F486283

General Info

Members Datasets Scaffolds Average Seq Length
939 458 1878 296

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10115790|Ga0157370_101157901
Length 302
Sequence MGRYKKKTIMTDRRLRIAVQKSGRLADRSGELISGAGLRILKGANELLYRIENQPIDLLRVRDDDIPTFVADGVAELGIVGYNVLAEHFPDRDLEEMIVQRLGFGSCTLKVAVPNDVDYTGPQWLEGKRIATSYPNILGKWLKDNGVTAEIVEMRGAVEVAPRMKIAHAICDLVSTGATLEANGMKATDLVLKSEAVLIKAPHAPPSELAHTYDMLLRRFDGVTASTGAKYVMMNAPKTHLDEIIRMIPGADAPTIMQLAGREDTVAVHAVCQENVFWDTLDKLKAAGASAILVLPIEKMMK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
91 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
92 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
93 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
94 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
190 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
279 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
280 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
287 2506520008 Serratia plymuthica AS12 Isolate Unclassified
288 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
289 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
290 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
291 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
292 2547132181 Kosakonia sacchari SP1 Isolate Stem
293 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
294 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
295 2561511199 Enterobacter sp. R4-368 Isolate Nodule
296 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
297 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
298 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
299 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
300 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
301 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
302 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
303 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
304 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
305 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
306 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
307 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
308 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
309 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
310 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
311 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
312 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
313 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
314 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
315 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
316 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
317 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
318 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
319 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
320 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
321 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
322 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
323 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
324 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
325 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
326 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
327 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
328 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
329 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
330 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
331 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
332 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
333 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
334 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
335 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
336 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
337 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
338 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
339 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
340 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
341 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
342 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
343 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
344 2636415599 Klebsiella variicola DX120E Isolate Unclassified
345 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
346 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
347 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
348 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
349 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
350 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
351 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
352 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
353 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
354 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
355 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
356 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
357 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
358 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
359 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
360 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
361 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
362 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
363 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
364 2751185917 Enterobacter sp. HK169 Isolate Unclassified
365 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
366 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
367 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
368 2775507074 Klebsiella sp. D5A Isolate Unclassified
369 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
370 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
371 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
372 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
373 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
374 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
375 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
376 2821118458 Enterobacter asburiae 609 Isolate Unclassified
377 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
378 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
379 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
380 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
381 2847085930 Erwinia persicina B64 Isolate Bulb
382 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
383 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
384 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
385 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
386 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
387 2865014394 Pantoea sp. R-71966 Isolate Unclassified
388 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
389 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
390 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
391 2876601092 Pantoea endophytica 596 Isolate Unclassified
392 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
393 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
394 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
395 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
396 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
397 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
398 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
399 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
400 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
401 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
402 2904504865 Serratia marcescens 1822 Isolate Unclassified
403 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
404 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
405 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
406 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
407 2919150387 Rahnella aceris 1817 Isolate Unclassified
408 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
409 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
410 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
411 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
412 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
413 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
414 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
415 2927143783 Rahnella sp. 2050 Isolate Unclassified
416 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
417 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
418 2932406140 Serratia sp. 2723 Isolate Rhizosphere
419 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
420 2937539931 Pantoea sp. LS15 Isolate Unclassified
421 2937967321 Serratia sp. YC16 Isolate Unclassified
422 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
423 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
424 2939577877 Serratia sp. 509 Isolate Rhizosphere
425 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
426 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
427 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
428 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
429 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
430 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
431 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
432 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
433 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
434 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
435 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
436 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
437 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
438 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
439 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
440 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
441 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
442 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
443 640753048 Serratia proteamaculans 568 Isolate Endosphere
444 8004592986 Serratia sp. S119 Isolate Unclassified
445 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
446 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
447 8018221730 Enterobacter sp. CM29 Isolate Unclassified
448 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
449 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
450 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
451 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
452 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
453 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
454 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
455 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
456 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
457 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
458 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.15
Metatranscriptomes 0.32
Isolates 18.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0.11
Endosphere 4.15
Nodule 2.13
Rhizoplane 7.14
Rhizosphere 66.99
Stem 0.11
Stem Tuber 0.64
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10115790 3300013104 Bacteria 2504
2 SwRhRL2b_contig_3798929 2162886007 Bacteria 5542
3 SwRhRL2b_contig_513557 2162886007 Bacteria 1650
4 JGI24740J21852_10023081 3300001979 Bacteria 2131
5 JGI24737J22298_10028251 3300001990 Bacteria 1764
6 JGI25162J39368_1000019 3300002737 Bacteria 262053
7 JGI25163J39215_1000121 3300002771 Bacteria 32543
8 JGI25164J39214_1000011 3300002772 Bacteria 262057
9 JGI25152J39213_1000139 3300002773 Bacteria 49588
10 rootH2_10014876 3300003320 Bacteria 26475
11 rootL2_10108836 3300003322 Bacteria 1086
12 rootH1_10208222 3300003323 Bacteria 2125
13 Ga0006562J51391_1018770 3300003578 Bacteria 6910
14 Ga0055538_1000021 3300003751 Bacteria 262057
15 Ga0055539_1000026 3300003752 Bacteria 262057
16 Ga0055533_1000035 3300003756 Bacteria 262057
17 Ga0055525_1000045 3300003759 Bacteria 262057
18 Ga0055536_1000238 3300003781 Bacteria 44092
19 Ga0055536_1032714 3300003781 Bacteria 1340
20 Ga0055541_1000020 3300003841 Bacteria 262057
21 Ga0058692_1000099 3300003856 Bacteria 57042
22 Ga0058692_1000261 3300003856 Bacteria 28622
23 Ga0058692_1000468 3300003856 Bacteria 18161
24 Ga0058692_1000698 3300003856 Bacteria 13787
25 Ga0058692_1001871 3300003856 Bacteria 7378
26 Ga0058692_1004106 3300003856 Bacteria 4371
27 Ga0058692_1005849 3300003856 Bacteria 3451
28 Ga0058692_1008705 3300003856 Bacteria 2605
29 Ga0058692_1009958 3300003856 Bacteria 2372
30 Ga0065703_1021842 3300005272 Bacteria 1086
31 Ga0065704_10000261 3300005289 Bacteria 53884
32 Ga0065704_10000708 3300005289 Bacteria 46350
33 Ga0065704_10003611 3300005289 Bacteria 6950
34 Ga0065704_10070657 3300005289 Bacteria 18234
35 Ga0065704_10216388 3300005289 Bacteria 1072
36 Ga0070658_10000013 3300005327 Bacteria 267776
37 Ga0070658_10028617 3300005327 Bacteria 4474
38 Ga0070658_10054019 3300005327 Bacteria 3261
39 Ga0070658_10203163 3300005327 Bacteria 1672
40 Ga0070683_100077457 3300005329 Bacteria 3109
41 Ga0070680_100000478 3300005336 Bacteria 27447
42 Ga0070660_100001747 3300005339 Bacteria 14895
43 Ga0070660_100017863 3300005339 Bacteria 5174
44 Ga0070660_100041749 3300005339 Bacteria 3497
45 Ga0070661_100001603 3300005344 Bacteria 15679
46 Ga0070661_100070963 3300005344 Bacteria 2562
47 Ga0070661_100101326 3300005344 Bacteria 2142
48 Ga0070692_10000649 3300005345 Bacteria 11041
49 Ga0070692_10030078 3300005345 Bacteria 2713
50 Ga0070668_100009419 3300005347 Bacteria 7245
51 Ga0070668_100249144 3300005347 Unclassified 1474
52 Ga0070675_100287179 3300005354 Bacteria 1447
53 Ga0070671_100006902 3300005355 Bacteria 9093
54 Ga0070671_100053006 3300005355 Bacteria 3372
55 Ga0070673_100167009 3300005364 Bacteria 1876
56 Ga0070659_100004808 3300005366 Bacteria 9654
57 Ga0070659_100062581 3300005366 Bacteria 2942
58 Ga0070659_100089858 3300005366 Bacteria 2461
59 Ga0070659_100305819 3300005366 Bacteria 1327
60 Ga0070667_100467219 3300005367 Bacteria 1154
61 Ga0070714_100103913 3300005435 Bacteria 2507
62 Ga0070714_100154029 3300005435 Bacteria 2074
63 Ga0070714_100188197 3300005435 Bacteria 1882
64 Ga0070713_100014588 3300005436 Bacteria 5843
65 Ga0070700_100088547 3300005441 Bacteria 2015
66 Ga0070663_100006997 3300005455 Bacteria 6831
67 Ga0070662_100012504 3300005457 Bacteria 5629
68 Ga0070662_100135774 3300005457 Bacteria 1902
69 Ga0070681_10015206 3300005458 Bacteria 7655
70 Ga0070679_100000007 3300005530 Bacteria 195373
71 Ga0070679_100103249 3300005530 Bacteria 2837
72 Ga0070684_100099249 3300005535 Bacteria 2598
73 Ga0070672_100220113 3300005543 Bacteria 1592
74 Ga0070686_100000138 3300005544 Bacteria 50075
75 Ga0070693_100243291 3300005547 Bacteria 1189
76 Ga0070665_100000075 3300005548 Bacteria 189496
77 Ga0070665_100000464 3300005548 Bacteria 58895
78 Ga0070665_100003847 3300005548 Bacteria 15889
79 Ga0070665_100230239 3300005548 Bacteria 1853
80 Ga0070665_100345473 3300005548 Unclassified 1493
81 Ga0070665_100593139 3300005548 Bacteria 1121
82 Ga0068855_100038568 3300005563 Bacteria 5676
83 Ga0068855_100172518 3300005563 Bacteria 2449
84 Ga0068857_100000207 3300005577 Bacteria 38345
85 Ga0068857_100004075 3300005577 Bacteria 12305
86 Ga0068857_100169541 3300005577 Bacteria 1984
87 Ga0068856_100008083 3300005614 Bacteria 10271
88 Ga0068856_100285568 3300005614 Bacteria 1667
89 Ga0068856_100630567 3300005614 Bacteria 1093
90 Ga0068856_100650749 3300005614 Bacteria 1074
91 Ga0068852_100003835 3300005616 Bacteria 10557
92 Ga0068852_100311461 3300005616 Bacteria 1526
93 Ga0068859_100002770 3300005617 Bacteria 17761
94 Ga0068859_100032361 3300005617 Bacteria 5254
95 Ga0068864_100115678 3300005618 Bacteria 2392
96 Ga0068863_100000122 3300005841 Bacteria 81534
97 Ga0068863_100023539 3300005841 Bacteria 5879
98 Ga0068863_100115542 3300005841 Bacteria 2557
99 Ga0068860_100018206 3300005843 Bacteria 6837
100 Ga0068860_100253458 3300005843 Bacteria 1714
101 Ga0068860_100409340 3300005843 Unclassified 1343
102 Ga0068862_100090529 3300005844 Bacteria 2663
103 Ga0068862_100103380 3300005844 Bacteria 2495
104 Ga0068862_100122166 3300005844 Bacteria 2296
105 Ga0081455_10026221 3300005937 Bacteria 5367
106 Ga0070717_10054160 3300006028 Bacteria 3308
107 Ga0075364_10004013 3300006051 Bacteria 8449
108 Ga0070716_100037943 3300006173 Bacteria 2665
109 Ga0075366_10052235 3300006195 Bacteria 2429
110 Ga0075430_100018405 3300006846 Bacteria 5944
111 Ga0075431_100499102 3300006847 Unclassified 1208
112 Ga0097620_100002770 3300006931 Bacteria 17761
113 Ga0097620_100032361 3300006931 Bacteria 5254
114 Ga0079104_1000018 3300006946 Bacteria 271088
115 Ga0079104_1000163 3300006946 Bacteria 94189
116 Ga0079104_1000282 3300006946 Bacteria 65218
117 Ga0079104_1000384 3300006946 Bacteria 51458
118 Ga0079104_1000391 3300006946 Bacteria 50839
119 Ga0079104_1001061 3300006946 Bacteria 20757
120 Ga0079104_1005390 3300006946 Bacteria 5124
121 Ga0079104_1006102 3300006946 Bacteria 4651
122 Ga0105251_10000141 3300009011 Bacteria 73581
123 Ga0105251_10000349 3300009011 Bacteria 45894
124 Ga0105251_10000471 3300009011 Bacteria 38348
125 Ga0105251_10001340 3300009011 Bacteria 21259
126 Ga0105251_10002019 3300009011 Bacteria 16478
127 Ga0105251_10004707 3300009011 Bacteria 9168
128 Ga0105251_10006665 3300009011 Bacteria 7300
129 Ga0105251_10010251 3300009011 Bacteria 5454
130 Ga0105251_10022944 3300009011 Bacteria 3230
131 Ga0105251_10053068 3300009011 Bacteria 1928
132 Ga0105251_10091942 3300009011 Bacteria 1393
133 Ga0105251_10196047 3300009011 Bacteria 910
134 Ga0105244_10000009 3300009036 Bacteria 286143
135 Ga0105244_10000123 3300009036 Bacteria 79547
136 Ga0105244_10000347 3300009036 Bacteria 43582
137 Ga0105244_10000636 3300009036 Bacteria 30959
138 Ga0105244_10000818 3300009036 Bacteria 26304
139 Ga0105244_10002573 3300009036 Bacteria 13616
140 Ga0105244_10003693 3300009036 Bacteria 10816
141 Ga0105244_10005634 3300009036 Bacteria 8274
142 Ga0105244_10007967 3300009036 Bacteria 6670
143 Ga0105244_10024207 3300009036 Bacteria 3315
144 Ga0105244_10041144 3300009036 Bacteria 2396
145 Ga0105244_10049734 3300009036 Bacteria 2140
146 Ga0105250_10000002 3300009092 Bacteria 566949
147 Ga0105250_10000100 3300009092 Bacteria 77155
148 Ga0105250_10000601 3300009092 Bacteria 23494
149 Ga0105250_10001115 3300009092 Bacteria 15152
150 Ga0105250_10001849 3300009092 Bacteria 11037
151 Ga0105250_10002145 3300009092 Bacteria 10129
152 Ga0105250_10008211 3300009092 Bacteria 4445
153 Ga0105240_10009039 3300009093 Bacteria 14150
154 Ga0105240_10188986 3300009093 Bacteria 2423
155 Ga0105240_10203458 3300009093 Bacteria 2319
156 Ga0105245_10099199 3300009098 Bacteria 2692
157 Ga0105247_10000025 3300009101 Bacteria 208459
158 Ga0105243_10033993 3300009148 Bacteria 3945
159 Ga0105241_10000005 3300009174 Bacteria 384203
160 Ga0105248_10691697 3300009177 Bacteria 1150
161 Ga0105237_10497238 3300009545 Bacteria 1226
162 Ga0105238_10081994 3300009551 Bacteria 3215
163 Ga0105249_10082479 3300009553 Bacteria 2991
164 Ga0105239_10668242 3300010375 Bacteria 1187
165 Ga0105246_10039694 3300011119 Bacteria 3173
166 Ga0157373_10000110 3300013100 Bacteria 64710
167 Ga0157373_10048988 3300013100 Bacteria 3012
168 Ga0157373_10068289 3300013100 Bacteria 2512
169 Ga0157373_10148992 3300013100 Bacteria 1646
170 Ga0157371_10000098 3300013102 Bacteria 134017
171 Ga0157371_10000673 3300013102 Bacteria 40561
172 Ga0157371_10002717 3300013102 Bacteria 16693
173 Ga0157371_10003439 3300013102 Bacteria 14361
174 Ga0157371_10005924 3300013102 Bacteria 10208
175 Ga0157371_10006411 3300013102 Bacteria 9716
176 Ga0157371_10007406 3300013102 Bacteria 8893
177 Ga0157371_10012018 3300013102 Bacteria 6638
178 Ga0157371_10059481 3300013102 Bacteria 2708
179 Ga0157371_10081337 3300013102 Bacteria 2294
180 Ga0157370_10000445 3300013104 Bacteria 51701
181 Ga0157370_10000707 3300013104 Bacteria 41767
182 Ga0157370_10005108 3300013104 Bacteria 14804
183 Ga0157370_10016493 3300013104 Bacteria 7475
184 Ga0157370_10181254 3300013104 Bacteria 1957
185 Ga0157370_10181396 3300013104 Bacteria 1956
186 Ga0157369_10000988 3300013105 Bacteria 35979
187 Ga0157369_10006229 3300013105 Bacteria 13845
188 Ga0157369_10019715 3300013105 Bacteria 7546
189 Ga0157369_10077912 3300013105 Bacteria 3552
190 Ga0157369_10124326 3300013105 Bacteria 2736
191 Ga0157369_10249797 3300013105 Bacteria 1851
192 Ga0157369_10300009 3300013105 Bacteria 1671
193 Ga0157378_10391212 3300013297 Bacteria 1367
194 Ga0163162_10072654 3300013306 Bacteria 3495
195 Ga0157372_10054735 3300013307 Bacteria 4453
196 Ga0157372_10055595 3300013307 Bacteria 4420
197 Ga0157372_10072400 3300013307 Bacteria 3884
198 Ga0157372_10091434 3300013307 Bacteria 3461
199 Ga0157372_10126381 3300013307 Bacteria 2940
200 Ga0157372_10254223 3300013307 Bacteria 2040
201 Ga0157372_10357124 3300013307 Bacteria 1702
202 Ga0157375_10572828 3300013308 Bacteria 1290
203 Ga0163163_10007998 3300014325 Bacteria 9357
204 Ga0182008_10022168 3300014497 Bacteria 3253
205 Ga0182008_10036789 3300014497 Bacteria 2449
206 Ga0157377_10133047 3300014745 Bacteria 1521
207 Ga0182006_1000018 3300015261 Bacteria 299376
208 Ga0182006_1030626 3300015261 Bacteria 2173
209 Ga0182007_10017056 3300015262 Bacteria 2662
210 Ga0183366_1001 3300015679 Bacteria 2743932
211 Ga0183370_1001 3300015680 Bacteria 2743932
212 Ga0183365_10001 3300015684 Bacteria 2090444
213 Ga0183369_1001 3300015685 Bacteria 2743932
214 Ga0183368_1001 3300015687 Bacteria 2743932
215 Ga0163161_10000001 3300017792 Bacteria 2041488
216 Ga0163161_10084750 3300017792 Bacteria 2337
217 Ga0206353_11324343 3300020082 Bacteria 7984
218 Ga0213873_10000006 3300021358 Bacteria 408723
219 Ga0213872_10008462 3300021361 Bacteria 4979
220 Ga0213872_10077011 3300021361 Bacteria 1500
221 Ga0213876_10000004 3300021384 Bacteria 943822
222 Ga0213876_10000034 3300021384 Bacteria 202967
223 Ga0213876_10004247 3300021384 Bacteria 8038
224 Ga0213876_10016435 3300021384 Bacteria 3911
225 Ga0213876_10058546 3300021384 Bacteria 2034
226 Ga0209760_100004 3300025207 Bacteria 254650
227 Ga0209784_100001 3300025224 Bacteria 3600592
228 Ga0209566_100001 3300025225 Bacteria 3600765
229 Ga0209674_100002 3300025226 Bacteria 3600592
230 Ga0209563_100002 3300025230 Bacteria 2045675
231 Ga0207427_100012 3300025231 Bacteria 585657
232 Ga0209437_100001 3300025233 Bacteria 2045675
233 Ga0209437_100238 3300025233 Bacteria 90380
234 Ga0209677_100002 3300025253 Bacteria 2045675
235 Ga0209129_1000077 3300025258 Bacteria 193474
236 Ga0209233_1012128 3300025261 Bacteria 2511
237 Ga0209676_1000252 3300025292 Bacteria 113425
238 Ga0209676_1004310 3300025292 Bacteria 8011
239 Ga0209050_1003880 3300025298 Bacteria 10623
240 Ga0209257_1000060 3300025304 Bacteria 372267
241 Ga0207696_1000001 3300025711 Bacteria 2579611
242 Ga0207696_1000013 3300025711 Bacteria 524881
243 Ga0207696_1000021 3300025711 Bacteria 432606
244 Ga0207696_1000053 3300025711 Bacteria 268590
245 Ga0207696_1000058 3300025711 Bacteria 248495
246 Ga0207696_1001994 3300025711 Bacteria 10346
247 Ga0207696_1002267 3300025711 Bacteria 9563
248 Ga0207696_1003430 3300025711 Bacteria 7230
249 Ga0207696_1003689 3300025711 Bacteria 6878
250 Ga0207696_1003913 3300025711 Bacteria 6567
251 Ga0207655_1000002 3300025728 Bacteria 1148694
252 Ga0207655_1000004 3300025728 Bacteria 1021221
253 Ga0207655_1000007 3300025728 Bacteria 773492
254 Ga0207655_1000036 3300025728 Bacteria 356747
255 Ga0207655_1000447 3300025728 Bacteria 54492
256 Ga0207655_1000604 3300025728 Bacteria 43480
257 Ga0207655_1000642 3300025728 Bacteria 41825
258 Ga0207655_1000829 3300025728 Bacteria 33362
259 Ga0207655_1003843 3300025728 Bacteria 10935
260 Ga0207655_1007692 3300025728 Bacteria 6955
261 Ga0207655_1010282 3300025728 Bacteria 5684
262 Ga0207655_1028073 3300025728 Bacteria 2662
263 Ga0207655_1081764 3300025728 Bacteria 1163
264 Ga0207713_1000001 3300025735 Bacteria 2295391
265 Ga0207713_1000012 3300025735 Bacteria 501860
266 Ga0207713_1000015 3300025735 Bacteria 424741
267 Ga0207713_1000092 3300025735 Bacteria 148309
268 Ga0207713_1000132 3300025735 Bacteria 113216
269 Ga0207713_1000142 3300025735 Bacteria 107313
270 Ga0207713_1000383 3300025735 Bacteria 47969
271 Ga0207713_1010431 3300025735 Bacteria 5139
272 Ga0207713_1012963 3300025735 Bacteria 4425
273 Ga0207713_1018658 3300025735 Bacteria 3427
274 Ga0207713_1023685 3300025735 Bacteria 2883
275 Ga0207713_1032191 3300025735 Bacteria 2306
276 Ga0207713_1100090 3300025735 Bacteria 1002
277 Ga0207710_10000150 3300025900 Bacteria 79270
278 Ga0207688_10067675 3300025901 Bacteria 2021
279 Ga0207680_10204119 3300025903 Bacteria 1348
280 Ga0207647_10007732 3300025904 Bacteria 7739
281 Ga0207647_10010023 3300025904 Bacteria 6709
282 Ga0207705_10000002 3300025909 Bacteria 2046852
283 Ga0207705_10000003 3300025909 Bacteria 709270
284 Ga0207705_10032612 3300025909 Bacteria 3723
285 Ga0207705_10310592 3300025909 Bacteria 1210
286 Ga0207654_10000007 3300025911 Bacteria 384211
287 Ga0207707_10027457 3300025912 Bacteria 4978
288 Ga0207695_10010391 3300025913 Bacteria 11391
289 Ga0207695_10016024 3300025913 Bacteria 8797
290 Ga0207695_10235004 3300025913 Bacteria 1736
291 Ga0207671_10320448 3300025914 Bacteria 1226
292 Ga0207660_10000536 3300025917 Bacteria 25438
293 Ga0207657_10004480 3300025919 Bacteria 14767
294 Ga0207657_10023582 3300025919 Bacteria 5726
295 Ga0207657_10027500 3300025919 Bacteria 5208
296 Ga0207649_10000329 3300025920 Bacteria 35885
297 Ga0207649_10001485 3300025920 Bacteria 13767
298 Ga0207649_10018803 3300025920 Bacteria 3939
299 Ga0207652_10000001 3300025921 Bacteria 1006643
300 Ga0207652_10000002 3300025921 Bacteria 878035
301 Ga0207681_10054989 3300025923 Bacteria 2709
302 Ga0207694_10050905 3300025924 Bacteria 3210
303 Ga0207659_10028215 3300025926 Bacteria 3812
304 Ga0207664_10168119 3300025929 Bacteria 1875
305 Ga0207644_10000299 3300025931 Bacteria 32238
306 Ga0207644_10000833 3300025931 Bacteria 19607
307 Ga0207644_10022554 3300025931 Bacteria 4302
308 Ga0207690_10005730 3300025932 Bacteria 7339
309 Ga0207690_10009302 3300025932 Bacteria 5838
310 Ga0207690_10025124 3300025932 Bacteria 3736
311 Ga0207690_10051399 3300025932 Bacteria 2756
312 Ga0207706_10006757 3300025933 Bacteria 10606
313 Ga0207706_10124010 3300025933 Bacteria 2272
314 Ga0207706_10273573 3300025933 Bacteria 1474
315 Ga0207709_10005891 3300025935 Bacteria 6918
316 Ga0207669_10008692 3300025937 Bacteria 4784
317 Ga0207691_10087794 3300025940 Bacteria 2789
318 Ga0207691_10221782 3300025940 Bacteria 1639
319 Ga0207711_10112771 3300025941 Bacteria 2420
320 Ga0207661_10021552 3300025944 Bacteria 4829
321 Ga0207667_10013015 3300025949 Bacteria 9550
322 Ga0207667_10015306 3300025949 Bacteria 8721
323 Ga0207651_10319221 3300025960 Bacteria 1298
324 Ga0207651_10465115 3300025960 Bacteria 1087
325 Ga0207668_10000082 3300025972 Bacteria 71860
326 Ga0207668_10082088 3300025972 Bacteria 2340
327 Ga0207668_10238423 3300025972 Unclassified 1470
328 Ga0207640_10000838 3300025981 Bacteria 17511
329 Ga0207640_10059204 3300025981 Bacteria 2527
330 Ga0207639_10043827 3300026041 Bacteria 3361
331 Ga0207639_10073093 3300026041 Bacteria 2687
332 Ga0207639_10112571 3300026041 Bacteria 2221
333 Ga0207678_10004283 3300026067 Bacteria 12797
334 Ga0207678_10029828 3300026067 Bacteria 4762
335 Ga0207678_10213377 3300026067 Bacteria 1651
336 Ga0207708_10072486 3300026075 Bacteria 2639
337 Ga0207702_10031878 3300026078 Bacteria 4396
338 Ga0207702_10075148 3300026078 Bacteria 2918
339 Ga0207702_10143550 3300026078 Bacteria 2163
340 Ga0207641_10000001 3300026088 Bacteria 1180841
341 Ga0207641_10011857 3300026088 Bacteria 7154
342 Ga0207676_10018047 3300026095 Bacteria 5122
343 Ga0207674_10000132 3300026116 Bacteria 87692
344 Ga0207674_10007565 3300026116 Bacteria 12655
345 Ga0207698_10015058 3300026142 Bacteria 5166
346 Ga0207698_10177272 3300026142 Bacteria 1884
347 Ga0209281_1000004 3300027111 Bacteria 1253949
348 Ga0209281_1000006 3300027111 Bacteria 1170244
349 Ga0209281_1000014 3300027111 Bacteria 643021
350 Ga0209281_1000027 3300027111 Bacteria 463409
351 Ga0209281_1000064 3300027111 Bacteria 287876
352 Ga0209281_1000071 3300027111 Bacteria 274050
353 Ga0209281_1000257 3300027111 Bacteria 103090
354 Ga0209281_1000370 3300027111 Bacteria 72879
355 Ga0209281_1000714 3300027111 Bacteria 33175
356 Ga0209281_1001392 3300027111 Bacteria 14777
357 Ga0209281_1004837 3300027111 Bacteria 3910
358 Ga0209371_1000001 3300027312 Bacteria 2771503
359 Ga0209371_1000002 3300027312 Bacteria 1551985
360 Ga0209371_1000005 3300027312 Bacteria 1061740
361 Ga0209371_1000015 3300027312 Bacteria 659640
362 Ga0209371_1000099 3300027312 Bacteria 154918
363 Ga0209371_1000100 3300027312 Bacteria 154467
364 Ga0209371_1000120 3300027312 Bacteria 132938
365 Ga0209371_1000731 3300027312 Bacteria 27606
366 Ga0209371_1000778 3300027312 Bacteria 26405
367 Ga0209371_1000964 3300027312 Bacteria 22330
368 Ga0209371_1001841 3300027312 Bacteria 13120
369 Ga0209371_1002061 3300027312 Bacteria 11984
370 Ga0209371_1003104 3300027312 Bacteria 8471
371 Ga0209371_1003934 3300027312 Bacteria 6816
372 Ga0209371_1007662 3300027312 Bacteria 3720
373 Ga0209371_1009080 3300027312 Bacteria 3201
374 Ga0268266_10000103 3300028379 Bacteria 179736
375 Ga0268266_10000286 3300028379 Bacteria 83269
376 Ga0268266_10000514 3300028379 Bacteria 54510
377 Ga0268266_10195106 3300028379 Bacteria 1850
378 Ga0268265_10119029 3300028380 Bacteria 2172
379 Ga0268264_10010903 3300028381 Bacteria 7509
380 Ga0268264_10012883 3300028381 Bacteria 6879
381 Ga0268256_1000001 3300030500 Bacteria 2771065
382 Ga0268256_1000002 3300030500 Bacteria 1535763
383 Ga0268256_1000006 3300030500 Bacteria 1063991
384 Ga0268256_1000018 3300030500 Bacteria 594572
385 Ga0268256_1000035 3300030500 Bacteria 384794
386 Ga0268256_1000089 3300030500 Bacteria 154491
387 Ga0268256_1000423 3300030500 Bacteria 38191
388 Ga0268256_1000714 3300030500 Bacteria 24660
389 Ga0268256_1000873 3300030500 Bacteria 21021
390 Ga0268256_1001822 3300030500 Bacteria 11984
391 Ga0268256_1003781 3300030500 Bacteria 6623
392 Ga0268256_1004445 3300030500 Bacteria 5810
393 Ga0268256_1005198 3300030500 Bacteria 5168
394 Ga0265327_10016858 3300031251 Bacteria 4616
395 Ga0307408_100001207 3300031548 Bacteria 19481
396 Ga0307405_10001717 3300031731 Bacteria 9351
397 Ga0307413_10000666 3300031824 Bacteria 11694
398 Ga0307413_10177276 3300031824 Bacteria 1515
399 Ga0307410_10002549 3300031852 Bacteria 8824
400 Ga0307410_10159736 3300031852 Bacteria 1687
401 Ga0307410_10177615 3300031852 Bacteria 1609
402 Ga0307410_10205837 3300031852 Bacteria 1505
403 Ga0307406_10001991 3300031901 Bacteria 11165
404 Ga0307406_10003346 3300031901 Bacteria 8737
405 Ga0307406_10296136 3300031901 Bacteria 1241
406 Ga0307407_10000195 3300031903 Bacteria 18328
407 Ga0307412_10002981 3300031911 Bacteria 9387
408 Ga0307412_10081574 3300031911 Bacteria 2237
409 Ga0307412_10343388 3300031911 Bacteria 1196
410 Ga0307409_100026891 3300031995 Bacteria 4066
411 Ga0307409_100082730 3300031995 Bacteria 2600
412 Ga0307409_100370035 3300031995 Bacteria 1359
413 Ga0307416_100001750 3300032002 Bacteria 12019
414 Ga0307414_10001053 3300032004 Bacteria 14103
415 Ga0307414_10003789 3300032004 Bacteria 8126
416 Ga0307414_10005946 3300032004 Bacteria 6758
417 Ga0307414_10037640 3300032004 Bacteria 3242
418 Ga0307414_10076705 3300032004 Bacteria 2429
419 Ga0307414_10235849 3300032004 Bacteria 1511
420 Ga0307414_10238395 3300032004 Bacteria 1504
421 Ga0307414_10356926 3300032004 Bacteria 1256
422 Ga0307411_10000206 3300032005 Bacteria 18997
423 Ga0307411_10002634 3300032005 Bacteria 8032
424 Ga0307411_10030860 3300032005 Bacteria 3290
425 Ga0307411_10193156 3300032005 Bacteria 1556
426 Ga0307411_10263980 3300032005 Bacteria 1361
427 Ga0307415_100008908 3300032126 Bacteria 5590
428 Ga0307415_100089979 3300032126 Bacteria 2219
429 Ga0316593_10041632 3300032168 Bacteria 1529
430 Ga0395899_0000184 3300037312 Bacteria 91815
431 Ga0395899_0000264 3300037312 Bacteria 68569
432 Ga0395899_0008407 3300037312 Bacteria 7946
433 Ga0395899_0033067 3300037312 Bacteria 3885
434 Ga0395899_0050095 3300037312 Bacteria 3102
435 Ga0395899_0080052 3300037312 Bacteria 2378
436 Ga0395899_0089388 3300037312 Bacteria 2234
437 Ga0395899_0100835 3300037312 Bacteria 2084
438 Ga0395899_0188198 3300037312 Bacteria 1445
439 Ga0395899_0240342 3300037312 Bacteria 1247
440 Ga0395900_0000723 3300037418 Bacteria 43948
441 Ga0395900_0003562 3300037418 Bacteria 16749
442 Ga0395900_0015186 3300037418 Bacteria 7852
443 Ga0395900_0015753 3300037418 Bacteria 7707
444 Ga0395900_0016216 3300037418 Bacteria 7590
445 Ga0395900_0018901 3300037418 Bacteria 7028
446 Ga0395900_0023262 3300037418 Bacteria 6342
447 Ga0395900_0036036 3300037418 Bacteria 5098
448 Ga0395900_0063713 3300037418 Bacteria 3789
449 Ga0395900_0143855 3300037418 Bacteria 2440
450 Ga0395900_0167208 3300037418 Bacteria 2241
451 Ga0395900_0248444 3300037418 Bacteria 1781
452 Ga0395900_0259066 3300037418 Bacteria 1738
453 Ga0395900_0489788 3300037418 Bacteria 1181
454 Ga0395900_0493594 3300037418 Bacteria 1175
455 Ga0395900_0540726 3300037418 Bacteria 1111
456 Ga0395898_0000087 3300037466 Bacteria 239211
457 Ga0395898_0004020 3300037466 Bacteria 16164
458 Ga0395898_0011911 3300037466 Bacteria 9007
459 Ga0395898_0018469 3300037466 Bacteria 7110
460 Ga0395898_0101522 3300037466 Bacteria 2762
461 Ga0395898_0106782 3300037466 Bacteria 2685
462 Ga0395898_0144648 3300037466 Unclassified 2276
463 Ga0395898_0170038 3300037466 Bacteria 2083
464 Ga0395898_0418492 3300037466 Bacteria 1277
465 Ga0395905_0000005 3300037471 Bacteria 557808
466 Ga0395905_0000070 3300037471 Bacteria 175662
467 Ga0395905_0002000 3300037471 Bacteria 23293
468 Ga0395905_0002910 3300037471 Bacteria 18678
469 Ga0395905_0005131 3300037471 Bacteria 13445
470 Ga0395905_0006920 3300037471 Bacteria 11334
471 Ga0395905_0017740 3300037471 Bacteria 6758
472 Ga0395905_0020118 3300037471 Bacteria 6324
473 Ga0395905_0022485 3300037471 Bacteria 5963
474 Ga0395905_0036963 3300037471 Bacteria 4587
475 Ga0395905_0040140 3300037471 Bacteria 4390
476 Ga0395905_0051191 3300037471 Bacteria 3868
477 Ga0395905_0069944 3300037471 Bacteria 3288
478 Ga0395905_0102146 3300037471 Bacteria 2691
479 Ga0395905_0346261 3300037471 Bacteria 1378
480 Ga0395905_0488463 3300037471 Bacteria 1131
481 Ga0395901_0001808 3300038443 Bacteria 22093
482 Ga0395901_0004038 3300038443 Bacteria 14781
483 Ga0395901_0015103 3300038443 Bacteria 7852
484 Ga0395901_0015235 3300038443 Bacteria 7823
485 Ga0395901_0024583 3300038443 Bacteria 6185
486 Ga0395901_0035231 3300038443 Bacteria 5171
487 Ga0395901_0036907 3300038443 Bacteria 5053
488 Ga0395901_0039387 3300038443 Bacteria 4890
489 Ga0395901_0081178 3300038443 Bacteria 3387
490 Ga0395901_0113760 3300038443 Bacteria 2842
491 Ga0395901_0162518 3300038443 Bacteria 2345
492 Ga0395901_0205851 3300038443 Bacteria 2061
493 Ga0395901_0430976 3300038443 Bacteria 1351
494 Ga0395901_0642065 3300038443 Bacteria 1066
495 Ga0400483_152581 3300039062 Bacteria 13902
496 Ga0436365_0674409 3300039437 Bacteria 5482
497 Ga0436365_0689373 3300039437 Bacteria 73333
498 Ga0436365_0965775 3300039437 Bacteria 470291
499 Ga0436365_0970858 3300039437 Bacteria 175279
500 Ga0436365_1116037 3300039437 Bacteria 5188
501 Ga0436365_1186688 3300039437 Bacteria 17067
502 Ga0436361_0292016 3300039447 Bacteria 6241
503 Ga0436361_0340720 3300039447 Bacteria 2892
504 Ga0436362_0554113 3300039453 Bacteria 162652
505 Ga0436362_1252872 3300039453 Bacteria 1274
506 Ga0439438_000002 3300041405 Bacteria 618223
507 Ga0439438_003831 3300041405 Bacteria 5935
508 Ga0439438_031555 3300041405 Bacteria 1407
509 Ga0439447_008214 3300041407 Bacteria 3248
510 Ga0439447_008992 3300041407 Bacteria 3059
511 Ga0439466_0000001 3300041411 Bacteria 647258
512 Ga0439445_0000014 3300042004 Bacteria 23823
513 Ga0439432_009149 3300042006 Bacteria 3460
514 Ga0439432_011912 3300042006 Bacteria 2988
515 Ga0439432_013062 3300042006 Bacteria 2830
516 Ga0439452_000001 3300042010 Bacteria 1725439
517 Ga0439452_000002 3300042010 Bacteria 1377577
518 Ga0439452_000020 3300042010 Bacteria 309345
519 Ga0439452_000031 3300042010 Bacteria 196691
520 Ga0439462_0053521 3300042015 Bacteria 1087
521 Ga0439463_008381 3300042016 Bacteria 2549
522 Ga0450912_000309 3300042116 Bacteria 2236
523 Ga0450923_017616 3300042125 Bacteria 1358
524 Ga0450907_000295 3300042146 Bacteria 16845
525 Ga0439446_0051763 3300042156 Bacteria 1228
526 Ga0439458_0000243 3300042157 Bacteria 13137
527 Ga0439458_0001940 3300042157 Bacteria 5130
528 Ga0439464_0003158 3300042439 Bacteria 4132
529 Ga0451577_0019045 3300042876 Bacteria 6318
530 Ga0466969_0000781 3300044656 Bacteria 17373
531 Ga0466969_0028998 3300044656 Bacteria 2828
532 Ga0466981_0000003 3300044669 Bacteria 248458
533 Ga0466966_0000039 3300044684 Bacteria 97202
534 Ga0466966_0000173 3300044684 Bacteria 42521
535 Ga0466966_0000802 3300044684 Bacteria 19991
536 Ga0466966_0000939 3300044684 Bacteria 18614
537 Ga0466966_0058404 3300044684 Bacteria 2438
538 Ga0466961_0000530 3300044693 Bacteria 24196
539 Ga0466961_0001878 3300044693 Bacteria 13060
540 Ga0466961_0039489 3300044693 Bacteria 3026
541 Ga0466961_0076757 3300044693 Bacteria 2117
542 Ga0466961_0079904 3300044693 Bacteria 2070
543 Ga0466961_0085520 3300044693 Bacteria 1994
544 Ga0466963_0012559 3300044694 Bacteria 5188
545 Ga0466963_0025445 3300044694 Bacteria 3775
546 Ga0466964_0194880 3300044706 Bacteria 969
547 Ga0466971_0000414 3300044719 Bacteria 16681
548 Ga0466968_0016031 3300044735 Bacteria 2978
549 Ga0466970_0000836 3300044765 Bacteria 14806
550 Ga0466970_0016422 3300044765 Bacteria 3817
551 Ga0466957_0001326 3300044842 Bacteria 12924
552 Ga0466957_0009306 3300044842 Bacteria 5605
553 Ga0466957_0036436 3300044842 Bacteria 2957
554 Ga0466957_0063314 3300044842 Bacteria 2273
555 Ga0466957_0193361 3300044842 Bacteria 1334
556 Ga0466959_0000108 3300045049 Bacteria 53075
557 Ga0466959_0008432 3300045049 Bacteria 7288
558 Ga0466959_0013571 3300045049 Bacteria 5907
559 Ga0466959_0096742 3300045049 Bacteria 2116
560 Ga0466959_0155022 3300045049 Bacteria 1612
561 Ga0466958_0001249 3300045836 Bacteria 11903
562 Ga0466958_0001949 3300045836 Bacteria 10125
563 Ga0466958_0022630 3300045836 Bacteria 3684
564 Ga0466958_0026893 3300045836 Bacteria 3401
565 Ga0466967_0044572 3300045976 Bacteria 3848
566 Ga0466967_0201029 3300045976 Bacteria 1887
567 Ga0466967_0336944 3300045976 Bacteria 1458
568 Ga0466967_0510636 3300045976 Bacteria 1180
569 Ga0495617_066763 3300046452 Bacteria 1185
570 Ga0495627_000018 3300046453 Bacteria 315125
571 Ga0495591_000050 3300046458 Bacteria 137772
572 Ga0495591_000059 3300046458 Bacteria 130522
573 Ga0495638_0021694 3300046460 Bacteria 4225
574 Ga0495650_0000031 3300046471 Bacteria 433811
575 Ga0495650_0000047 3300046471 Bacteria 335136
576 Ga0495650_0000182 3300046471 Bacteria 137031
577 Ga0495605_0016907 3300046474 Bacteria 3940
578 Ga0495585_0004843 3300046492 Bacteria 8641
579 Ga0495596_0013908 3300046500 Bacteria 3399
580 Ga0495607_0045969 3300046501 Bacteria 2566
581 Ga0495606_0003900 3300046507 Bacteria 15370
582 Ga0495616_0034318 3300046513 Bacteria 2636
583 Ga0495620_0009743 3300046515 Bacteria 5099
584 Ga0495637_0085427 3300046520 Bacteria 1252
585 Ga0495643_0017719 3300046522 Bacteria 4157
586 Ga0495644_0012461 3300046523 Bacteria 3269
587 Ga0495648_0001866 3300046524 Bacteria 20143
588 Ga0495648_0015572 3300046524 Bacteria 5516
589 Ga0495654_0000009 3300046530 Bacteria 381872
590 Ga0495654_0000068 3300046530 Bacteria 125533
591 Ga0495654_0000596 3300046530 Bacteria 28899
592 Ga0495598_0006796 3300046537 Bacteria 2597
593 Ga0495621_0000983 3300046539 Bacteria 7289
594 Ga0495597_0002098 3300046542 Bacteria 13248
595 Ga0495633_0000162 3300046558 Bacteria 87434
596 Ga0495633_0010150 3300046558 Bacteria 5156
597 Ga0495625_0003714 3300046660 Bacteria 14888
598 Ga0495625_0049949 3300046660 Bacteria 3004
599 Ga0495588_0047665 3300046674 Bacteria 2200
600 Ga0495670_0015196 3300046691 Bacteria 3786
601 Ga0495649_0000165 3300046694 Bacteria 57643
602 Ga0495649_0004029 3300046694 Bacteria 9675
603 Ga0495649_0004333 3300046694 Bacteria 9308
604 Ga0495649_0007728 3300046694 Bacteria 6529
605 Ga0495589_0000002 3300046794 Bacteria 758846
606 Ga0495660_0000004 3300046810 Bacteria 1003183
607 Ga0495660_0000015 3300046810 Bacteria 324892
608 Ga0495660_0045452 3300046810 Bacteria 2410
609 Ga0495672_0000001 3300047320 Bacteria 1458820
610 Ga0495672_0000009 3300047320 Bacteria 557755
611 Ga0495672_0000015 3300047320 Bacteria 502855
612 Ga0495676_0276541 3300047321 Bacteria 1138
613 Ga0495679_000309 3300047446 Bacteria 39033
614 Ga0495679_003403 3300047446 Bacteria 7665
615 Ga0495679_006075 3300047446 Bacteria 5267
616 Ga0495673_0000007 3300047469 Bacteria 796722
617 Ga0495673_0000019 3300047469 Bacteria 554389
618 Ga0496100_0002186 3300048903 Bacteria 9870
619 Ga0496101_0000157 3300048904 Bacteria 57989
620 Ga0496102_0017189 3300048905 Bacteria 6334
621 Ga0496104_0000158 3300048907 Bacteria 61536
622 Ga0496104_0002904 3300048907 Bacteria 14766
623 Ga0496105_0005660 3300048908 Bacteria 9509
624 Ga0496105_0096668 3300048908 Bacteria 2439
625 Ga0496109_0035306 3300048912 Bacteria 4509
626 Ga0496110_0110046 3300048913 Bacteria 2475
627 Ga0496112_0123313 3300048915 Bacteria 2562
628 Ga0496113_0083843 3300048916 Bacteria 2446
629 Ga0496113_0399362 3300048916 Bacteria 1104
630 Ga0496116_0000023 3300048919 Bacteria 475792
631 Ga0496116_0000094 3300048919 Bacteria 205588
632 Ga0496116_0000110 3300048919 Bacteria 185668
633 Ga0496116_0000140 3300048919 Bacteria 151165
634 Ga0496116_0000625 3300048919 Bacteria 46424
635 Ga0496116_0005122 3300048919 Bacteria 12308
636 Ga0496116_0042463 3300048919 Bacteria 3107
637 Ga0496116_0076052 3300048919 Bacteria 2105
638 Ga0496117_0000009 3300048920 Bacteria 613759
639 Ga0496117_0000138 3300048920 Bacteria 159456
640 Ga0496117_0000154 3300048920 Bacteria 146606
641 Ga0496117_0000380 3300048920 Bacteria 76671
642 Ga0496117_0000835 3300048920 Bacteria 47629
643 Ga0496117_0007932 3300048920 Bacteria 10201
644 Ga0496117_0012591 3300048920 Bacteria 7441
645 Ga0496117_0015662 3300048920 Bacteria 6444
646 Ga0496117_0079691 3300048920 Bacteria 2156
647 Ga0496117_0109624 3300048920 Bacteria 1723
648 Ga0496118_0000017 3300048921 Bacteria 549445
649 Ga0496118_0000150 3300048921 Bacteria 123251
650 Ga0496118_0000158 3300048921 Bacteria 121361
651 Ga0496118_0001286 3300048921 Bacteria 38322
652 Ga0496118_0003879 3300048921 Bacteria 18358
653 Ga0496118_0005328 3300048921 Bacteria 14648
654 Ga0496118_0009114 3300048921 Bacteria 10097
655 Ga0496118_0034368 3300048921 Bacteria 4138
656 Ga0496118_0038462 3300048921 Bacteria 3834
657 Ga0496118_0055527 3300048921 Bacteria 2987
658 Ga0496118_0218215 3300048921 Bacteria 1112
659 Ga0496119_0000012 3300048922 Bacteria 411917
660 Ga0496119_0000027 3300048922 Bacteria 249124
661 Ga0496119_0000049 3300048922 Bacteria 185482
662 Ga0496119_0004375 3300048922 Bacteria 14096
663 Ga0496119_0004462 3300048922 Bacteria 13925
664 Ga0496119_0006885 3300048922 Bacteria 10375
665 Ga0496119_0015911 3300048922 Bacteria 5758
666 Ga0496119_0017287 3300048922 Bacteria 5432
667 Ga0496119_0018326 3300048922 Bacteria 5220
668 Ga0496119_0020904 3300048922 Bacteria 4749
669 Ga0496119_0026577 3300048922 Bacteria 4009
670 Ga0496120_0000004 3300048923 Bacteria 534793
671 Ga0496120_0000022 3300048923 Bacteria 249124
672 Ga0496120_0000048 3300048923 Bacteria 187988
673 Ga0496120_0000052 3300048923 Bacteria 186071
674 Ga0496120_0000057 3300048923 Bacteria 177460
675 Ga0496120_0000137 3300048923 Bacteria 123518
676 Ga0496120_0001027 3300048923 Bacteria 37319
677 Ga0496120_0002674 3300048923 Bacteria 17528
678 Ga0496120_0003623 3300048923 Bacteria 13860
679 Ga0496120_0004742 3300048923 Bacteria 11163
680 Ga0496120_0032115 3300048923 Bacteria 3169
681 Ga0496120_0042229 3300048923 Bacteria 2664
682 Ga0496121_0000389 3300048924 Bacteria 89759
683 Ga0496121_0001226 3300048924 Bacteria 44634
684 Ga0496121_0007606 3300048924 Bacteria 13034
685 Ga0496121_0012388 3300048924 Bacteria 9311
686 Ga0496121_0013317 3300048924 Bacteria 8852
687 Ga0496121_0016076 3300048924 Bacteria 7755
688 Ga0496122_0000003 3300048925 Bacteria 645810
689 Ga0496122_0000007 3300048925 Bacteria 606493
690 Ga0496122_0000088 3300048925 Bacteria 207600
691 Ga0496122_0002515 3300048925 Bacteria 25867
692 Ga0496122_0002765 3300048925 Bacteria 24195
693 Ga0496122_0014001 3300048925 Bacteria 7793
694 Ga0496122_0027761 3300048925 Bacteria 4827
695 Ga0496122_0029152 3300048925 Bacteria 4662
696 Ga0496122_0033217 3300048925 Bacteria 4249
697 Ga0496122_0154784 3300048925 Bacteria 1408
698 Ga0496123_0000004 3300048926 Bacteria 777230
699 Ga0496123_0000012 3300048926 Bacteria 458760
700 Ga0496123_0000139 3300048926 Bacteria 151469
701 Ga0496123_0000811 3300048926 Bacteria 50435
702 Ga0496123_0001770 3300048926 Bacteria 28492
703 Ga0496123_0002175 3300048926 Bacteria 25005
704 Ga0496123_0008368 3300048926 Bacteria 9513
705 Ga0496123_0012229 3300048926 Bacteria 7341
706 Ga0496123_0012648 3300048926 Bacteria 7167
707 Ga0496124_0000017 3300048927 Bacteria 444389
708 Ga0496124_0000025 3300048927 Bacteria 405471
709 Ga0496124_0000045 3300048927 Bacteria 287396
710 Ga0496124_0000484 3300048927 Bacteria 68281
711 Ga0496124_0001484 3300048927 Bacteria 34470
712 Ga0496124_0004039 3300048927 Bacteria 17427
713 Ga0496124_0020650 3300048927 Bacteria 6079
714 Ga0496124_0033130 3300048927 Bacteria 4548
715 Ga0496124_0059533 3300048927 Bacteria 3208
716 Ga0496124_0110800 3300048927 Bacteria 2209
717 Ga0496124_0125319 3300048927 Bacteria 2047
718 Ga0496124_0174349 3300048927 Bacteria 1662
719 Ga0496124_0229331 3300048927 Bacteria 1390
720 Ga0496125_0000013 3300048928 Bacteria 628761
721 Ga0496125_0000065 3300048928 Bacteria 249830
722 Ga0496125_0001229 3300048928 Bacteria 38359
723 Ga0496125_0001911 3300048928 Bacteria 28512
724 Ga0496125_0006272 3300048928 Bacteria 12922
725 Ga0496125_0015636 3300048928 Bacteria 7323
726 Ga0496125_0017742 3300048928 Bacteria 6774
727 Ga0496126_0000865 3300048929 Bacteria 53248
728 Ga0496126_0004050 3300048929 Bacteria 17821
729 Ga0496126_0036320 3300048929 Bacteria 4607
730 Ga0496126_0037033 3300048929 Bacteria 4556
731 Ga0496126_0046052 3300048929 Bacteria 4004
732 Ga0496126_0127556 3300048929 Bacteria 2201
733 Ga0496126_0143447 3300048929 Bacteria 2053
734 Ga0496126_0167588 3300048929 Bacteria 1873
735 Ga0496126_0171269 3300048929 Bacteria 1849
736 Ga0496126_0181350 3300048929 Bacteria 1788
737 Ga0495678_000777 3300049459 Bacteria 28686
738 Ga0495682_0000001 3300049460 Bacteria 1559116
739 Ga0501034_0231124 3300049571 Bacteria 1798
740 Ga0501043_0118373 3300049579 Bacteria 2078
741 Ga0501047_0000381 3300049581 Bacteria 50014
742 Ga0501047_0254628 3300049581 Bacteria 1604
743 Ga0501067_0131767 3300049583 Unclassified 1391
744 Ga0501069_0001456 3300049585 Bacteria 11649
745 Ga0501070_0157613 3300049586 Bacteria 1872
746 Ga0501072_0381748 3300049588 Bacteria 1118
747 Ga0501080_0017723 3300049742 Bacteria 6590
748 Ga0501035_0012306 3300049822 Bacteria 7911
749 nmdc:mga00v17_1439_c1 3300050491 Bacteria 4629
750 nmdc:mga0qj67_7355_c1 3300050509 Bacteria 8139
751 nmdc:mga06r32_469768_c1 3300050510 Unclassified 1236
752 Ga0500635_0005491 3300053080 Bacteria 3330
753 Ga0495595_0254822 3300053084 Bacteria 879
754 Ga0500644_0004127 3300053088 Bacteria 3618
755 Ga0500651_0010951 3300053093 Bacteria 5455
756 Ga0500651_0132105 3300053093 Bacteria 1509
757 Ga0500566_0172253 3300053094 Bacteria 1118
758 Ga0500621_000002 3300053126 Bacteria 849473
759 Ga0500559_0057407 3300053136 Bacteria 1729
760 Ga0500568_0004359 3300053139 Bacteria 7574
761 Ga0500573_0004957 3300053140 Bacteria 7071
762 Ga0501082_0044900 3300060353 Bacteria 3811
763 Ga0466962_0000176 3300061719 Bacteria 26558
764 Ga0466962_0004914 3300061719 Bacteria 6427
765 Ga0466962_0073495 3300061719 Bacteria 1634
766 2506577645 2506520007 Bacteria 5442880
767 2506582783 2506520008 Bacteria 5443009
768 2508851580 2508501071 Bacteria 5454741
769 2511379891 2511231025 Bacteria 5324661
770 2511434743 2511231035 Bacteria 5341610
771 2538424298 2537561728 Bacteria 5149301
772 2547697163 2547132181 Bacteria 4945084
773 2548648745 2547132416 Bacteria 4633861
774 2555261269 2554235234 Bacteria 5762085
775 2562463319 2561511199 Bacteria 5155034
776 2585829846 2585427591 Bacteria 5482980
777 2585835024 2585427592 Bacteria 5370892
778 2599411461 2599185169 Bacteria 5441380
779 2599926340 2599185299 Bacteria 4854625
780 2601522943 2600255254 Bacteria 5281859
781 2601527970 2600255255 Bacteria 5282785
782 2601534803 2600255256 Bacteria 5597742
783 2601539568 2600255257 Bacteria 5597196
784 2601614804 2600255280 Bacteria 5292309
785 2601619521 2600255281 Bacteria 5288753
786 2601641884 2600255287 Bacteria 5210468
787 2601646721 2600255288 Bacteria 5282738
788 2601656334 2600255289 Bacteria 5281907
789 2601658274 2600255290 Bacteria 5282218
790 2601665898 2600255291 Bacteria 5217298
791 2601698755 2600255298 Bacteria 5215185
792 2601701627 2600255299 Bacteria 5218662
793 2601706795 2600255300 Bacteria 5287774
794 2601711099 2600255301 Bacteria 5280532
795 2601716113 2600255302 Bacteria 5288235
796 2601719691 2600255303 Bacteria 5219315
797 2601726519 2600255304 Bacteria 5283973
798 2601731060 2600255305 Bacteria 5282329
799 2601736075 2600255306 Bacteria 5281613
800 2601741511 2600255307 Bacteria 5439064
801 2601752235 2600255309 Bacteria 5431045
802 2601757918 2600255310 Bacteria 5600903
803 2601764276 2600255311 Bacteria 5598766
804 2602019076 2600255392 Bacteria 5437392
805 2603637092 2602042046 Bacteria 5483348
806 2603645048 2602042047 Bacteria 4697674
807 2603661385 2602042052 Bacteria 5215873
808 2603664339 2602042053 Bacteria 5214361
809 2603699149 2602042066 Bacteria 4423871
810 2603705164 2602042067 Bacteria 4863713
811 2603838455 2602042103 Bacteria 5284714
812 2603843532 2602042104 Bacteria 5281639
813 2603848606 2602042105 Bacteria 5282303
814 2603853679 2602042106 Bacteria 5282744
815 2603868792 2602042109 Bacteria 5152801
816 2603871733 2602042110 Bacteria 5283285
817 2603876635 2602042111 Bacteria 5212080
818 2606048923 2603880178 Bacteria 5283018
819 2606068769 2603880184 Bacteria 5217896
820 2606144562 2603880202 Bacteria 5284684
821 2606176326 2603880211 Bacteria 5284226
822 2608669878 2608642108 Bacteria 4104624
823 2609909870 2609459761 Bacteria 5513740
824 2637224285 2636415599 Bacteria 5718434
825 2643882612 2643221574 Bacteria 2789653
826 2644352498 2643221663 Bacteria 3425771
827 2644549431 2643221699 Bacteria 5731501
828 2644550481 2643221699 Bacteria 5731501
829 2649120099 2648501241 Bacteria 5312320
830 2650897088 2648501693 Bacteria 5069560
831 2652972856 2651869818 Bacteria 5864031
832 2656278670 2654587920 Bacteria 5475511
833 2671101335 2667528172 Bacteria 5170840
834 2671108747 2667528173 Bacteria 5375747
835 2671585536 2671180115 Bacteria 5353919
836 2676405687 2675903046 Bacteria 5451247
837 2681996422 2681812866 Bacteria 4552357
838 2682006229 2681812869 Bacteria 5014465
839 2686353995 2684622997 Bacteria 4624240
840 2689444138 2687453601 Bacteria 5546041
841 2691330201 2690315857 Bacteria 4396207
842 2707101961 2706794495 Bacteria 4536932
843 2712469431 2711768156 Bacteria 4471618
844 2739791996 2739367756 Bacteria 4553612
845 2753856715 2751185917 Bacteria 4551186
846 2765589809 2765235842 Bacteria 4799256
847 2772438167 2772190666 Bacteria 5117644
848 2775539744 2775506706 Bacteria 4873073
849 2777020743 2775507074 Bacteria 5532402
850 2791925054 2791354903 Bacteria 4937680
851 2792310371 2791355010 Bacteria 4864581
852 2793404946 2791355275 Bacteria 4429597
853 2807176492 2806310673 Bacteria 4801221
854 2809125550 2808606414 Bacteria 4917181
855 2813728110 2811995292 Bacteria 5303342
856 2814695654 2814123068 Bacteria 5687681
857 2821120829 2821118458 Bacteria 4714306
858 2823375463 2823373977 Bacteria 4779415
859 2844428166 2844425489 Bacteria 4854065
860 2844528976 2844528606 Bacteria 4733806
861 2846542088 2846540461 Bacteria 5471451
862 2847086795 2847085930 Bacteria 5070450
863 2847799148 2847797336 Bacteria 5176640
864 2852107601 2852103415 Bacteria 5193810
865 2854602361 2854601825 Bacteria 4797592
866 2855199668 2855195626 Bacteria 4927512
867 2858467691 2858466076 Bacteria 4722413
868 2865017448 2865014394 Bacteria 4764573
869 2869553494 2869551831 Bacteria 5474685
870 2871274131 2871272651 Bacteria 5042015
871 2871285256 2871282230 Bacteria 4917173
872 2876602933 2876601092 Bacteria 5114497
873 2881613964 2881609920 Bacteria 4405319
874 2881716541 2881714928 Bacteria 2469486
875 2884088154 2884086401 Bacteria 5005459
876 2887631988 2887630918 Bacteria 3239855
877 2888368182 2888366609 Bacteria 5155009
878 2888374207 2888373701 Bacteria 5098052
879 2891672160 2891670763 Bacteria 4967099
880 2896429545 2896429255 Bacteria 2557483
881 2900052291 2900051742 Bacteria 4985156
882 2904475557 2904474040 Bacteria 5504324
883 2904507975 2904504865 Bacteria 5152820
884 2904515606 2904513164 Bacteria 5476410
885 2908672261 2908669403 Bacteria 5740494
886 2916179317 2916178963 Bacteria 5265078
887 2919111279 2919108558 Bacteria 5897419
888 2919151726 2919150387 Bacteria 5500879
889 2919495762 2919493220 Bacteria 4598500
890 2919500320 2919497567 Bacteria 4408621
891 2919535310 2919534386 Bacteria 4577686
892 2919543401 2919543075 Bacteria 4728703
893 2919692183 2919688452 Bacteria 4595932
894 2923528442 2923525760 Bacteria 4472324
895 2923635630 2923634449 Bacteria 4753480
896 2927144395 2927143783 Bacteria 5504251
897 2927833402 2927833300 Bacteria 4923934
898 2928974064 2928972540 Bacteria 3058286
899 2932408386 2932406140 Bacteria 5134491
900 2935625973 2935625433 Bacteria 5042964
901 2937542655 2937539931 Bacteria 4639830
902 2937969908 2937967321 Bacteria 5094075
903 2939569831 2939568625 Bacteria 4542555
904 2939573075 2939573065 Bacteria 4926053
905 2939580047 2939577877 Bacteria 5132791
906 2939606942 2939602548 Bacteria 4950493
907 2939608890 2939607340 Bacteria 4719256
908 2939618272 2939617950 Bacteria 4820956
909 2939643165 2939642701 Bacteria 4475280
910 2941489202 2941485952 Bacteria 3591484
911 2945877070 2945874760 Bacteria 5527237
912 2945952380 2945951305 Bacteria 4918162
913 2969081325 2969079654 Bacteria 5439582
914 2971822744 2971820967 Bacteria 5823634
915 2974311322 2974310843 Bacteria 4947816
916 2974439061 2974435778 Bacteria 4876478
917 2977240969 2977240413 Bacteria 3191065
918 2978978869 2978975091 Bacteria 4704313
919 2984497357 2984494565 Bacteria 5000175
920 2984563788 2984559226 Bacteria 5683096
921 2984596521 2984595703 Bacteria 5682994
922 2990261308 2990261002 Bacteria 4919493
923 3000378596 3000376612 Bacteria 4705565
924 640937148 640753048 Bacteria 5495657
925 8004597522 8004592986 Bacteria 5122074
926 8015397712 8015394850 Bacteria 5064660
927 8016735232 8016733728 Bacteria 5274317
928 8018223226 8018221730 Bacteria 4616064
929 8018409460 8018405270 Bacteria 4978981
930 8019501287 8019499862 Bacteria 5169538
931 8019505391 8019504834 Bacteria 4819156
932 8054360671 8054357960 Bacteria 2867777
933 8054846421 8054844752 Bacteria 4450330
934 8054851742 8054849141 Bacteria 5232694
935 8055088021 8055087960 Bacteria 4784273
936 8055095287 8055092621 Bacteria 4873875
937 8055098417 8055097453 Bacteria 4865496
938 8055695401 8055693939 Bacteria 4772047
939 8057307016 8057304971 Bacteria 4649742
940 Ga0157370_10115790
941 SwRhRL2b_contig_3798929
942 SwRhRL2b_contig_513557
943 JGI24740J21852_10023081
944 JGI24737J22298_10028251
945 JGI25162J39368_1000019
946 JGI25163J39215_1000121
947 JGI25164J39214_1000011
948 JGI25152J39213_1000139
949 rootH2_10014876
950 rootL2_10108836
951 rootH1_10208222
952 Ga0006562J51391_1018770
953 Ga0055538_1000021
954 Ga0055539_1000026
955 Ga0055533_1000035
956 Ga0055525_1000045
957 Ga0055536_1000238
958 Ga0055536_1032714
959 Ga0055541_1000020
960 Ga0058692_1000099
961 Ga0058692_1000261
962 Ga0058692_1000468
963 Ga0058692_1000698
964 Ga0058692_1001871
965 Ga0058692_1004106
966 Ga0058692_1005849
967 Ga0058692_1008705
968 Ga0058692_1009958
969 Ga0065703_1021842
970 Ga0065704_10000261
971 Ga0065704_10000708
972 Ga0065704_10003611
973 Ga0065704_10070657
974 Ga0065704_10216388
975 Ga0070658_10000013
976 Ga0070658_10028617
977 Ga0070658_10054019
978 Ga0070658_10203163
979 Ga0070683_100077457
980 Ga0070680_100000478
981 Ga0070660_100001747
982 Ga0070660_100017863
983 Ga0070660_100041749
984 Ga0070661_100001603
985 Ga0070661_100070963
986 Ga0070661_100101326
987 Ga0070692_10000649
988 Ga0070692_10030078
989 Ga0070668_100009419
990 Ga0070668_100249144
991 Ga0070675_100287179
992 Ga0070671_100006902
993 Ga0070671_100053006
994 Ga0070673_100167009
995 Ga0070659_100004808
996 Ga0070659_100062581
997 Ga0070659_100089858
998 Ga0070659_100305819
999 Ga0070667_100467219
1000 Ga0070714_100103913
1001 Ga0070714_100154029
1002 Ga0070714_100188197
1003 Ga0070713_100014588
1004 Ga0070700_100088547
1005 Ga0070663_100006997
1006 Ga0070662_100012504
1007 Ga0070662_100135774
1008 Ga0070681_10015206
1009 Ga0070679_100000007
1010 Ga0070679_100103249
1011 Ga0070684_100099249
1012 Ga0070672_100220113
1013 Ga0070686_100000138
1014 Ga0070693_100243291
1015 Ga0070665_100000075
1016 Ga0070665_100000464
1017 Ga0070665_100003847
1018 Ga0070665_100230239
1019 Ga0070665_100345473
1020 Ga0070665_100593139
1021 Ga0068855_100038568
1022 Ga0068855_100172518
1023 Ga0068857_100000207
1024 Ga0068857_100004075
1025 Ga0068857_100169541
1026 Ga0068856_100008083
1027 Ga0068856_100285568
1028 Ga0068856_100630567
1029 Ga0068856_100650749
1030 Ga0068852_100003835
1031 Ga0068852_100311461
1032 Ga0068859_100002770
1033 Ga0068859_100032361
1034 Ga0068864_100115678
1035 Ga0068863_100000122
1036 Ga0068863_100023539
1037 Ga0068863_100115542
1038 Ga0068860_100018206
1039 Ga0068860_100253458
1040 Ga0068860_100409340
1041 Ga0068862_100090529
1042 Ga0068862_100103380
1043 Ga0068862_100122166
1044 Ga0081455_10026221
1045 Ga0070717_10054160
1046 Ga0075364_10004013
1047 Ga0070716_100037943
1048 Ga0075366_10052235
1049 Ga0075430_100018405
1050 Ga0075431_100499102
1051 Ga0097620_100002770
1052 Ga0097620_100032361
1053 Ga0079104_1000018
1054 Ga0079104_1000163
1055 Ga0079104_1000282
1056 Ga0079104_1000384
1057 Ga0079104_1000391
1058 Ga0079104_1001061
1059 Ga0079104_1005390
1060 Ga0079104_1006102
1061 Ga0105251_10000141
1062 Ga0105251_10000349
1063 Ga0105251_10000471
1064 Ga0105251_10001340
1065 Ga0105251_10002019
1066 Ga0105251_10004707
1067 Ga0105251_10006665
1068 Ga0105251_10010251
1069 Ga0105251_10022944
1070 Ga0105251_10053068
1071 Ga0105251_10091942
1072 Ga0105251_10196047
1073 Ga0105244_10000009
1074 Ga0105244_10000123
1075 Ga0105244_10000347
1076 Ga0105244_10000636
1077 Ga0105244_10000818
1078 Ga0105244_10002573
1079 Ga0105244_10003693
1080 Ga0105244_10005634
1081 Ga0105244_10007967
1082 Ga0105244_10024207
1083 Ga0105244_10041144
1084 Ga0105244_10049734
1085 Ga0105250_10000002
1086 Ga0105250_10000100
1087 Ga0105250_10000601
1088 Ga0105250_10001115
1089 Ga0105250_10001849
1090 Ga0105250_10002145
1091 Ga0105250_10008211
1092 Ga0105240_10009039
1093 Ga0105240_10188986
1094 Ga0105240_10203458
1095 Ga0105245_10099199
1096 Ga0105247_10000025
1097 Ga0105243_10033993
1098 Ga0105241_10000005
1099 Ga0105248_10691697
1100 Ga0105237_10497238
1101 Ga0105238_10081994
1102 Ga0105249_10082479
1103 Ga0105239_10668242
1104 Ga0105246_10039694
1105 Ga0157373_10000110
1106 Ga0157373_10048988
1107 Ga0157373_10068289
1108 Ga0157373_10148992
1109 Ga0157371_10000098
1110 Ga0157371_10000673
1111 Ga0157371_10002717
1112 Ga0157371_10003439
1113 Ga0157371_10005924
1114 Ga0157371_10006411
1115 Ga0157371_10007406
1116 Ga0157371_10012018
1117 Ga0157371_10059481
1118 Ga0157371_10081337
1119 Ga0157370_10000445
1120 Ga0157370_10000707
1121 Ga0157370_10005108
1122 Ga0157370_10016493
1123 Ga0157370_10181254
1124 Ga0157370_10181396
1125 Ga0157369_10000988
1126 Ga0157369_10006229
1127 Ga0157369_10019715
1128 Ga0157369_10077912
1129 Ga0157369_10124326
1130 Ga0157369_10249797
1131 Ga0157369_10300009
1132 Ga0157378_10391212
1133 Ga0163162_10072654
1134 Ga0157372_10054735
1135 Ga0157372_10055595
1136 Ga0157372_10072400
1137 Ga0157372_10091434
1138 Ga0157372_10126381
1139 Ga0157372_10254223
1140 Ga0157372_10357124
1141 Ga0157375_10572828
1142 Ga0163163_10007998
1143 Ga0182008_10022168
1144 Ga0182008_10036789
1145 Ga0157377_10133047
1146 Ga0182006_1000018
1147 Ga0182006_1030626
1148 Ga0182007_10017056
1149 Ga0183366_1001
1150 Ga0183370_1001
1151 Ga0183365_10001
1152 Ga0183369_1001
1153 Ga0183368_1001
1154 Ga0163161_10000001
1155 Ga0163161_10084750
1156 Ga0206353_11324343
1157 Ga0213873_10000006
1158 Ga0213872_10008462
1159 Ga0213872_10077011
1160 Ga0213876_10000004
1161 Ga0213876_10000034
1162 Ga0213876_10004247
1163 Ga0213876_10016435
1164 Ga0213876_10058546
1165 Ga0209760_100004
1166 Ga0209784_100001
1167 Ga0209566_100001
1168 Ga0209674_100002
1169 Ga0209563_100002
1170 Ga0207427_100012
1171 Ga0209437_100001
1172 Ga0209437_100238
1173 Ga0209677_100002
1174 Ga0209129_1000077
1175 Ga0209233_1012128
1176 Ga0209676_1000252
1177 Ga0209676_1004310
1178 Ga0209050_1003880
1179 Ga0209257_1000060
1180 Ga0207696_1000001
1181 Ga0207696_1000013
1182 Ga0207696_1000021
1183 Ga0207696_1000053
1184 Ga0207696_1000058
1185 Ga0207696_1001994
1186 Ga0207696_1002267
1187 Ga0207696_1003430
1188 Ga0207696_1003689
1189 Ga0207696_1003913
1190 Ga0207655_1000002
1191 Ga0207655_1000004
1192 Ga0207655_1000007
1193 Ga0207655_1000036
1194 Ga0207655_1000447
1195 Ga0207655_1000604
1196 Ga0207655_1000642
1197 Ga0207655_1000829
1198 Ga0207655_1003843
1199 Ga0207655_1007692
1200 Ga0207655_1010282
1201 Ga0207655_1028073
1202 Ga0207655_1081764
1203 Ga0207713_1000001
1204 Ga0207713_1000012
1205 Ga0207713_1000015
1206 Ga0207713_1000092
1207 Ga0207713_1000132
1208 Ga0207713_1000142
1209 Ga0207713_1000383
1210 Ga0207713_1010431
1211 Ga0207713_1012963
1212 Ga0207713_1018658
1213 Ga0207713_1023685
1214 Ga0207713_1032191
1215 Ga0207713_1100090
1216 Ga0207710_10000150
1217 Ga0207688_10067675
1218 Ga0207680_10204119
1219 Ga0207647_10007732
1220 Ga0207647_10010023
1221 Ga0207705_10000002
1222 Ga0207705_10000003
1223 Ga0207705_10032612
1224 Ga0207705_10310592
1225 Ga0207654_10000007
1226 Ga0207707_10027457
1227 Ga0207695_10010391
1228 Ga0207695_10016024
1229 Ga0207695_10235004
1230 Ga0207671_10320448
1231 Ga0207660_10000536
1232 Ga0207657_10004480
1233 Ga0207657_10023582
1234 Ga0207657_10027500
1235 Ga0207649_10000329
1236 Ga0207649_10001485
1237 Ga0207649_10018803
1238 Ga0207652_10000001
1239 Ga0207652_10000002
1240 Ga0207681_10054989
1241 Ga0207694_10050905
1242 Ga0207659_10028215
1243 Ga0207664_10168119
1244 Ga0207644_10000299
1245 Ga0207644_10000833
1246 Ga0207644_10022554
1247 Ga0207690_10005730
1248 Ga0207690_10009302
1249 Ga0207690_10025124
1250 Ga0207690_10051399
1251 Ga0207706_10006757
1252 Ga0207706_10124010
1253 Ga0207706_10273573
1254 Ga0207709_10005891
1255 Ga0207669_10008692
1256 Ga0207691_10087794
1257 Ga0207691_10221782
1258 Ga0207711_10112771
1259 Ga0207661_10021552
1260 Ga0207667_10013015
1261 Ga0207667_10015306
1262 Ga0207651_10319221
1263 Ga0207651_10465115
1264 Ga0207668_10000082
1265 Ga0207668_10082088
1266 Ga0207668_10238423
1267 Ga0207640_10000838
1268 Ga0207640_10059204
1269 Ga0207639_10043827
1270 Ga0207639_10073093
1271 Ga0207639_10112571
1272 Ga0207678_10004283
1273 Ga0207678_10029828
1274 Ga0207678_10213377
1275 Ga0207708_10072486
1276 Ga0207702_10031878
1277 Ga0207702_10075148
1278 Ga0207702_10143550
1279 Ga0207641_10000001
1280 Ga0207641_10011857
1281 Ga0207676_10018047
1282 Ga0207674_10000132
1283 Ga0207674_10007565
1284 Ga0207698_10015058
1285 Ga0207698_10177272
1286 Ga0209281_1000004
1287 Ga0209281_1000006
1288 Ga0209281_1000014
1289 Ga0209281_1000027
1290 Ga0209281_1000064
1291 Ga0209281_1000071
1292 Ga0209281_1000257
1293 Ga0209281_1000370
1294 Ga0209281_1000714
1295 Ga0209281_1001392
1296 Ga0209281_1004837
1297 Ga0209371_1000001
1298 Ga0209371_1000002
1299 Ga0209371_1000005
1300 Ga0209371_1000015
1301 Ga0209371_1000099
1302 Ga0209371_1000100
1303 Ga0209371_1000120
1304 Ga0209371_1000731
1305 Ga0209371_1000778
1306 Ga0209371_1000964
1307 Ga0209371_1001841
1308 Ga0209371_1002061
1309 Ga0209371_1003104
1310 Ga0209371_1003934
1311 Ga0209371_1007662
1312 Ga0209371_1009080
1313 Ga0268266_10000103
1314 Ga0268266_10000286
1315 Ga0268266_10000514
1316 Ga0268266_10195106
1317 Ga0268265_10119029
1318 Ga0268264_10010903
1319 Ga0268264_10012883
1320 Ga0268256_1000001
1321 Ga0268256_1000002
1322 Ga0268256_1000006
1323 Ga0268256_1000018
1324 Ga0268256_1000035
1325 Ga0268256_1000089
1326 Ga0268256_1000423
1327 Ga0268256_1000714
1328 Ga0268256_1000873
1329 Ga0268256_1001822
1330 Ga0268256_1003781
1331 Ga0268256_1004445
1332 Ga0268256_1005198
1333 Ga0265327_10016858
1334 Ga0307408_100001207
1335 Ga0307405_10001717
1336 Ga0307413_10000666
1337 Ga0307413_10177276
1338 Ga0307410_10002549
1339 Ga0307410_10159736
1340 Ga0307410_10177615
1341 Ga0307410_10205837
1342 Ga0307406_10001991
1343 Ga0307406_10003346
1344 Ga0307406_10296136
1345 Ga0307407_10000195
1346 Ga0307412_10002981
1347 Ga0307412_10081574
1348 Ga0307412_10343388
1349 Ga0307409_100026891
1350 Ga0307409_100082730
1351 Ga0307409_100370035
1352 Ga0307416_100001750
1353 Ga0307414_10001053
1354 Ga0307414_10003789
1355 Ga0307414_10005946
1356 Ga0307414_10037640
1357 Ga0307414_10076705
1358 Ga0307414_10235849
1359 Ga0307414_10238395
1360 Ga0307414_10356926
1361 Ga0307411_10000206
1362 Ga0307411_10002634
1363 Ga0307411_10030860
1364 Ga0307411_10193156
1365 Ga0307411_10263980
1366 Ga0307415_100008908
1367 Ga0307415_100089979
1368 Ga0316593_10041632
1369 Ga0395899_0000184
1370 Ga0395899_0000264
1371 Ga0395899_0008407
1372 Ga0395899_0033067
1373 Ga0395899_0050095
1374 Ga0395899_0080052
1375 Ga0395899_0089388
1376 Ga0395899_0100835
1377 Ga0395899_0188198
1378 Ga0395899_0240342
1379 Ga0395900_0000723
1380 Ga0395900_0003562
1381 Ga0395900_0015186
1382 Ga0395900_0015753
1383 Ga0395900_0016216
1384 Ga0395900_0018901
1385 Ga0395900_0023262
1386 Ga0395900_0036036
1387 Ga0395900_0063713
1388 Ga0395900_0143855
1389 Ga0395900_0167208
1390 Ga0395900_0248444
1391 Ga0395900_0259066
1392 Ga0395900_0489788
1393 Ga0395900_0493594
1394 Ga0395900_0540726
1395 Ga0395898_0000087
1396 Ga0395898_0004020
1397 Ga0395898_0011911
1398 Ga0395898_0018469
1399 Ga0395898_0101522
1400 Ga0395898_0106782
1401 Ga0395898_0144648
1402 Ga0395898_0170038
1403 Ga0395898_0418492
1404 Ga0395905_0000005
1405 Ga0395905_0000070
1406 Ga0395905_0002000
1407 Ga0395905_0002910
1408 Ga0395905_0005131
1409 Ga0395905_0006920
1410 Ga0395905_0017740
1411 Ga0395905_0020118
1412 Ga0395905_0022485
1413 Ga0395905_0036963
1414 Ga0395905_0040140
1415 Ga0395905_0051191
1416 Ga0395905_0069944
1417 Ga0395905_0102146
1418 Ga0395905_0346261
1419 Ga0395905_0488463
1420 Ga0395901_0001808
1421 Ga0395901_0004038
1422 Ga0395901_0015103
1423 Ga0395901_0015235
1424 Ga0395901_0024583
1425 Ga0395901_0035231
1426 Ga0395901_0036907
1427 Ga0395901_0039387
1428 Ga0395901_0081178
1429 Ga0395901_0113760
1430 Ga0395901_0162518
1431 Ga0395901_0205851
1432 Ga0395901_0430976
1433 Ga0395901_0642065
1434 Ga0400483_152581
1435 Ga0436365_0674409
1436 Ga0436365_0689373
1437 Ga0436365_0965775
1438 Ga0436365_0970858
1439 Ga0436365_1116037
1440 Ga0436365_1186688
1441 Ga0436361_0292016
1442 Ga0436361_0340720
1443 Ga0436362_0554113
1444 Ga0436362_1252872
1445 Ga0439438_000002
1446 Ga0439438_003831
1447 Ga0439438_031555
1448 Ga0439447_008214
1449 Ga0439447_008992
1450 Ga0439466_0000001
1451 Ga0439445_0000014
1452 Ga0439432_009149
1453 Ga0439432_011912
1454 Ga0439432_013062
1455 Ga0439452_000001
1456 Ga0439452_000002
1457 Ga0439452_000020
1458 Ga0439452_000031
1459 Ga0439462_0053521
1460 Ga0439463_008381
1461 Ga0450912_000309
1462 Ga0450923_017616
1463 Ga0450907_000295
1464 Ga0439446_0051763
1465 Ga0439458_0000243
1466 Ga0439458_0001940
1467 Ga0439464_0003158
1468 Ga0451577_0019045
1469 Ga0466969_0000781
1470 Ga0466969_0028998
1471 Ga0466981_0000003
1472 Ga0466966_0000039
1473 Ga0466966_0000173
1474 Ga0466966_0000802
1475 Ga0466966_0000939
1476 Ga0466966_0058404
1477 Ga0466961_0000530
1478 Ga0466961_0001878
1479 Ga0466961_0039489
1480 Ga0466961_0076757
1481 Ga0466961_0079904
1482 Ga0466961_0085520
1483 Ga0466963_0012559
1484 Ga0466963_0025445
1485 Ga0466964_0194880
1486 Ga0466971_0000414
1487 Ga0466968_0016031
1488 Ga0466970_0000836
1489 Ga0466970_0016422
1490 Ga0466957_0001326
1491 Ga0466957_0009306
1492 Ga0466957_0036436
1493 Ga0466957_0063314
1494 Ga0466957_0193361
1495 Ga0466959_0000108
1496 Ga0466959_0008432
1497 Ga0466959_0013571
1498 Ga0466959_0096742
1499 Ga0466959_0155022
1500 Ga0466958_0001249
1501 Ga0466958_0001949
1502 Ga0466958_0022630
1503 Ga0466958_0026893
1504 Ga0466967_0044572
1505 Ga0466967_0201029
1506 Ga0466967_0336944
1507 Ga0466967_0510636
1508 Ga0495617_066763
1509 Ga0495627_000018
1510 Ga0495591_000050
1511 Ga0495591_000059
1512 Ga0495638_0021694
1513 Ga0495650_0000031
1514 Ga0495650_0000047
1515 Ga0495650_0000182
1516 Ga0495605_0016907
1517 Ga0495585_0004843
1518 Ga0495596_0013908
1519 Ga0495607_0045969
1520 Ga0495606_0003900
1521 Ga0495616_0034318
1522 Ga0495620_0009743
1523 Ga0495637_0085427
1524 Ga0495643_0017719
1525 Ga0495644_0012461
1526 Ga0495648_0001866
1527 Ga0495648_0015572
1528 Ga0495654_0000009
1529 Ga0495654_0000068
1530 Ga0495654_0000596
1531 Ga0495598_0006796
1532 Ga0495621_0000983
1533 Ga0495597_0002098
1534 Ga0495633_0000162
1535 Ga0495633_0010150
1536 Ga0495625_0003714
1537 Ga0495625_0049949
1538 Ga0495588_0047665
1539 Ga0495670_0015196
1540 Ga0495649_0000165
1541 Ga0495649_0004029
1542 Ga0495649_0004333
1543 Ga0495649_0007728
1544 Ga0495589_0000002
1545 Ga0495660_0000004
1546 Ga0495660_0000015
1547 Ga0495660_0045452
1548 Ga0495672_0000001
1549 Ga0495672_0000009
1550 Ga0495672_0000015
1551 Ga0495676_0276541
1552 Ga0495679_000309
1553 Ga0495679_003403
1554 Ga0495679_006075
1555 Ga0495673_0000007
1556 Ga0495673_0000019
1557 Ga0496100_0002186
1558 Ga0496101_0000157
1559 Ga0496102_0017189
1560 Ga0496104_0000158
1561 Ga0496104_0002904
1562 Ga0496105_0005660
1563 Ga0496105_0096668
1564 Ga0496109_0035306
1565 Ga0496110_0110046
1566 Ga0496112_0123313
1567 Ga0496113_0083843
1568 Ga0496113_0399362
1569 Ga0496116_0000023
1570 Ga0496116_0000094
1571 Ga0496116_0000110
1572 Ga0496116_0000140
1573 Ga0496116_0000625
1574 Ga0496116_0005122
1575 Ga0496116_0042463
1576 Ga0496116_0076052
1577 Ga0496117_0000009
1578 Ga0496117_0000138
1579 Ga0496117_0000154
1580 Ga0496117_0000380
1581 Ga0496117_0000835
1582 Ga0496117_0007932
1583 Ga0496117_0012591
1584 Ga0496117_0015662
1585 Ga0496117_0079691
1586 Ga0496117_0109624
1587 Ga0496118_0000017
1588 Ga0496118_0000150
1589 Ga0496118_0000158
1590 Ga0496118_0001286
1591 Ga0496118_0003879
1592 Ga0496118_0005328
1593 Ga0496118_0009114
1594 Ga0496118_0034368
1595 Ga0496118_0038462
1596 Ga0496118_0055527
1597 Ga0496118_0218215
1598 Ga0496119_0000012
1599 Ga0496119_0000027
1600 Ga0496119_0000049
1601 Ga0496119_0004375
1602 Ga0496119_0004462
1603 Ga0496119_0006885
1604 Ga0496119_0015911
1605 Ga0496119_0017287
1606 Ga0496119_0018326
1607 Ga0496119_0020904
1608 Ga0496119_0026577
1609 Ga0496120_0000004
1610 Ga0496120_0000022
1611 Ga0496120_0000048
1612 Ga0496120_0000052
1613 Ga0496120_0000057
1614 Ga0496120_0000137
1615 Ga0496120_0001027
1616 Ga0496120_0002674
1617 Ga0496120_0003623
1618 Ga0496120_0004742
1619 Ga0496120_0032115
1620 Ga0496120_0042229
1621 Ga0496121_0000389
1622 Ga0496121_0001226
1623 Ga0496121_0007606
1624 Ga0496121_0012388
1625 Ga0496121_0013317
1626 Ga0496121_0016076
1627 Ga0496122_0000003
1628 Ga0496122_0000007
1629 Ga0496122_0000088
1630 Ga0496122_0002515
1631 Ga0496122_0002765
1632 Ga0496122_0014001
1633 Ga0496122_0027761
1634 Ga0496122_0029152
1635 Ga0496122_0033217
1636 Ga0496122_0154784
1637 Ga0496123_0000004
1638 Ga0496123_0000012
1639 Ga0496123_0000139
1640 Ga0496123_0000811
1641 Ga0496123_0001770
1642 Ga0496123_0002175
1643 Ga0496123_0008368
1644 Ga0496123_0012229
1645 Ga0496123_0012648
1646 Ga0496124_0000017
1647 Ga0496124_0000025
1648 Ga0496124_0000045
1649 Ga0496124_0000484
1650 Ga0496124_0001484
1651 Ga0496124_0004039
1652 Ga0496124_0020650
1653 Ga0496124_0033130
1654 Ga0496124_0059533
1655 Ga0496124_0110800
1656 Ga0496124_0125319
1657 Ga0496124_0174349
1658 Ga0496124_0229331
1659 Ga0496125_0000013
1660 Ga0496125_0000065
1661 Ga0496125_0001229
1662 Ga0496125_0001911
1663 Ga0496125_0006272
1664 Ga0496125_0015636
1665 Ga0496125_0017742
1666 Ga0496126_0000865
1667 Ga0496126_0004050
1668 Ga0496126_0036320
1669 Ga0496126_0037033
1670 Ga0496126_0046052
1671 Ga0496126_0127556
1672 Ga0496126_0143447
1673 Ga0496126_0167588
1674 Ga0496126_0171269
1675 Ga0496126_0181350
1676 Ga0495678_000777
1677 Ga0495682_0000001
1678 Ga0501034_0231124
1679 Ga0501043_0118373
1680 Ga0501047_0000381
1681 Ga0501047_0254628
1682 Ga0501067_0131767
1683 Ga0501069_0001456
1684 Ga0501070_0157613
1685 Ga0501072_0381748
1686 Ga0501080_0017723
1687 Ga0501035_0012306
1688 nmdc:mga00v17_1439_c1
1689 nmdc:mga0qj67_7355_c1
1690 nmdc:mga06r32_469768_c1
1691 Ga0500635_0005491
1692 Ga0495595_0254822
1693 Ga0500644_0004127
1694 Ga0500651_0010951
1695 Ga0500651_0132105
1696 Ga0500566_0172253
1697 Ga0500621_000002
1698 Ga0500559_0057407
1699 Ga0500568_0004359
1700 Ga0500573_0004957
1701 Ga0501082_0044900
1702 Ga0466962_0000176
1703 Ga0466962_0004914
1704 Ga0466962_0073495
1705 2506577645
1706 2506582783
1707 2508851580
1708 2511379891
1709 2511434743
1710 2538424298
1711 2547697163
1712 2548648745
1713 2555261269
1714 2562463319
1715 2585829846
1716 2585835024
1717 2599411461
1718 2599926340
1719 2601522943
1720 2601527970
1721 2601534803
1722 2601539568
1723 2601614804
1724 2601619521
1725 2601641884
1726 2601646721
1727 2601656334
1728 2601658274
1729 2601665898
1730 2601698755
1731 2601701627
1732 2601706795
1733 2601711099
1734 2601716113
1735 2601719691
1736 2601726519
1737 2601731060
1738 2601736075
1739 2601741511
1740 2601752235
1741 2601757918
1742 2601764276
1743 2602019076
1744 2603637092
1745 2603645048
1746 2603661385
1747 2603664339
1748 2603699149
1749 2603705164
1750 2603838455
1751 2603843532
1752 2603848606
1753 2603853679
1754 2603868792
1755 2603871733
1756 2603876635
1757 2606048923
1758 2606068769
1759 2606144562
1760 2606176326
1761 2608669878
1762 2609909870
1763 2637224285
1764 2643882612
1765 2644352498
1766 2644549431
1767 2644550481
1768 2649120099
1769 2650897088
1770 2652972856
1771 2656278670
1772 2671101335
1773 2671108747
1774 2671585536
1775 2676405687
1776 2681996422
1777 2682006229
1778 2686353995
1779 2689444138
1780 2691330201
1781 2707101961
1782 2712469431
1783 2739791996
1784 2753856715
1785 2765589809
1786 2772438167
1787 2775539744
1788 2777020743
1789 2791925054
1790 2792310371
1791 2793404946
1792 2807176492
1793 2809125550
1794 2813728110
1795 2814695654
1796 2821120829
1797 2823375463
1798 2844428166
1799 2844528976
1800 2846542088
1801 2847086795
1802 2847799148
1803 2852107601
1804 2854602361
1805 2855199668
1806 2858467691
1807 2865017448
1808 2869553494
1809 2871274131
1810 2871285256
1811 2876602933
1812 2881613964
1813 2881716541
1814 2884088154
1815 2887631988
1816 2888368182
1817 2888374207
1818 2891672160
1819 2896429545
1820 2900052291
1821 2904475557
1822 2904507975
1823 2904515606
1824 2908672261
1825 2916179317
1826 2919111279
1827 2919151726
1828 2919495762
1829 2919500320
1830 2919535310
1831 2919543401
1832 2919692183
1833 2923528442
1834 2923635630
1835 2927144395
1836 2927833402
1837 2928974064
1838 2932408386
1839 2935625973
1840 2937542655
1841 2937969908
1842 2939569831
1843 2939573075
1844 2939580047
1845 2939606942
1846 2939608890
1847 2939618272
1848 2939643165
1849 2941489202
1850 2945877070
1851 2945952380
1852 2969081325
1853 2971822744
1854 2974311322
1855 2974439061
1856 2977240969
1857 2978978869
1858 2984497357
1859 2984563788
1860 2984596521
1861 2990261308
1862 3000378596
1863 640937148
1864 8004597522
1865 8015397712
1866 8016735232
1867 8018223226
1868 8018409460
1869 8019501287
1870 8019505391
1871 8054360671
1872 8054846421
1873 8054851742
1874 8055088021
1875 8055095287
1876 8055098417
1877 8055695401
1878 8057307016

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08029

HisG_C

HisG, C-terminal domain

227

299

0.98

PF01634

HisG

ATP phosphoribosyltransferase

62

222

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ubi-assembly1.cif.gz_A catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp 0.99 5 220
5ub9-assembly1.cif.gz_A catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni 0.9768 6 225
5ubi-assembly1.cif.gz_A catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp 0.9765 5 220
5ub9-assembly1.cif.gz_A catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni 0.9681 6 225
4yb6-assembly1.cif.gz_A adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine 0.9193 5 295
ID Description Score Start End Superfamily
1q1kA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9917 102 190 3.40.190.10
4yb6F01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9704 6 225 3.40.190.10
1q1kA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.97 102 190 3.40.190.10
4yb6F01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9554 6 225 3.40.190.10
2vd3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 102 190 3.40.190.10
ID Description Score Start End GO Terms
AF-X1WWX8-F1-model_v4 deleted 0.9981 1 215
AF-A0A2J4V0M8-F1-model_v4 deleted 0.9957 1 216
AF-A0A7G2K1D4-F1-model_v4 ATP phosphoribosyltransferase (EC 2.4.2.17) 0.9941 62 194 GO:0000105
GO:0003879
GO:0005737
AF-A0A059UMJ5-F1-model_v4 ATP phosphoribosyltransferase (EC 2.4.2.17) 0.9918 49 189 GO:0000105
GO:0003879
GO:0005737
AF-A0A3S4IKW2-F1-model_v4 ATP phosphoribosyltransferase (EC 2.4.2.17) 0.9909 53 212 GO:0000105
GO:0003879
GO:0005737

Map