_1074	148
443	3300053085	Ga0495619_0000012	Ga0495619_0000012_168976_169440	148
444	3300053094	Ga0500566_0011017	Ga0500566_0011017_3039_3506	148
445	3300053117	Ga0500593_296043	Ga0500593_296043_12_479	148
446	3300053119	Ga0500595_004352	Ga0500595_004352_1901_2368	148
447	3300053134	Ga0500658_0091828	Ga0500658_0091828_41_508	148
448	3300053150	Ga0500603_111362	Ga0500603_111362_117_584	148
449	3300053154	Ga0500619_226054	Ga0500619_226054_116_583	148
450	3300053158	Ga0500627_0072760	Ga0500627_0072760_94_561	148
451	3300053162	Ga0500638_012405	Ga0500638_012405_2459_2926	148
452	3300053178	Ga0500637_0001280	Ga0500637_0001280_1413_1880	148
453	3300054114	Ga0501084_0009791	Ga0501084_0009791_3494_3961	148
454	3300059508	Ga0587088_133352	Ga0587088_133352_30_491	148
455	3300059630	Ga0587128_118284	Ga0587128_118284_11_478	148
456	3300060344	Ga0587071_159681	Ga0587071_159681_12_491	148
457	3300060353	Ga0501082_0022461	Ga0501082_0022461_4904_5371	148
458	3300005340	Ga0070689_100127808	Ga0070689_1001278081	149
459	3300005436	Ga0070713_100316685	Ga0070713_1003166852	149
460	3300005544	Ga0070686_100276922	Ga0070686_1002769222	149
461	3300005548	Ga0070665_101616619	Ga0070665_1016166191	149
462	3300005617	Ga0068859_100405244	Ga0068859_1004052443	149
463	3300005843	Ga0068860_100276228	Ga0068860_1002762282	149
464	3300005844	Ga0068862_100168839	Ga0068862_1001688393	149
465	3300006931	Ga0097620_100405245	Ga0097620_1004052451	149
466	3300009098	Ga0105245_10012576	Ga0105245_100125762	149
467	3300009177	Ga0105248_10298509	Ga0105248_102985092	149
468	3300009177	Ga0105248_13463501	Ga0105248_134635011	149
469	3300010159	Ga0099796_10106464	Ga0099796_101064642	149
470	3300013296	Ga0157374_10489957	Ga0157374_104899572	149
471	3300013308	Ga0157375_11001303	Ga0157375_110013032	149
472	3300014325	Ga0163163_11554591	Ga0163163_115545911	149
473	3300014326	Ga0157380_10051102	Ga0157380_100511023	149
474	3300025918	Ga0207662_10024699	Ga0207662_100246992	149
475	3300025928	Ga0207700_10312070	Ga0207700_103120701	149
476	3300025933	Ga0207706_10216748	Ga0207706_102167482	149
477	3300025941	Ga0207711_10606204	Ga0207711_106062042	149
478	3300027671	Ga0209588_1116411	Ga0209588_11164111	149
479	3300028380	Ga0268265_10906392	Ga0268265_109063921	149
480	3300028381	Ga0268264_10297648	Ga0268264_102976482	149
481	3300028381	Ga0268264_11680830	Ga0268264_116808301	149
482	3300031730	Ga0307516_10052151	Ga0307516_100521511	149
483	3300035116	Ga0373945_0013564	Ga0373945_0013564_49_540	149
484	3300035691	Ga0373931_0304793	Ga0373931_0304793_195_656	149
485	3300037312	Ga0395899_0119869	Ga0395899_0119869_619_1095	149
486	3300037471	Ga0395905_0030267	Ga0395905_0030267_449_940	149
487	3300041459	Ga0451800_0993481	Ga0451800_0993481_40_501	149
488	3300046809	Ga0495600_0220870	Ga0495600_0220870_14_490	149
489	3300047469	Ga0495673_0004092	Ga0495673_0004092_5517_6008	149
490	3300048924	Ga0496121_0000254	Ga0496121_0000254_59190_59681	149
491	3300053139	Ga0500568_0248475	Ga0500568_0248475_148_612	149
492	3300053151	Ga0500604_0111003	Ga0500604_0111003_42_506	149
493	2209111006	2214884082	2213936984	150
494	3300000041	ARcpr5oldR_c000550	ARcpr5oldR_0005502	150
495	3300000042	ARSoilYngRDRAFT_c00162	ARSoilYngRDRAFT_001625	150
496	3300000043	ARcpr5yngRDRAFT_c000013	ARcpr5yngRDRAFT_00001319	150
497	3300000044	ARSoilOldRDRAFT_c000029	ARSoilOldRDRAFT_0000297	150
498	3300000652	ARCol0yngRDRAFT_1000528	ARCol0yngRDRAFT_10005286	150
499	3300001430	JGI24032J14994_101255	JGI24032J14994_1012552	150
500	3300001915	JGI24741J21665_1009003	JGI24741J21665_10090032	150
501	3300001976	JGI24752J21851_1006775	JGI24752J21851_10067751	150
502	3300001977	JGI24746J21847_1000267	JGI24746J21847_10002673	150
503	3300001978	JGI24747J21853_1001317	JGI24747J21853_10013172	150
504	3300001989	JGI24739J22299_10019642	JGI24739J22299_100196421	150
505	3300001990	JGI24737J22298_10001023	JGI24737J22298_100010235	150
506	3300001990	JGI24737J22298_10049278	JGI24737J22298_100492782	150
507	3300001991	JGI24743J22301_10040988	JGI24743J22301_100409881	150
508	3300002070	JGI24750J21931_1000585	JGI24750J21931_10005856	150
509	3300002070	JGI24750J21931_1069550	JGI24750J21931_10695501	150
510	3300002073	JGI24745J21846_1000082	JGI24745J21846_10000825	150
511	3300002074	JGI24748J21848_1000312	JGI24748J21848_10003123	150
512	3300002075	JGI24738J21930_10002656	JGI24738J21930_100026563	150
513	3300002076	JGI24749J21850_1000328	JGI24749J21850_10003283	150
514	3300002077	JGI24744J21845_10006624	JGI24744J21845_100066242	150
515	3300002126	JGI24035J26624_1000763	JGI24035J26624_10007633	150
516	3300002155	JGI24033J26618_1006887	JGI24033J26618_10068872	150
517	3300002239	JGI24034J26672_10001849	JGI24034J26672_100018492	150
518	3300002244	JGI24742J22300_10000452	JGI24742J22300_100004523	150
519	3300003162	Ga0006778J45830_1059919	Ga0006778J45830_10599191	150
520	3300003163	Ga0006759J45824_1028391	Ga0006759J45824_10283911	150
521	3300003163	Ga0006759J45824_1030682	Ga0006759J45824_10306821	150
522	3300003305	Ga0006770J48903_1012985	Ga0006770J48903_10129851	150
523	3300003305	Ga0006770J48903_1025145	Ga0006770J48903_10251451	150
524	3300003305	Ga0006770J48903_1053544	Ga0006770J48903_10535441	150
525	3300003308	Ga0006777J48905_1004867	Ga0006777J48905_10048671	150
526	3300003308	Ga0006777J48905_1015450	Ga0006777J48905_10154501	150
527	3300003347	JGI26128J50194_1006838	JGI26128J50194_10068381	150
528	3300003371	JGI26145J50221_1006481	JGI26145J50221_10064812	150
529	3300003544	Ga0007417J51691_1022949	Ga0007417J51691_10229491	150
530	3300003544	Ga0007417J51691_1061499	Ga0007417J51691_10614991	150
531	3300003568	Ga0006781J51513_1006973	Ga0006781J51513_10069731	150
532	3300003574	Ga0007410J51695_1022396	Ga0007410J51695_10223961	150
533	3300003579	Ga0007429J51699_1021290	Ga0007429J51699_10212901	150
534	3300003579	Ga0007429J51699_1040932	Ga0007429J51699_10409321	150
535	3300003693	Ga0032354_1002506	Ga0032354_10025061	150
536	3300003693	Ga0032354_1008050	Ga0032354_10080501	150
537	3300003693	Ga0032354_1028872	Ga0032354_10288721	150
538	3300003735	Ga0006780_1005027	Ga0006780_10050271	150
539	3300003735	Ga0006780_1016131	Ga0006780_10161311	150
540	3300005276	Ga0065717_1005603	Ga0065717_10056031	150
541	3300005277	Ga0065716_1000028	Ga0065716_10000286	150
542	3300005289	Ga0065704_10799314	Ga0065704_107993141	150
543	3300005290	Ga0065712_10202863	Ga0065712_102028632	150
544	3300005293	Ga0065715_10099927	Ga0065715_100999273	150
545	3300005293	Ga0065715_10349433	Ga0065715_103494331	150
546	3300005295	Ga0065707_10181128	Ga0065707_101811282	150
547	3300005328	Ga0070676_10001293	Ga0070676_100012935	150
548	3300005328	Ga0070676_10139297	Ga0070676_101392972	150
549	3300005328	Ga0070676_11098427	Ga0070676_110984271	150
550	3300005329	Ga0070683_100000173	Ga0070683_1000001735	150
551	3300005330	Ga0070690_100010450	Ga0070690_1000104503	150
552	3300005330	Ga0070690_100034289	Ga0070690_1000342892	150
553	3300005331	Ga0070670_100003033	Ga0070670_1000030336	150
554	3300005333	Ga0070677_10000466	Ga0070677_100004666	150
555	3300005334	Ga0068869_100000425	Ga0068869_10000042513	150
556	3300005335	Ga0070666_10010906	Ga0070666_100109063	150
557	3300005336	Ga0070680_100002814	Ga0070680_1000028145	150
558	3300005336	Ga0070680_100210924	Ga0070680_1002109241	150
559	3300005337	Ga0070682_100000375	Ga0070682_1000003757	150
560	3300005338	Ga0068868_100000176	Ga0068868_1000001766	150
561	3300005339	Ga0070660_100000590	Ga0070660_10000059015	150
562	3300005339	Ga0070660_100032225	Ga0070660_1000322252	150
563	3300005340	Ga0070689_100000116	Ga0070689_10000011636	150
564	3300005340	Ga0070689_100320887	Ga0070689_1003208872	150
565	3300005341	Ga0070691_10000584	Ga0070691_100005846	150
566	3300005341	Ga0070691_10087609	Ga0070691_100876091	150
567	3300005343	Ga0070687_100001023	Ga0070687_1000010235	150
568	3300005343	Ga0070687_100059829	Ga0070687_1000598291	150
569	3300005344	Ga0070661_100000934	Ga0070661_10000093414	150
570	3300005345	Ga0070692_10010539	Ga0070692_100105392	150
571	3300005345	Ga0070692_10022178	Ga0070692_100221783	150
572	3300005347	Ga0070668_100000814	Ga0070668_1000008142	150
573	3300005347	Ga0070668_100113204	Ga0070668_1001132042	150
574	3300005353	Ga0070669_100000723	Ga0070669_1000007237	150
575	3300005353	Ga0070669_100259723	Ga0070669_1002597231	150
576	3300005354	Ga0070675_100002974	Ga0070675_1000029745	150
577	3300005354	Ga0070675_100189594	Ga0070675_1001895941	150
578	3300005354	Ga0070675_100700210	Ga0070675_1007002101	150
579	3300005355	Ga0070671_100012154	Ga0070671_1000121546	150
580	3300005356	Ga0070674_100081002	Ga0070674_1000810023	150
581	3300005356	Ga0070674_100688665	Ga0070674_1006886652	150
582	3300005364	Ga0070673_100013022	Ga0070673_1000130223	150
583	3300005365	Ga0070688_100004867	Ga0070688_1000048676	150
584	3300005365	Ga0070688_100189185	Ga0070688_1001891852	150
585	3300005365	Ga0070688_100240134	Ga0070688_1002401342	150
586	3300005366	Ga0070659_100023122	Ga0070659_1000231222	150
587	3300005366	Ga0070659_100255990	Ga0070659_1002559901	150
588	3300005367	Ga0070667_100000973	Ga0070667_1000009736	150
589	3300005367	Ga0070667_100801250	Ga0070667_1008012501	150
590	3300005406	Ga0070703_10079299	Ga0070703_100792992	150
591	3300005438	Ga0070701_10002456	Ga0070701_100024563	150
592	3300005438	Ga0070701_10205446	Ga0070701_102054461	150
593	3300005440	Ga0070705_100005712	Ga0070705_1000057123	150
594	3300005440	Ga0070705_100083713	Ga0070705_1000837133	150
595	3300005441	Ga0070700_100011354	Ga0070700_1000113545	150
596	3300005441	Ga0070700_100026320	Ga0070700_1000263203	150
597	3300005444	Ga0070694_100012237	Ga0070694_1000122374	150
598	3300005444	Ga0070694_100024089	Ga0070694_1000240893	150
599	3300005445	Ga0070708_100206184	Ga0070708_1002061841	150
600	3300005456	Ga0070678_100009102	Ga0070678_1000091026	150
601	3300005456	Ga0070678_100673723	Ga0070678_1006737231	150
602	3300005457	Ga0070662_100001872	Ga0070662_1000018725	150
603	3300005457	Ga0070662_100346923	Ga0070662_1003469232	150
604	3300005458	Ga0070681_10001649	Ga0070681_1000164911	150
605	3300005458	Ga0070681_10099631	Ga0070681_100996311	150
606	3300005458	Ga0070681_10516487	Ga0070681_105164872	150
607	3300005459	Ga0068867_100023270	Ga0068867_1000232705	150
608	3300005459	Ga0068867_101254408	Ga0068867_1012544081	150
609	3300005466	Ga0070685_10003195	Ga0070685_100031954	150
610	3300005466	Ga0070685_10156784	Ga0070685_101567841	150
611	3300005468	Ga0070707_100600845	Ga0070707_1006008453	150
612	3300005471	Ga0070698_101066522	Ga0070698_1010665221	150
613	3300005507	Ga0074259_10954145	Ga0074259_109541452	150
614	3300005518	Ga0070699_100298695	Ga0070699_1002986951	150
615	3300005530	Ga0070679_100019945	Ga0070679_1000199451	150
616	3300005530	Ga0070679_100925213	Ga0070679_1009252131	150
617	3300005535	Ga0070684_100000146	Ga0070684_10000014636	150
618	3300005535	Ga0070684_100024765	Ga0070684_1000247654	150
619	3300005536	Ga0070697_100039969	Ga0070697_1000399693	150
620	3300005539	Ga0068853_100009850	Ga0068853_1000098503	150
621	3300005539	Ga0068853_100977314	Ga0068853_1009773141	150
622	3300005543	Ga0070672_100000063	Ga0070672_1000000636	150
623	3300005543	Ga0070672_100193102	Ga0070672_1001931022	150
624	3300005544	Ga0070686_100000498	Ga0070686_10000049815	150
625	3300005544	Ga0070686_100024534	Ga0070686_1000245342	150
626	3300005545	Ga0070695_100000044	Ga0070695_10000004436	150
627	3300005545	Ga0070695_100029947	Ga0070695_1000299471	150
628	3300005546	Ga0070696_100007162	Ga0070696_1000071623	150
629	3300005546	Ga0070696_100392499	Ga0070696_1003924991	150
630	3300005547	Ga0070693_100001749	Ga0070693_1000017493	150
631	3300005547	Ga0070693_100543486	Ga0070693_1005434862	150
632	3300005548	Ga0070665_100073862	Ga0070665_1000738623	150
633	3300005548	Ga0070665_100109425	Ga0070665_1001094253	150
634	3300005548	Ga0070665_100555294	Ga0070665_1005552942	150
635	3300005549	Ga0070704_100000125	Ga0070704_10000012517	150
636	3300005549	Ga0070704_100009894	Ga0070704_1000098943	150
637	3300005549	Ga0070704_101023807	Ga0070704_1010238071	150
638	3300005563	Ga0068855_100003481	Ga0068855_1000034816	150
639	3300005564	Ga0070664_100023525	Ga0070664_1000235256	150
640	3300005564	Ga0070664_100279069	Ga0070664_1002790692	150
641	3300005564	Ga0070664_100486943	Ga0070664_1004869432	150
642	3300005577	Ga0068857_100002070	Ga0068857_1000020707	150
643	3300005577	Ga0068857_100134787	Ga0068857_1001347873	150
644	3300005578	Ga0068854_100006766	Ga0068854_1000067667	150
645	3300005614	Ga0068856_100001419	Ga0068856_10000141915	150
646	3300005615	Ga0070702_100000992	Ga0070702_1000009926	150
647	3300005616	Ga0068852_100025419	Ga0068852_1000254194	150
648	3300005616	Ga0068852_100291883	Ga0068852_1002918833	150
649	3300005617	Ga0068859_100001728	Ga0068859_1000017285	150
650	3300005617	Ga0068859_100049711	Ga0068859_1000497113	150
651	3300005618	Ga0068864_100779173	Ga0068864_1007791731	150
652	3300005718	Ga0068866_10004751	Ga0068866_100047513	150
653	3300005718	Ga0068866_10866606	Ga0068866_108666062	150
654	3300005719	Ga0068861_100006229	Ga0068861_1000062293	150
655	3300005719	Ga0068861_100045771	Ga0068861_1000457713	150
656	3300005840	Ga0068870_10005931	Ga0068870_100059313	150
657	3300005841	Ga0068863_100000334	Ga0068863_10000033436	150
658	3300005841	Ga0068863_100750270	Ga0068863_1007502701	150
659	3300005842	Ga0068858_100063599	Ga0068858_1000635992	150
660	3300005842	Ga0068858_100620760	Ga0068858_1006207602	150
661	3300005842	Ga0068858_101038762	Ga0068858_1010387622	150
662	3300005843	Ga0068860_100005103	Ga0068860_1000051035	150
663	3300005844	Ga0068862_100013798	Ga0068862_1000137987	150
664	3300005844	Ga0068862_100326576	Ga0068862_1003265761	150
665	3300005937	Ga0081455_10000101	Ga0081455_1000010178	150
666	3300005937	Ga0081455_10011688	Ga0081455_100116884	150
667	3300005983	Ga0081540_1033335	Ga0081540_10333352	150
668	3300006042	Ga0075368_10092183	Ga0075368_100921831	150
669	3300006048	Ga0075363_100052299	Ga0075363_1000522992	150
670	3300006058	Ga0075432_10001203	Ga0075432_100012034	150
671	3300006178	Ga0075367_10178514	Ga0075367_101785142	150
672	3300006194	Ga0075427_10005139	Ga0075427_100051392	150
673	3300006237	Ga0097621_100000019	Ga0097621_10000001975	150
674	3300006353	Ga0075370_10124199	Ga0075370_101241992	150
675	3300006358	Ga0068871_100002255	Ga0068871_1000022556	150
676	3300006844	Ga0075428_100038288	Ga0075428_1000382882	150
677	3300006846	Ga0075430_100000427	Ga0075430_1000004276	150
678	3300006846	Ga0075430_100655460	Ga0075430_1006554602	150
679	3300006847	Ga0075431_100956158	Ga0075431_1009561581	150
680	3300006852	Ga0075433_10031568	Ga0075433_100315686	150
681	3300006852	Ga0075433_10781635	Ga0075433_107816351	150
682	3300006871	Ga0075434_100003647	Ga0075434_1000036475	150
683	3300006871	Ga0075434_100013101	Ga0075434_1000131017	150
684	3300006880	Ga0075429_100001540	Ga0075429_10000154010	150
685	3300006880	Ga0075429_100424383	Ga0075429_1004243832	150
686	3300006881	Ga0068865_100001204	Ga0068865_1000012046	150
687	3300006881	Ga0068865_100369621	Ga0068865_1003696212	150
688	3300006931	Ga0097620_100001728	Ga0097620_1000017285	150
689	3300006931	Ga0097620_100049713	Ga0097620_1000497133	150
690	3300007076	Ga0075435_100252416	Ga0075435_1002524162	150
691	3300007076	Ga0075435_100418657	Ga0075435_1004186571	150
692	3300009036	Ga0105244_10020183	Ga0105244_100201832	150
693	3300009093	Ga0105240_10157152	Ga0105240_101571523	150
694	3300009093	Ga0105240_11332673	Ga0105240_113326731	150
695	3300009094	Ga0111539_10003096	Ga0111539_1000309615	150
696	3300009094	Ga0111539_10029632	Ga0111539_100296324	150
697	3300009098	Ga0105245_10018285	Ga0105245_100182857	150
698	3300009101	Ga0105247_10010378	Ga0105247_100103785	150
699	3300009101	Ga0105247_10082797	Ga0105247_100827972	150
700	3300009148	Ga0105243_10000376	Ga0105243_100003766	150
701	3300009148	Ga0105243_10120093	Ga0105243_101200933	150
702	3300009176	Ga0105242_10013774	Ga0105242_100137747	150
703	3300009177	Ga0105248_10024674	Ga0105248_100246746	150
704	3300009545	Ga0105237_10022580	Ga0105237_100225803	150
705	3300009545	Ga0105237_10274457	Ga0105237_102744572	150
706	3300009551	Ga0105238_10653394	Ga0105238_106533942	150
707	3300009553	Ga0105249_10000752	Ga0105249_1000075216	150
708	3300009553	Ga0105249_10018458	Ga0105249_100184585	150
709	3300010375	Ga0105239_10004996	Ga0105239_100049968	150
710	3300011119	Ga0105246_10006514	Ga0105246_100065145	150
711	3300011119	Ga0105246_10382467	Ga0105246_103824672	150
712	3300011119	Ga0105246_10617625	Ga0105246_106176252	150
713	3300012478	Ga0157328_1007357	Ga0157328_10073571	150
714	3300012483	Ga0157337_1010050	Ga0157337_10100501	150
715	3300012488	Ga0157343_1000627	Ga0157343_10006272	150
716	3300012495	Ga0157323_1000631	Ga0157323_10006312	150
717	3300012498	Ga0157345_1006169	Ga0157345_10061691	150
718	3300012515	Ga0157338_1000288	Ga0157338_10002882	150
719	3300013100	Ga0157373_10105312	Ga0157373_101053122	150
720	3300013102	Ga0157371_10010064	Ga0157371_100100643	150
721	3300013102	Ga0157371_10374010	Ga0157371_103740101	150
722	3300013104	Ga0157370_10949784	Ga0157370_109497842	150
723	3300013105	Ga0157369_10621177	Ga0157369_106211772	150
724	3300013296	Ga0157374_10013009	Ga0157374_100130093	150
725	3300013297	Ga0157378_10039951	Ga0157378_100399513	150
726	3300013297	Ga0157378_10261517	Ga0157378_102615172	150
727	3300013306	Ga0163162_10015688	Ga0163162_100156886	150
728	3300013307	Ga0157372_10210195	Ga0157372_102101952	150
729	3300013308	Ga0157375_10000293	Ga0157375_100002932	150
730	3300014325	Ga0163163_10031177	Ga0163163_100311773	150
731	3300014326	Ga0157380_10000307	Ga0157380_100003076	150
732	3300014745	Ga0157377_10005217	Ga0157377_100052173	150
733	3300014968	Ga0157379_10001189	Ga0157379_100011893	150
734	3300014969	Ga0157376_10003167	Ga0157376_100031674	150
735	3300017792	Ga0163161_10004010	Ga0163161_100040104	150
736	3300020082	Ga0206353_12015128	Ga0206353_120151281	150
737	3300025271	Ga0207666_1000288	Ga0207666_10002885	150
738	3300025271	Ga0207666_1009266	Ga0207666_10092661	150
739	3300025290	Ga0207673_1000437	Ga0207673_10004372	150
740	3300025315	Ga0207697_10002308	Ga0207697_100023089	150
741	3300025315	Ga0207697_10010802	Ga0207697_100108023	150
742	3300025893	Ga0207682_10000876	Ga0207682_100008764	150
743	3300025899	Ga0207642_10000445	Ga0207642_100004452	150
744	3300025900	Ga0207710_10003413	Ga0207710_100034134	150
745	3300025901	Ga0207688_10010307	Ga0207688_100103076	150
746	3300025903	Ga0207680_10006408	Ga0207680_100064083	150
747	3300025904	Ga0207647_10010736	Ga0207647_100107363	150
748	3300025904	Ga0207647_10017195	Ga0207647_100171952	150
749	3300025904	Ga0207647_10485829	Ga0207647_104858291	150
750	3300025907	Ga0207645_10000291	Ga0207645_100002915	150
751	3300025907	Ga0207645_10654056	Ga0207645_106540561	150
752	3300025908	Ga0207643_10000373	Ga0207643_1000037310	150
753	3300025911	Ga0207654_10003302	Ga0207654_100033023	150
754	3300025912	Ga0207707_10004766	Ga0207707_100047665	150
755	3300025912	Ga0207707_10005748	Ga0207707_100057485	150
756	3300025913	Ga0207695_10225842	Ga0207695_102258422	150
757	3300025914	Ga0207671_10016742	Ga0207671_100167423	150
758	3300025914	Ga0207671_10942619	Ga0207671_109426191	150
759	3300025917	Ga0207660_10006704	Ga0207660_1000670411	150
760	3300025917	Ga0207660_10080308	Ga0207660_100803081	150
761	3300025918	Ga0207662_10000803	Ga0207662_100008035	150
762	3300025918	Ga0207662_10005017	Ga0207662_100050175	150
763	3300025919	Ga0207657_10001716	Ga0207657_1000171615	150
764	3300025919	Ga0207657_10117849	Ga0207657_101178492	150
765	3300025920	Ga0207649_10000204	Ga0207649_1000020436	150
766	3300025921	Ga0207652_10007413	Ga0207652_100074133	150
767	3300025921	Ga0207652_10766636	Ga0207652_107666362	150
768	3300025923	Ga0207681_10000066	Ga0207681_1000006682	150
769	3300025923	Ga0207681_10259654	Ga0207681_102596541	150
770	3300025924	Ga0207694_10461017	Ga0207694_104610171	150
771	3300025925	Ga0207650_10443165	Ga0207650_104431652	150
772	3300025926	Ga0207659_10000273	Ga0207659_1000027315	150
773	3300025926	Ga0207659_10074185	Ga0207659_100741851	150
774	3300025926	Ga0207659_11064037	Ga0207659_110640371	150
775	3300025927	Ga0207687_10000052	Ga0207687_1000005276	150
776	3300025931	Ga0207644_10003722	Ga0207644_100037226	150
777	3300025932	Ga0207690_10000187	Ga0207690_1000018736	150
778	3300025932	Ga0207690_10365136	Ga0207690_103651362	150
779	3300025933	Ga0207706_10027464	Ga0207706_100274642	150
780	3300025933	Ga0207706_10396085	Ga0207706_103960851	150
781	3300025933	Ga0207706_10563631	Ga0207706_105636311	150
782	3300025934	Ga0207686_10008244	Ga0207686_100082443	150
783	3300025935	Ga0207709_10004618	Ga0207709_100046186	150
784	3300025935	Ga0207709_10057734	Ga0207709_100577343	150
785	3300025936	Ga0207670_10000140	Ga0207670_100001405	150
786	3300025936	Ga0207670_10270270	Ga0207670_102702702	150
787	3300025937	Ga0207669_10004921	Ga0207669_100049216	150
788	3300025938	Ga0207704_10000108	Ga0207704_1000010832	150
789	3300025940	Ga0207691_10012798	Ga0207691_100127982	150
790	3300025941	Ga0207711_10031782	Ga0207711_100317823	150
791	3300025941	Ga0207711_10173475	Ga0207711_101734753	150
792	3300025942	Ga0207689_10000233	Ga0207689_100002337	150
793	3300025944	Ga0207661_10000230	Ga0207661_1000023025	150
794	3300025945	Ga0207679_10000052	Ga0207679_1000005296	150
795	3300025945	Ga0207679_10265905	Ga0207679_102659052	150
796	3300025960	Ga0207651_10000482	Ga0207651_100004826	150
797	3300025961	Ga0207712_10000265	Ga0207712_1000026538	150
798	3300025961	Ga0207712_10022187	Ga0207712_100221875	150
799	3300025961	Ga0207712_10113748	Ga0207712_101137482	150
800	3300025972	Ga0207668_10000151	Ga0207668_1000015136	150
801	3300025972	Ga0207668_10302967	Ga0207668_103029672	150
802	3300025981	Ga0207640_10001417	Ga0207640_100014176	150
803	3300025986	Ga0207658_10000807	Ga0207658_100008076	150
804	3300025986	Ga0207658_10761639	Ga0207658_107616391	150
805	3300026023	Ga0207677_10005185	Ga0207677_100051853	150
806	3300026035	Ga0207703_10010332	Ga0207703_100103326	150
807	3300026035	Ga0207703_10964192	Ga0207703_109641922	150
808	3300026041	Ga0207639_10008165	Ga0207639_100081656	150
809	3300026041	Ga0207639_10010933	Ga0207639_100109333	150
810	3300026067	Ga0207678_10005081	Ga0207678_100050814	150
811	3300026075	Ga0207708_10018213	Ga0207708_100182132	150
812	3300026075	Ga0207708_10715581	Ga0207708_107155811	150
813	3300026078	Ga0207702_10003970	Ga0207702_100039707	150
814	3300026088	Ga0207641_10000468	Ga0207641_1000046832	150
815	3300026089	Ga0207648_10057846	Ga0207648_100578462	150
816	3300026089	Ga0207648_10341094	Ga0207648_103410941	150
817	3300026116	Ga0207674_10019995	Ga0207674_100199957	150
818	3300026116	Ga0207674_10059559	Ga0207674_100595593	150
819	3300026118	Ga0207675_100064021	Ga0207675_1000640212	150
820	3300026121	Ga0207683_10000048	Ga0207683_1000004874	150
821	3300026142	Ga0207698_10002688	Ga0207698_100026883	150
822	3300027252	Ga0209973_1013584	Ga0209973_10135841	150
823	3300027395	Ga0209996_1022112	Ga0209996_10221121	150
824	3300027526	Ga0209968_1047241	Ga0209968_10472411	150
825	3300027526	Ga0209968_1056923	Ga0209968_10569232	150
826	3300027552	Ga0209982_1014615	Ga0209982_10146153	150
827	3300027614	Ga0209970_1025559	Ga0209970_10255592	150
828	3300027617	Ga0210002_1000997	Ga0210002_10009973	150
829	3300027617	Ga0210002_1013919	Ga0210002_10139192	150
830	3300027665	Ga0209983_1031424	Ga0209983_10314242	150
831	3300027682	Ga0209971_1009281	Ga0209971_10092813	150
832	3300027695	Ga0209966_1002373	Ga0209966_10023732	150
833	3300027717	Ga0209998_10002648	Ga0209998_100026483	150
834	3300027866	Ga0209813_10092237	Ga0209813_100922371	150
835	3300027876	Ga0209974_10005215	Ga0209974_100052152	150
836	3300027907	Ga0207428_10000247	Ga0207428_100002476	150
837	3300027907	Ga0207428_10000287	Ga0207428_100002875	150
838	3300027907	Ga0207428_10000784	Ga0207428_100007848	150
839	3300027907	Ga0207428_10118980	Ga0207428_101189802	150
840	3300028379	Ga0268266_10568432	Ga0268266_105684321	150
841	3300028380	Ga0268265_10008060	Ga0268265_100080606	150
842	3300028381	Ga0268264_10005848	Ga0268264_100058483	150
843	3300032002	Ga0307416_101866918	Ga0307416_1018669181	150
844	3300032168	Ga0316593_10392570	Ga0316593_103925701	150
845	3300033541	Ga0316596_1159898	Ga0316596_11598981	150
846	3300034816	Ga0373930_0000140	Ga0373930_0000140_4736_5215	150
847	3300034817	Ga0373948_0001192	Ga0373948_0001192_251_730	150
848	3300034817	Ga0373948_0001283	Ga0373948_0001283_684_1163	150
849	3300034819	Ga0373958_0000497	Ga0373958_0000497_3838_4317	150
850	3300034819	Ga0373958_0007079	Ga0373958_0007079_153_632	150
851	3300034957	Ga0373938_0000282	Ga0373938_0000282_3953_4432	150
852	3300034957	Ga0373938_0007960	Ga0373938_0007960_645_1124	150
853	3300035084	Ga0373928_0012923	Ga0373928_0012923_381_860	150
854	3300035084	Ga0373928_0128860	Ga0373928_0128860_60_539	150
855	3300035085	Ga0373929_0001241	Ga0373929_0001241_708_1187	150
856	3300035088	Ga0373940_0000844	Ga0373940_0000844_4099_4578	150
857	3300035090	Ga0373949_0001347	Ga0373949_0001347_3790_4269	150
858	3300035091	Ga0373951_0002181	Ga0373951_0002181_2767_3246	150
859	3300035091	Ga0373951_0003150	Ga0373951_0003150_799_1278	150
860	3300035092	Ga0373952_0000008	Ga0373952_0000008_28617_29096	150
861	3300035112	Ga0373932_0000925	Ga0373932_0000925_4457_4936	150
862	3300035112	Ga0373932_0002073	Ga0373932_0002073_2144_2623	150
863	3300035114	Ga0373939_0002358	Ga0373939_0002358_3786_4265	150
864	3300035115	Ga0373941_0009266	Ga0373941_0009266_741_1220	150
865	3300035115	Ga0373941_0015316	Ga0373941_0015316_747_1226	150
866	3300035119	Ga0373956_0380344	Ga0373956_0380344_16_468	150
867	3300035121	Ga0373960_0000401	Ga0373960_0000401_4240_4719	150
868	3300035207	Ga0373942_0001070	Ga0373942_0001070_3576_4055	150
869	3300035241	Ga0373961_0003204	Ga0373961_0003204_2804_3283	150
870	3300035241	Ga0373961_0199286	Ga0373961_0199286_175_654	150
871	3300035242	Ga0373962_0087129	Ga0373962_0087129_99_578	150
872	3300035691	Ga0373931_0000174	Ga0373931_0000174_21773_22252	150
873	3300035691	Ga0373931_0331062	Ga0373931_0331062_218_697	150
874	3300035724	Ga0373933_0419413	Ga0373933_0419413_332_799	150
875	3300041408	Ga0439453_0000015	Ga0439453_0000015_9087_9551	150
876	3300042005	Ga0439448_0031086	Ga0439448_0031086_686_1165	150
877	3300042012	Ga0439455_0030214	Ga0439455_0030214_153_605	150
878	3300042157	Ga0439458_0055768	Ga0439458_0055768_206_658	150
879	3300042439	Ga0439464_0146730	Ga0439464_0146730_38_529	150
880	3300042461	Ga0439460_0010313	Ga0439460_0010313_95_559	150
881	3300042876	Ga0451577_0098393	Ga0451577_0098393_1987_2532	150
882	3300042993	Ga0439440_0036579	Ga0439440_0036579_613_1065	150
883	3300044842	Ga0466957_0406270	Ga0466957_0406270_222_716	150
884	3300045051	Ga0451576_0089285	Ga0451576_0089285_1975_2454	150
885	3300046491	Ga0495584_0076280	Ga0495584_0076280_411_890	150
886	3300046507	Ga0495606_0002692	Ga0495606_0002692_3133_3612	150
887	3300046512	Ga0495610_0074410	Ga0495610_0074410_406_885	150
888	3300046520	Ga0495637_0120404	Ga0495637_0120404_374_853	150
889	3300046538	Ga0495609_0128929	Ga0495609_0128929_234_713	150
890	3300046694	Ga0495649_0250569	Ga0495649_0250569_177_644	150
891	3300048903	Ga0496100_0006382	Ga0496100_0006382_1093_1572	150
892	3300048904	Ga0496101_0000317	Ga0496101_0000317_1544_2023	150
893	3300048905	Ga0496102_0010330	Ga0496102_0010330_796_1275	150
894	3300048905	Ga0496102_0250038	Ga0496102_0250038_131_610	150
895	3300048906	Ga0496103_0004965	Ga0496103_0004965_3767_4246	150
896	3300048909	Ga0496106_0003930	Ga0496106_0003930_6338_6817	150
897	3300048910	Ga0496107_0003258	Ga0496107_0003258_6553_7032	150
898	3300048910	Ga0496107_0120188	Ga0496107_0120188_802_1281	150
899	3300048911	Ga0496108_0044373	Ga0496108_0044373_3199_3678	150
900	3300048912	Ga0496109_0000686	Ga0496109_0000686_23705_24184	150
901	3300048913	Ga0496110_0010632	Ga0496110_0010632_492_971	150
902	3300048917	Ga0496114_0228964	Ga0496114_0228964_105_584	150
903	3300048918	Ga0496115_0008430	Ga0496115_0008430_3907_4386	150
904	3300049571	Ga0501034_0946777	Ga0501034_0946777_86_544	150
905	3300049578	Ga0501042_0563597	Ga0501042_0563597_21_476	150
906	3300049587	Ga0501071_0567859	Ga0501071_0567859_326_778	150
907	3300049590	Ga0501074_0750159	Ga0501074_0750159_168_620	150
908	3300049592	Ga0501076_0396336	Ga0501076_0396336_450_902	150
909	3300050494	nmdc:mga06z11_168596_c1	nmdc:mga06z11_168596_c1_122_601	150
910	3300050495	nmdc:mga04h51_511492_c1	nmdc:mga04h51_511492_c1_24_476	150
911	3300050496	nmdc:mga07m45_366613_c1	nmdc:mga07m45_366613_c1_54_521	150
912	3300050507	nmdc:mga05p37_69_c2	nmdc:mga05p37_69_c2_29469_29948	150
913	3300050508	nmdc:mga09592_1149540_c1	nmdc:mga09592_1149540_c1_92_556	150
914	3300050508	nmdc:mga09592_548_c1	nmdc:mga09592_548_c1_26690_27169	150
915	3300050509	nmdc:mga0qj67_6073_c1	nmdc:mga0qj67_6073_c1_3916_4395	150
916	3300050510	nmdc:mga06r32_468_c1	nmdc:mga06r32_468_c1_28880_29359	150
917	3300050511	nmdc:mga08y16_14578_c1	nmdc:mga08y16_14578_c1_4009_4488	150
918	3300050511	nmdc:mga08y16_146485_c1	nmdc:mga08y16_146485_c1_362_841	150
919	3300050511	nmdc:mga08y16_52826_c1	nmdc:mga08y16_52826_c1_60_539	150
920	3300050511	nmdc:mga08y16_624_c1	nmdc:mga08y16_624_c1_5803_6282	150
921	3300050512	nmdc:mga0n895_1034_c1	nmdc:mga0n895_1034_c1_4744_5223	150
922	3300050512	nmdc:mga0n895_44_c1	nmdc:mga0n895_44_c1_4493_4972	150
923	3300050513	nmdc:mga0rr50_8463_c2	nmdc:mga0rr50_8463_c2_1518_1997	150
924	3300050514	nmdc:mga08x19_185762_c1	nmdc:mga08x19_185762_c1_65_544	150
925	3300050515	nmdc:mga0a205_247_c1	nmdc:mga0a205_247_c1_4511_4990	150
926	3300050515	nmdc:mga0a205_29907_c1	nmdc:mga0a205_29907_c1_4184_4663	150
927	3300050515	nmdc:mga0a205_45994_c1	nmdc:mga0a205_45994_c1_2945_3424	150
928	3300053083	Ga0495655_0042235	Ga0495655_0042235_17_496	150
929	3300053090	Ga0500646_0095738	Ga0500646_0095738_316_783	150
930	3300053096	Ga0500641_0017132	Ga0500641_0017132_1960_2427	150
931	3300053142	Ga0500577_0277728	Ga0500577_0277728_216_683	150
932	3300053150	Ga0500603_044206	Ga0500603_044206_253_747	150
933	3300053727	Ga0500611_136251	Ga0500611_136251_124_591	150
934	3300054114	Ga0501084_0084977	Ga0501084_0084977_1082_1534	150
935	3300059492	Ga0587073_0213350	Ga0587073_0213350_14_466	150
936	3300059504	Ga0587082_104458	Ga0587082_104458_22_516	150
937	3300059644	Ga0587075_105839	Ga0587075_105839_22_489	150
938	3300059647	Ga0587079_157997	Ga0587079_157997_72_566	150
939	3300060344	Ga0587071_161744	Ga0587071_161744_51_530	150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

71

171

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4rzk-assembly1.cif.gz_B	crystal structure of sulfolobus solfataricus hsp20.1 acd	0.8042	33	123
5lum-assembly2.cif.gz_C	alpha-crystallin domain of human hspb6 patched with its n-terminal peptide	0.7943	44	123
3n3e-assembly1.cif.gz_B	zebrafish alphaa crystallin	0.7901	35	125
5zul-assembly1.cif.gz_A-2	small heat shock protein from mycobacterium marinum m : form-3	0.7885	33	121
5zul-assembly1.cif.gz_C-2	small heat shock protein from mycobacterium marinum m : form-3	0.7851	33	123

ID	Description	Score	Start	End	Superfamily
af_P0C054_33_137_2.60.40.790	Mainly Beta;Sandwich;Immunoglobulin-like;	0.8974	31	136	2.60.40.790
af_P0C054_33_137_2.60.40.790	Mainly Beta;Sandwich;Immunoglobulin-like;	0.8893	31	136	2.60.40.790
af_Q8S1F2_1_96_2.60.40.790	Mainly Beta;Sandwich;Immunoglobulin-like;	0.8826	33	122	2.60.40.790
4zj9A00	Mainly Beta;Sandwich;Immunoglobulin-like;	0.8376	33	121	2.60.40.790
af_C0PJF1_1_102_2.60.40.790	Mainly Beta;Sandwich;Immunoglobulin-like;	0.8363	33	125	2.60.40.790

ID	Description	Score	Start	End
AF-F3KHI5-F1-model_v4	16 kDa heat shock protein A	0.8698	41	138
AF-A0A2J7TK57-F1-model_v4	Heat-shock protein Hsp20	0.8377	28	126
AF-A0A355JRA8-F1-model_v4	deleted	0.8204	53	139
AF-A0A836NRI7-F1-model_v4	deleted	0.8193	27	140
AF-A0A355JRA8-F1-model_v4	deleted	0.812	53	139

Feature Viewer

pLDDT	pTM	Quality
73.07	0.6	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F486282

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00011

HSP20

Hsp20/alpha crystallin family

71

171

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map