F486283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 458 | 1878 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10115790|Ga0157370_101157901 |
| Length | 302 |
| Sequence | MGRYKKKTIMTDRRLRIAVQKSGRLADRSGELISGAGLRILKGANELLYRIENQPIDLLRVRDDDIPTFVADGVAELGIVGYNVLAEHFPDRDLEEMIVQRLGFGSCTLKVAVPNDVDYTGPQWLEGKRIATSYPNILGKWLKDNGVTAEIVEMRGAVEVAPRMKIAHAICDLVSTGATLEANGMKATDLVLKSEAVLIKAPHAPPSELAHTYDMLLRRFDGVTASTGAKYVMMNAPKTHLDEIIRMIPGADAPTIMQLAGREDTVAVHAVCQENVFWDTLDKLKAAGASAILVLPIEKMMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 91 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 92 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 93 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 94 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 183 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 188 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 189 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 190 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 191 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 192 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 193 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 279 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 281 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 286 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 287 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 288 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 289 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 290 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 291 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 292 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 293 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 294 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 295 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 296 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 297 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 298 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 299 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 300 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 301 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 302 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 303 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 304 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 305 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 306 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 307 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 308 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 309 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 310 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 311 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 312 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 313 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 314 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 315 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 316 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 317 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 318 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 319 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 320 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 321 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 322 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 323 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 324 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 325 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 326 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 327 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 328 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 329 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 330 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 331 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 332 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 333 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 334 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 335 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 336 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 337 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 338 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 339 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 340 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 341 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 342 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 343 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 344 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 345 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 346 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 347 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 348 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 349 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 350 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 351 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 352 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 353 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 354 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 355 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 356 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 357 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 358 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 359 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 360 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 361 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 362 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 363 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 364 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 365 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 366 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 367 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 368 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 369 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 370 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 371 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 372 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 373 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 374 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 375 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 376 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 377 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 378 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 379 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 380 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 381 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 382 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 383 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 384 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 385 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 386 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 387 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 388 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 389 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 390 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 391 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 392 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 393 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 394 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 395 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 396 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 397 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 398 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 399 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 400 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 401 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 402 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 403 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 404 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 405 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 406 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 407 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 408 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 409 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 410 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 411 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 412 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 413 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 414 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 415 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 416 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 417 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 418 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 419 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 420 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 421 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 422 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 423 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 424 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 425 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 426 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 427 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 428 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 429 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 430 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 431 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 432 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 433 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 434 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 435 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 436 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 437 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 438 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 439 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 440 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 441 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 442 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 443 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 444 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 445 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 446 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 447 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 448 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 449 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 450 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 451 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 452 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 453 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 454 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 455 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 456 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 457 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 458 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.15 |
| Metatranscriptomes | 0.32 |
| Isolates | 18.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0.11 |
| Endosphere | 4.15 |
| Nodule | 2.13 |
| Rhizoplane | 7.14 |
| Rhizosphere | 66.99 |
| Stem | 0.11 |
| Stem Tuber | 0.64 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10115790 | 3300013104 | Bacteria | 2504 |
| 2 | SwRhRL2b_contig_3798929 | 2162886007 | Bacteria | 5542 |
| 3 | SwRhRL2b_contig_513557 | 2162886007 | Bacteria | 1650 |
| 4 | JGI24740J21852_10023081 | 3300001979 | Bacteria | 2131 |
| 5 | JGI24737J22298_10028251 | 3300001990 | Bacteria | 1764 |
| 6 | JGI25162J39368_1000019 | 3300002737 | Bacteria | 262053 |
| 7 | JGI25163J39215_1000121 | 3300002771 | Bacteria | 32543 |
| 8 | JGI25164J39214_1000011 | 3300002772 | Bacteria | 262057 |
| 9 | JGI25152J39213_1000139 | 3300002773 | Bacteria | 49588 |
| 10 | rootH2_10014876 | 3300003320 | Bacteria | 26475 |
| 11 | rootL2_10108836 | 3300003322 | Bacteria | 1086 |
| 12 | rootH1_10208222 | 3300003323 | Bacteria | 2125 |
| 13 | Ga0006562J51391_1018770 | 3300003578 | Bacteria | 6910 |
| 14 | Ga0055538_1000021 | 3300003751 | Bacteria | 262057 |
| 15 | Ga0055539_1000026 | 3300003752 | Bacteria | 262057 |
| 16 | Ga0055533_1000035 | 3300003756 | Bacteria | 262057 |
| 17 | Ga0055525_1000045 | 3300003759 | Bacteria | 262057 |
| 18 | Ga0055536_1000238 | 3300003781 | Bacteria | 44092 |
| 19 | Ga0055536_1032714 | 3300003781 | Bacteria | 1340 |
| 20 | Ga0055541_1000020 | 3300003841 | Bacteria | 262057 |
| 21 | Ga0058692_1000099 | 3300003856 | Bacteria | 57042 |
| 22 | Ga0058692_1000261 | 3300003856 | Bacteria | 28622 |
| 23 | Ga0058692_1000468 | 3300003856 | Bacteria | 18161 |
| 24 | Ga0058692_1000698 | 3300003856 | Bacteria | 13787 |
| 25 | Ga0058692_1001871 | 3300003856 | Bacteria | 7378 |
| 26 | Ga0058692_1004106 | 3300003856 | Bacteria | 4371 |
| 27 | Ga0058692_1005849 | 3300003856 | Bacteria | 3451 |
| 28 | Ga0058692_1008705 | 3300003856 | Bacteria | 2605 |
| 29 | Ga0058692_1009958 | 3300003856 | Bacteria | 2372 |
| 30 | Ga0065703_1021842 | 3300005272 | Bacteria | 1086 |
| 31 | Ga0065704_10000261 | 3300005289 | Bacteria | 53884 |
| 32 | Ga0065704_10000708 | 3300005289 | Bacteria | 46350 |
| 33 | Ga0065704_10003611 | 3300005289 | Bacteria | 6950 |
| 34 | Ga0065704_10070657 | 3300005289 | Bacteria | 18234 |
| 35 | Ga0065704_10216388 | 3300005289 | Bacteria | 1072 |
| 36 | Ga0070658_10000013 | 3300005327 | Bacteria | 267776 |
| 37 | Ga0070658_10028617 | 3300005327 | Bacteria | 4474 |
| 38 | Ga0070658_10054019 | 3300005327 | Bacteria | 3261 |
| 39 | Ga0070658_10203163 | 3300005327 | Bacteria | 1672 |
| 40 | Ga0070683_100077457 | 3300005329 | Bacteria | 3109 |
| 41 | Ga0070680_100000478 | 3300005336 | Bacteria | 27447 |
| 42 | Ga0070660_100001747 | 3300005339 | Bacteria | 14895 |
| 43 | Ga0070660_100017863 | 3300005339 | Bacteria | 5174 |
| 44 | Ga0070660_100041749 | 3300005339 | Bacteria | 3497 |
| 45 | Ga0070661_100001603 | 3300005344 | Bacteria | 15679 |
| 46 | Ga0070661_100070963 | 3300005344 | Bacteria | 2562 |
| 47 | Ga0070661_100101326 | 3300005344 | Bacteria | 2142 |
| 48 | Ga0070692_10000649 | 3300005345 | Bacteria | 11041 |
| 49 | Ga0070692_10030078 | 3300005345 | Bacteria | 2713 |
| 50 | Ga0070668_100009419 | 3300005347 | Bacteria | 7245 |
| 51 | Ga0070668_100249144 | 3300005347 | Unclassified | 1474 |
| 52 | Ga0070675_100287179 | 3300005354 | Bacteria | 1447 |
| 53 | Ga0070671_100006902 | 3300005355 | Bacteria | 9093 |
| 54 | Ga0070671_100053006 | 3300005355 | Bacteria | 3372 |
| 55 | Ga0070673_100167009 | 3300005364 | Bacteria | 1876 |
| 56 | Ga0070659_100004808 | 3300005366 | Bacteria | 9654 |
| 57 | Ga0070659_100062581 | 3300005366 | Bacteria | 2942 |
| 58 | Ga0070659_100089858 | 3300005366 | Bacteria | 2461 |
| 59 | Ga0070659_100305819 | 3300005366 | Bacteria | 1327 |
| 60 | Ga0070667_100467219 | 3300005367 | Bacteria | 1154 |
| 61 | Ga0070714_100103913 | 3300005435 | Bacteria | 2507 |
| 62 | Ga0070714_100154029 | 3300005435 | Bacteria | 2074 |
| 63 | Ga0070714_100188197 | 3300005435 | Bacteria | 1882 |
| 64 | Ga0070713_100014588 | 3300005436 | Bacteria | 5843 |
| 65 | Ga0070700_100088547 | 3300005441 | Bacteria | 2015 |
| 66 | Ga0070663_100006997 | 3300005455 | Bacteria | 6831 |
| 67 | Ga0070662_100012504 | 3300005457 | Bacteria | 5629 |
| 68 | Ga0070662_100135774 | 3300005457 | Bacteria | 1902 |
| 69 | Ga0070681_10015206 | 3300005458 | Bacteria | 7655 |
| 70 | Ga0070679_100000007 | 3300005530 | Bacteria | 195373 |
| 71 | Ga0070679_100103249 | 3300005530 | Bacteria | 2837 |
| 72 | Ga0070684_100099249 | 3300005535 | Bacteria | 2598 |
| 73 | Ga0070672_100220113 | 3300005543 | Bacteria | 1592 |
| 74 | Ga0070686_100000138 | 3300005544 | Bacteria | 50075 |
| 75 | Ga0070693_100243291 | 3300005547 | Bacteria | 1189 |
| 76 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 77 | Ga0070665_100000464 | 3300005548 | Bacteria | 58895 |
| 78 | Ga0070665_100003847 | 3300005548 | Bacteria | 15889 |
| 79 | Ga0070665_100230239 | 3300005548 | Bacteria | 1853 |
| 80 | Ga0070665_100345473 | 3300005548 | Unclassified | 1493 |
| 81 | Ga0070665_100593139 | 3300005548 | Bacteria | 1121 |
| 82 | Ga0068855_100038568 | 3300005563 | Bacteria | 5676 |
| 83 | Ga0068855_100172518 | 3300005563 | Bacteria | 2449 |
| 84 | Ga0068857_100000207 | 3300005577 | Bacteria | 38345 |
| 85 | Ga0068857_100004075 | 3300005577 | Bacteria | 12305 |
| 86 | Ga0068857_100169541 | 3300005577 | Bacteria | 1984 |
| 87 | Ga0068856_100008083 | 3300005614 | Bacteria | 10271 |
| 88 | Ga0068856_100285568 | 3300005614 | Bacteria | 1667 |
| 89 | Ga0068856_100630567 | 3300005614 | Bacteria | 1093 |
| 90 | Ga0068856_100650749 | 3300005614 | Bacteria | 1074 |
| 91 | Ga0068852_100003835 | 3300005616 | Bacteria | 10557 |
| 92 | Ga0068852_100311461 | 3300005616 | Bacteria | 1526 |
| 93 | Ga0068859_100002770 | 3300005617 | Bacteria | 17761 |
| 94 | Ga0068859_100032361 | 3300005617 | Bacteria | 5254 |
| 95 | Ga0068864_100115678 | 3300005618 | Bacteria | 2392 |
| 96 | Ga0068863_100000122 | 3300005841 | Bacteria | 81534 |
| 97 | Ga0068863_100023539 | 3300005841 | Bacteria | 5879 |
| 98 | Ga0068863_100115542 | 3300005841 | Bacteria | 2557 |
| 99 | Ga0068860_100018206 | 3300005843 | Bacteria | 6837 |
| 100 | Ga0068860_100253458 | 3300005843 | Bacteria | 1714 |
| 101 | Ga0068860_100409340 | 3300005843 | Unclassified | 1343 |
| 102 | Ga0068862_100090529 | 3300005844 | Bacteria | 2663 |
| 103 | Ga0068862_100103380 | 3300005844 | Bacteria | 2495 |
| 104 | Ga0068862_100122166 | 3300005844 | Bacteria | 2296 |
| 105 | Ga0081455_10026221 | 3300005937 | Bacteria | 5367 |
| 106 | Ga0070717_10054160 | 3300006028 | Bacteria | 3308 |
| 107 | Ga0075364_10004013 | 3300006051 | Bacteria | 8449 |
| 108 | Ga0070716_100037943 | 3300006173 | Bacteria | 2665 |
| 109 | Ga0075366_10052235 | 3300006195 | Bacteria | 2429 |
| 110 | Ga0075430_100018405 | 3300006846 | Bacteria | 5944 |
| 111 | Ga0075431_100499102 | 3300006847 | Unclassified | 1208 |
| 112 | Ga0097620_100002770 | 3300006931 | Bacteria | 17761 |
| 113 | Ga0097620_100032361 | 3300006931 | Bacteria | 5254 |
| 114 | Ga0079104_1000018 | 3300006946 | Bacteria | 271088 |
| 115 | Ga0079104_1000163 | 3300006946 | Bacteria | 94189 |
| 116 | Ga0079104_1000282 | 3300006946 | Bacteria | 65218 |
| 117 | Ga0079104_1000384 | 3300006946 | Bacteria | 51458 |
| 118 | Ga0079104_1000391 | 3300006946 | Bacteria | 50839 |
| 119 | Ga0079104_1001061 | 3300006946 | Bacteria | 20757 |
| 120 | Ga0079104_1005390 | 3300006946 | Bacteria | 5124 |
| 121 | Ga0079104_1006102 | 3300006946 | Bacteria | 4651 |
| 122 | Ga0105251_10000141 | 3300009011 | Bacteria | 73581 |
| 123 | Ga0105251_10000349 | 3300009011 | Bacteria | 45894 |
| 124 | Ga0105251_10000471 | 3300009011 | Bacteria | 38348 |
| 125 | Ga0105251_10001340 | 3300009011 | Bacteria | 21259 |
| 126 | Ga0105251_10002019 | 3300009011 | Bacteria | 16478 |
| 127 | Ga0105251_10004707 | 3300009011 | Bacteria | 9168 |
| 128 | Ga0105251_10006665 | 3300009011 | Bacteria | 7300 |
| 129 | Ga0105251_10010251 | 3300009011 | Bacteria | 5454 |
| 130 | Ga0105251_10022944 | 3300009011 | Bacteria | 3230 |
| 131 | Ga0105251_10053068 | 3300009011 | Bacteria | 1928 |
| 132 | Ga0105251_10091942 | 3300009011 | Bacteria | 1393 |
| 133 | Ga0105251_10196047 | 3300009011 | Bacteria | 910 |
| 134 | Ga0105244_10000009 | 3300009036 | Bacteria | 286143 |
| 135 | Ga0105244_10000123 | 3300009036 | Bacteria | 79547 |
| 136 | Ga0105244_10000347 | 3300009036 | Bacteria | 43582 |
| 137 | Ga0105244_10000636 | 3300009036 | Bacteria | 30959 |
| 138 | Ga0105244_10000818 | 3300009036 | Bacteria | 26304 |
| 139 | Ga0105244_10002573 | 3300009036 | Bacteria | 13616 |
| 140 | Ga0105244_10003693 | 3300009036 | Bacteria | 10816 |
| 141 | Ga0105244_10005634 | 3300009036 | Bacteria | 8274 |
| 142 | Ga0105244_10007967 | 3300009036 | Bacteria | 6670 |
| 143 | Ga0105244_10024207 | 3300009036 | Bacteria | 3315 |
| 144 | Ga0105244_10041144 | 3300009036 | Bacteria | 2396 |
| 145 | Ga0105244_10049734 | 3300009036 | Bacteria | 2140 |
| 146 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 147 | Ga0105250_10000100 | 3300009092 | Bacteria | 77155 |
| 148 | Ga0105250_10000601 | 3300009092 | Bacteria | 23494 |
| 149 | Ga0105250_10001115 | 3300009092 | Bacteria | 15152 |
| 150 | Ga0105250_10001849 | 3300009092 | Bacteria | 11037 |
| 151 | Ga0105250_10002145 | 3300009092 | Bacteria | 10129 |
| 152 | Ga0105250_10008211 | 3300009092 | Bacteria | 4445 |
| 153 | Ga0105240_10009039 | 3300009093 | Bacteria | 14150 |
| 154 | Ga0105240_10188986 | 3300009093 | Bacteria | 2423 |
| 155 | Ga0105240_10203458 | 3300009093 | Bacteria | 2319 |
| 156 | Ga0105245_10099199 | 3300009098 | Bacteria | 2692 |
| 157 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 158 | Ga0105243_10033993 | 3300009148 | Bacteria | 3945 |
| 159 | Ga0105241_10000005 | 3300009174 | Bacteria | 384203 |
| 160 | Ga0105248_10691697 | 3300009177 | Bacteria | 1150 |
| 161 | Ga0105237_10497238 | 3300009545 | Bacteria | 1226 |
| 162 | Ga0105238_10081994 | 3300009551 | Bacteria | 3215 |
| 163 | Ga0105249_10082479 | 3300009553 | Bacteria | 2991 |
| 164 | Ga0105239_10668242 | 3300010375 | Bacteria | 1187 |
| 165 | Ga0105246_10039694 | 3300011119 | Bacteria | 3173 |
| 166 | Ga0157373_10000110 | 3300013100 | Bacteria | 64710 |
| 167 | Ga0157373_10048988 | 3300013100 | Bacteria | 3012 |
| 168 | Ga0157373_10068289 | 3300013100 | Bacteria | 2512 |
| 169 | Ga0157373_10148992 | 3300013100 | Bacteria | 1646 |
| 170 | Ga0157371_10000098 | 3300013102 | Bacteria | 134017 |
| 171 | Ga0157371_10000673 | 3300013102 | Bacteria | 40561 |
| 172 | Ga0157371_10002717 | 3300013102 | Bacteria | 16693 |
| 173 | Ga0157371_10003439 | 3300013102 | Bacteria | 14361 |
| 174 | Ga0157371_10005924 | 3300013102 | Bacteria | 10208 |
| 175 | Ga0157371_10006411 | 3300013102 | Bacteria | 9716 |
| 176 | Ga0157371_10007406 | 3300013102 | Bacteria | 8893 |
| 177 | Ga0157371_10012018 | 3300013102 | Bacteria | 6638 |
| 178 | Ga0157371_10059481 | 3300013102 | Bacteria | 2708 |
| 179 | Ga0157371_10081337 | 3300013102 | Bacteria | 2294 |
| 180 | Ga0157370_10000445 | 3300013104 | Bacteria | 51701 |
| 181 | Ga0157370_10000707 | 3300013104 | Bacteria | 41767 |
| 182 | Ga0157370_10005108 | 3300013104 | Bacteria | 14804 |
| 183 | Ga0157370_10016493 | 3300013104 | Bacteria | 7475 |
| 184 | Ga0157370_10181254 | 3300013104 | Bacteria | 1957 |
| 185 | Ga0157370_10181396 | 3300013104 | Bacteria | 1956 |
| 186 | Ga0157369_10000988 | 3300013105 | Bacteria | 35979 |
| 187 | Ga0157369_10006229 | 3300013105 | Bacteria | 13845 |
| 188 | Ga0157369_10019715 | 3300013105 | Bacteria | 7546 |
| 189 | Ga0157369_10077912 | 3300013105 | Bacteria | 3552 |
| 190 | Ga0157369_10124326 | 3300013105 | Bacteria | 2736 |
| 191 | Ga0157369_10249797 | 3300013105 | Bacteria | 1851 |
| 192 | Ga0157369_10300009 | 3300013105 | Bacteria | 1671 |
| 193 | Ga0157378_10391212 | 3300013297 | Bacteria | 1367 |
| 194 | Ga0163162_10072654 | 3300013306 | Bacteria | 3495 |
| 195 | Ga0157372_10054735 | 3300013307 | Bacteria | 4453 |
| 196 | Ga0157372_10055595 | 3300013307 | Bacteria | 4420 |
| 197 | Ga0157372_10072400 | 3300013307 | Bacteria | 3884 |
| 198 | Ga0157372_10091434 | 3300013307 | Bacteria | 3461 |
| 199 | Ga0157372_10126381 | 3300013307 | Bacteria | 2940 |
| 200 | Ga0157372_10254223 | 3300013307 | Bacteria | 2040 |
| 201 | Ga0157372_10357124 | 3300013307 | Bacteria | 1702 |
| 202 | Ga0157375_10572828 | 3300013308 | Bacteria | 1290 |
| 203 | Ga0163163_10007998 | 3300014325 | Bacteria | 9357 |
| 204 | Ga0182008_10022168 | 3300014497 | Bacteria | 3253 |
| 205 | Ga0182008_10036789 | 3300014497 | Bacteria | 2449 |
| 206 | Ga0157377_10133047 | 3300014745 | Bacteria | 1521 |
| 207 | Ga0182006_1000018 | 3300015261 | Bacteria | 299376 |
| 208 | Ga0182006_1030626 | 3300015261 | Bacteria | 2173 |
| 209 | Ga0182007_10017056 | 3300015262 | Bacteria | 2662 |
| 210 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 211 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 212 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 213 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 214 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 215 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 216 | Ga0163161_10084750 | 3300017792 | Bacteria | 2337 |
| 217 | Ga0206353_11324343 | 3300020082 | Bacteria | 7984 |
| 218 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 219 | Ga0213872_10008462 | 3300021361 | Bacteria | 4979 |
| 220 | Ga0213872_10077011 | 3300021361 | Bacteria | 1500 |
| 221 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 222 | Ga0213876_10000034 | 3300021384 | Bacteria | 202967 |
| 223 | Ga0213876_10004247 | 3300021384 | Bacteria | 8038 |
| 224 | Ga0213876_10016435 | 3300021384 | Bacteria | 3911 |
| 225 | Ga0213876_10058546 | 3300021384 | Bacteria | 2034 |
| 226 | Ga0209760_100004 | 3300025207 | Bacteria | 254650 |
| 227 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 228 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 229 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 230 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 231 | Ga0207427_100012 | 3300025231 | Bacteria | 585657 |
| 232 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 233 | Ga0209437_100238 | 3300025233 | Bacteria | 90380 |
| 234 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 235 | Ga0209129_1000077 | 3300025258 | Bacteria | 193474 |
| 236 | Ga0209233_1012128 | 3300025261 | Bacteria | 2511 |
| 237 | Ga0209676_1000252 | 3300025292 | Bacteria | 113425 |
| 238 | Ga0209676_1004310 | 3300025292 | Bacteria | 8011 |
| 239 | Ga0209050_1003880 | 3300025298 | Bacteria | 10623 |
| 240 | Ga0209257_1000060 | 3300025304 | Bacteria | 372267 |
| 241 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 242 | Ga0207696_1000013 | 3300025711 | Bacteria | 524881 |
| 243 | Ga0207696_1000021 | 3300025711 | Bacteria | 432606 |
| 244 | Ga0207696_1000053 | 3300025711 | Bacteria | 268590 |
| 245 | Ga0207696_1000058 | 3300025711 | Bacteria | 248495 |
| 246 | Ga0207696_1001994 | 3300025711 | Bacteria | 10346 |
| 247 | Ga0207696_1002267 | 3300025711 | Bacteria | 9563 |
| 248 | Ga0207696_1003430 | 3300025711 | Bacteria | 7230 |
| 249 | Ga0207696_1003689 | 3300025711 | Bacteria | 6878 |
| 250 | Ga0207696_1003913 | 3300025711 | Bacteria | 6567 |
| 251 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 252 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 253 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 254 | Ga0207655_1000036 | 3300025728 | Bacteria | 356747 |
| 255 | Ga0207655_1000447 | 3300025728 | Bacteria | 54492 |
| 256 | Ga0207655_1000604 | 3300025728 | Bacteria | 43480 |
| 257 | Ga0207655_1000642 | 3300025728 | Bacteria | 41825 |
| 258 | Ga0207655_1000829 | 3300025728 | Bacteria | 33362 |
| 259 | Ga0207655_1003843 | 3300025728 | Bacteria | 10935 |
| 260 | Ga0207655_1007692 | 3300025728 | Bacteria | 6955 |
| 261 | Ga0207655_1010282 | 3300025728 | Bacteria | 5684 |
| 262 | Ga0207655_1028073 | 3300025728 | Bacteria | 2662 |
| 263 | Ga0207655_1081764 | 3300025728 | Bacteria | 1163 |
| 264 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 265 | Ga0207713_1000012 | 3300025735 | Bacteria | 501860 |
| 266 | Ga0207713_1000015 | 3300025735 | Bacteria | 424741 |
| 267 | Ga0207713_1000092 | 3300025735 | Bacteria | 148309 |
| 268 | Ga0207713_1000132 | 3300025735 | Bacteria | 113216 |
| 269 | Ga0207713_1000142 | 3300025735 | Bacteria | 107313 |
| 270 | Ga0207713_1000383 | 3300025735 | Bacteria | 47969 |
| 271 | Ga0207713_1010431 | 3300025735 | Bacteria | 5139 |
| 272 | Ga0207713_1012963 | 3300025735 | Bacteria | 4425 |
| 273 | Ga0207713_1018658 | 3300025735 | Bacteria | 3427 |
| 274 | Ga0207713_1023685 | 3300025735 | Bacteria | 2883 |
| 275 | Ga0207713_1032191 | 3300025735 | Bacteria | 2306 |
| 276 | Ga0207713_1100090 | 3300025735 | Bacteria | 1002 |
| 277 | Ga0207710_10000150 | 3300025900 | Bacteria | 79270 |
| 278 | Ga0207688_10067675 | 3300025901 | Bacteria | 2021 |
| 279 | Ga0207680_10204119 | 3300025903 | Bacteria | 1348 |
| 280 | Ga0207647_10007732 | 3300025904 | Bacteria | 7739 |
| 281 | Ga0207647_10010023 | 3300025904 | Bacteria | 6709 |
| 282 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 283 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 284 | Ga0207705_10032612 | 3300025909 | Bacteria | 3723 |
| 285 | Ga0207705_10310592 | 3300025909 | Bacteria | 1210 |
| 286 | Ga0207654_10000007 | 3300025911 | Bacteria | 384211 |
| 287 | Ga0207707_10027457 | 3300025912 | Bacteria | 4978 |
| 288 | Ga0207695_10010391 | 3300025913 | Bacteria | 11391 |
| 289 | Ga0207695_10016024 | 3300025913 | Bacteria | 8797 |
| 290 | Ga0207695_10235004 | 3300025913 | Bacteria | 1736 |
| 291 | Ga0207671_10320448 | 3300025914 | Bacteria | 1226 |
| 292 | Ga0207660_10000536 | 3300025917 | Bacteria | 25438 |
| 293 | Ga0207657_10004480 | 3300025919 | Bacteria | 14767 |
| 294 | Ga0207657_10023582 | 3300025919 | Bacteria | 5726 |
| 295 | Ga0207657_10027500 | 3300025919 | Bacteria | 5208 |
| 296 | Ga0207649_10000329 | 3300025920 | Bacteria | 35885 |
| 297 | Ga0207649_10001485 | 3300025920 | Bacteria | 13767 |
| 298 | Ga0207649_10018803 | 3300025920 | Bacteria | 3939 |
| 299 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 300 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 301 | Ga0207681_10054989 | 3300025923 | Bacteria | 2709 |
| 302 | Ga0207694_10050905 | 3300025924 | Bacteria | 3210 |
| 303 | Ga0207659_10028215 | 3300025926 | Bacteria | 3812 |
| 304 | Ga0207664_10168119 | 3300025929 | Bacteria | 1875 |
| 305 | Ga0207644_10000299 | 3300025931 | Bacteria | 32238 |
| 306 | Ga0207644_10000833 | 3300025931 | Bacteria | 19607 |
| 307 | Ga0207644_10022554 | 3300025931 | Bacteria | 4302 |
| 308 | Ga0207690_10005730 | 3300025932 | Bacteria | 7339 |
| 309 | Ga0207690_10009302 | 3300025932 | Bacteria | 5838 |
| 310 | Ga0207690_10025124 | 3300025932 | Bacteria | 3736 |
| 311 | Ga0207690_10051399 | 3300025932 | Bacteria | 2756 |
| 312 | Ga0207706_10006757 | 3300025933 | Bacteria | 10606 |
| 313 | Ga0207706_10124010 | 3300025933 | Bacteria | 2272 |
| 314 | Ga0207706_10273573 | 3300025933 | Bacteria | 1474 |
| 315 | Ga0207709_10005891 | 3300025935 | Bacteria | 6918 |
| 316 | Ga0207669_10008692 | 3300025937 | Bacteria | 4784 |
| 317 | Ga0207691_10087794 | 3300025940 | Bacteria | 2789 |
| 318 | Ga0207691_10221782 | 3300025940 | Bacteria | 1639 |
| 319 | Ga0207711_10112771 | 3300025941 | Bacteria | 2420 |
| 320 | Ga0207661_10021552 | 3300025944 | Bacteria | 4829 |
| 321 | Ga0207667_10013015 | 3300025949 | Bacteria | 9550 |
| 322 | Ga0207667_10015306 | 3300025949 | Bacteria | 8721 |
| 323 | Ga0207651_10319221 | 3300025960 | Bacteria | 1298 |
| 324 | Ga0207651_10465115 | 3300025960 | Bacteria | 1087 |
| 325 | Ga0207668_10000082 | 3300025972 | Bacteria | 71860 |
| 326 | Ga0207668_10082088 | 3300025972 | Bacteria | 2340 |
| 327 | Ga0207668_10238423 | 3300025972 | Unclassified | 1470 |
| 328 | Ga0207640_10000838 | 3300025981 | Bacteria | 17511 |
| 329 | Ga0207640_10059204 | 3300025981 | Bacteria | 2527 |
| 330 | Ga0207639_10043827 | 3300026041 | Bacteria | 3361 |
| 331 | Ga0207639_10073093 | 3300026041 | Bacteria | 2687 |
| 332 | Ga0207639_10112571 | 3300026041 | Bacteria | 2221 |
| 333 | Ga0207678_10004283 | 3300026067 | Bacteria | 12797 |
| 334 | Ga0207678_10029828 | 3300026067 | Bacteria | 4762 |
| 335 | Ga0207678_10213377 | 3300026067 | Bacteria | 1651 |
| 336 | Ga0207708_10072486 | 3300026075 | Bacteria | 2639 |
| 337 | Ga0207702_10031878 | 3300026078 | Bacteria | 4396 |
| 338 | Ga0207702_10075148 | 3300026078 | Bacteria | 2918 |
| 339 | Ga0207702_10143550 | 3300026078 | Bacteria | 2163 |
| 340 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 341 | Ga0207641_10011857 | 3300026088 | Bacteria | 7154 |
| 342 | Ga0207676_10018047 | 3300026095 | Bacteria | 5122 |
| 343 | Ga0207674_10000132 | 3300026116 | Bacteria | 87692 |
| 344 | Ga0207674_10007565 | 3300026116 | Bacteria | 12655 |
| 345 | Ga0207698_10015058 | 3300026142 | Bacteria | 5166 |
| 346 | Ga0207698_10177272 | 3300026142 | Bacteria | 1884 |
| 347 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 348 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 349 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 350 | Ga0209281_1000027 | 3300027111 | Bacteria | 463409 |
| 351 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 352 | Ga0209281_1000071 | 3300027111 | Bacteria | 274050 |
| 353 | Ga0209281_1000257 | 3300027111 | Bacteria | 103090 |
| 354 | Ga0209281_1000370 | 3300027111 | Bacteria | 72879 |
| 355 | Ga0209281_1000714 | 3300027111 | Bacteria | 33175 |
| 356 | Ga0209281_1001392 | 3300027111 | Bacteria | 14777 |
| 357 | Ga0209281_1004837 | 3300027111 | Bacteria | 3910 |
| 358 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 359 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 360 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 361 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 362 | Ga0209371_1000099 | 3300027312 | Bacteria | 154918 |
| 363 | Ga0209371_1000100 | 3300027312 | Bacteria | 154467 |
| 364 | Ga0209371_1000120 | 3300027312 | Bacteria | 132938 |
| 365 | Ga0209371_1000731 | 3300027312 | Bacteria | 27606 |
| 366 | Ga0209371_1000778 | 3300027312 | Bacteria | 26405 |
| 367 | Ga0209371_1000964 | 3300027312 | Bacteria | 22330 |
| 368 | Ga0209371_1001841 | 3300027312 | Bacteria | 13120 |
| 369 | Ga0209371_1002061 | 3300027312 | Bacteria | 11984 |
| 370 | Ga0209371_1003104 | 3300027312 | Bacteria | 8471 |
| 371 | Ga0209371_1003934 | 3300027312 | Bacteria | 6816 |
| 372 | Ga0209371_1007662 | 3300027312 | Bacteria | 3720 |
| 373 | Ga0209371_1009080 | 3300027312 | Bacteria | 3201 |
| 374 | Ga0268266_10000103 | 3300028379 | Bacteria | 179736 |
| 375 | Ga0268266_10000286 | 3300028379 | Bacteria | 83269 |
| 376 | Ga0268266_10000514 | 3300028379 | Bacteria | 54510 |
| 377 | Ga0268266_10195106 | 3300028379 | Bacteria | 1850 |
| 378 | Ga0268265_10119029 | 3300028380 | Bacteria | 2172 |
| 379 | Ga0268264_10010903 | 3300028381 | Bacteria | 7509 |
| 380 | Ga0268264_10012883 | 3300028381 | Bacteria | 6879 |
| 381 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 382 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 383 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 384 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 385 | Ga0268256_1000035 | 3300030500 | Bacteria | 384794 |
| 386 | Ga0268256_1000089 | 3300030500 | Bacteria | 154491 |
| 387 | Ga0268256_1000423 | 3300030500 | Bacteria | 38191 |
| 388 | Ga0268256_1000714 | 3300030500 | Bacteria | 24660 |
| 389 | Ga0268256_1000873 | 3300030500 | Bacteria | 21021 |
| 390 | Ga0268256_1001822 | 3300030500 | Bacteria | 11984 |
| 391 | Ga0268256_1003781 | 3300030500 | Bacteria | 6623 |
| 392 | Ga0268256_1004445 | 3300030500 | Bacteria | 5810 |
| 393 | Ga0268256_1005198 | 3300030500 | Bacteria | 5168 |
| 394 | Ga0265327_10016858 | 3300031251 | Bacteria | 4616 |
| 395 | Ga0307408_100001207 | 3300031548 | Bacteria | 19481 |
| 396 | Ga0307405_10001717 | 3300031731 | Bacteria | 9351 |
| 397 | Ga0307413_10000666 | 3300031824 | Bacteria | 11694 |
| 398 | Ga0307413_10177276 | 3300031824 | Bacteria | 1515 |
| 399 | Ga0307410_10002549 | 3300031852 | Bacteria | 8824 |
| 400 | Ga0307410_10159736 | 3300031852 | Bacteria | 1687 |
| 401 | Ga0307410_10177615 | 3300031852 | Bacteria | 1609 |
| 402 | Ga0307410_10205837 | 3300031852 | Bacteria | 1505 |
| 403 | Ga0307406_10001991 | 3300031901 | Bacteria | 11165 |
| 404 | Ga0307406_10003346 | 3300031901 | Bacteria | 8737 |
| 405 | Ga0307406_10296136 | 3300031901 | Bacteria | 1241 |
| 406 | Ga0307407_10000195 | 3300031903 | Bacteria | 18328 |
| 407 | Ga0307412_10002981 | 3300031911 | Bacteria | 9387 |
| 408 | Ga0307412_10081574 | 3300031911 | Bacteria | 2237 |
| 409 | Ga0307412_10343388 | 3300031911 | Bacteria | 1196 |
| 410 | Ga0307409_100026891 | 3300031995 | Bacteria | 4066 |
| 411 | Ga0307409_100082730 | 3300031995 | Bacteria | 2600 |
| 412 | Ga0307409_100370035 | 3300031995 | Bacteria | 1359 |
| 413 | Ga0307416_100001750 | 3300032002 | Bacteria | 12019 |
| 414 | Ga0307414_10001053 | 3300032004 | Bacteria | 14103 |
| 415 | Ga0307414_10003789 | 3300032004 | Bacteria | 8126 |
| 416 | Ga0307414_10005946 | 3300032004 | Bacteria | 6758 |
| 417 | Ga0307414_10037640 | 3300032004 | Bacteria | 3242 |
| 418 | Ga0307414_10076705 | 3300032004 | Bacteria | 2429 |
| 419 | Ga0307414_10235849 | 3300032004 | Bacteria | 1511 |
| 420 | Ga0307414_10238395 | 3300032004 | Bacteria | 1504 |
| 421 | Ga0307414_10356926 | 3300032004 | Bacteria | 1256 |
| 422 | Ga0307411_10000206 | 3300032005 | Bacteria | 18997 |
| 423 | Ga0307411_10002634 | 3300032005 | Bacteria | 8032 |
| 424 | Ga0307411_10030860 | 3300032005 | Bacteria | 3290 |
| 425 | Ga0307411_10193156 | 3300032005 | Bacteria | 1556 |
| 426 | Ga0307411_10263980 | 3300032005 | Bacteria | 1361 |
| 427 | Ga0307415_100008908 | 3300032126 | Bacteria | 5590 |
| 428 | Ga0307415_100089979 | 3300032126 | Bacteria | 2219 |
| 429 | Ga0316593_10041632 | 3300032168 | Bacteria | 1529 |
| 430 | Ga0395899_0000184 | 3300037312 | Bacteria | 91815 |
| 431 | Ga0395899_0000264 | 3300037312 | Bacteria | 68569 |
| 432 | Ga0395899_0008407 | 3300037312 | Bacteria | 7946 |
| 433 | Ga0395899_0033067 | 3300037312 | Bacteria | 3885 |
| 434 | Ga0395899_0050095 | 3300037312 | Bacteria | 3102 |
| 435 | Ga0395899_0080052 | 3300037312 | Bacteria | 2378 |
| 436 | Ga0395899_0089388 | 3300037312 | Bacteria | 2234 |
| 437 | Ga0395899_0100835 | 3300037312 | Bacteria | 2084 |
| 438 | Ga0395899_0188198 | 3300037312 | Bacteria | 1445 |
| 439 | Ga0395899_0240342 | 3300037312 | Bacteria | 1247 |
| 440 | Ga0395900_0000723 | 3300037418 | Bacteria | 43948 |
| 441 | Ga0395900_0003562 | 3300037418 | Bacteria | 16749 |
| 442 | Ga0395900_0015186 | 3300037418 | Bacteria | 7852 |
| 443 | Ga0395900_0015753 | 3300037418 | Bacteria | 7707 |
| 444 | Ga0395900_0016216 | 3300037418 | Bacteria | 7590 |
| 445 | Ga0395900_0018901 | 3300037418 | Bacteria | 7028 |
| 446 | Ga0395900_0023262 | 3300037418 | Bacteria | 6342 |
| 447 | Ga0395900_0036036 | 3300037418 | Bacteria | 5098 |
| 448 | Ga0395900_0063713 | 3300037418 | Bacteria | 3789 |
| 449 | Ga0395900_0143855 | 3300037418 | Bacteria | 2440 |
| 450 | Ga0395900_0167208 | 3300037418 | Bacteria | 2241 |
| 451 | Ga0395900_0248444 | 3300037418 | Bacteria | 1781 |
| 452 | Ga0395900_0259066 | 3300037418 | Bacteria | 1738 |
| 453 | Ga0395900_0489788 | 3300037418 | Bacteria | 1181 |
| 454 | Ga0395900_0493594 | 3300037418 | Bacteria | 1175 |
| 455 | Ga0395900_0540726 | 3300037418 | Bacteria | 1111 |
| 456 | Ga0395898_0000087 | 3300037466 | Bacteria | 239211 |
| 457 | Ga0395898_0004020 | 3300037466 | Bacteria | 16164 |
| 458 | Ga0395898_0011911 | 3300037466 | Bacteria | 9007 |
| 459 | Ga0395898_0018469 | 3300037466 | Bacteria | 7110 |
| 460 | Ga0395898_0101522 | 3300037466 | Bacteria | 2762 |
| 461 | Ga0395898_0106782 | 3300037466 | Bacteria | 2685 |
| 462 | Ga0395898_0144648 | 3300037466 | Unclassified | 2276 |
| 463 | Ga0395898_0170038 | 3300037466 | Bacteria | 2083 |
| 464 | Ga0395898_0418492 | 3300037466 | Bacteria | 1277 |
| 465 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 466 | Ga0395905_0000070 | 3300037471 | Bacteria | 175662 |
| 467 | Ga0395905_0002000 | 3300037471 | Bacteria | 23293 |
| 468 | Ga0395905_0002910 | 3300037471 | Bacteria | 18678 |
| 469 | Ga0395905_0005131 | 3300037471 | Bacteria | 13445 |
| 470 | Ga0395905_0006920 | 3300037471 | Bacteria | 11334 |
| 471 | Ga0395905_0017740 | 3300037471 | Bacteria | 6758 |
| 472 | Ga0395905_0020118 | 3300037471 | Bacteria | 6324 |
| 473 | Ga0395905_0022485 | 3300037471 | Bacteria | 5963 |
| 474 | Ga0395905_0036963 | 3300037471 | Bacteria | 4587 |
| 475 | Ga0395905_0040140 | 3300037471 | Bacteria | 4390 |
| 476 | Ga0395905_0051191 | 3300037471 | Bacteria | 3868 |
| 477 | Ga0395905_0069944 | 3300037471 | Bacteria | 3288 |
| 478 | Ga0395905_0102146 | 3300037471 | Bacteria | 2691 |
| 479 | Ga0395905_0346261 | 3300037471 | Bacteria | 1378 |
| 480 | Ga0395905_0488463 | 3300037471 | Bacteria | 1131 |
| 481 | Ga0395901_0001808 | 3300038443 | Bacteria | 22093 |
| 482 | Ga0395901_0004038 | 3300038443 | Bacteria | 14781 |
| 483 | Ga0395901_0015103 | 3300038443 | Bacteria | 7852 |
| 484 | Ga0395901_0015235 | 3300038443 | Bacteria | 7823 |
| 485 | Ga0395901_0024583 | 3300038443 | Bacteria | 6185 |
| 486 | Ga0395901_0035231 | 3300038443 | Bacteria | 5171 |
| 487 | Ga0395901_0036907 | 3300038443 | Bacteria | 5053 |
| 488 | Ga0395901_0039387 | 3300038443 | Bacteria | 4890 |
| 489 | Ga0395901_0081178 | 3300038443 | Bacteria | 3387 |
| 490 | Ga0395901_0113760 | 3300038443 | Bacteria | 2842 |
| 491 | Ga0395901_0162518 | 3300038443 | Bacteria | 2345 |
| 492 | Ga0395901_0205851 | 3300038443 | Bacteria | 2061 |
| 493 | Ga0395901_0430976 | 3300038443 | Bacteria | 1351 |
| 494 | Ga0395901_0642065 | 3300038443 | Bacteria | 1066 |
| 495 | Ga0400483_152581 | 3300039062 | Bacteria | 13902 |
| 496 | Ga0436365_0674409 | 3300039437 | Bacteria | 5482 |
| 497 | Ga0436365_0689373 | 3300039437 | Bacteria | 73333 |
| 498 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 499 | Ga0436365_0970858 | 3300039437 | Bacteria | 175279 |
| 500 | Ga0436365_1116037 | 3300039437 | Bacteria | 5188 |
| 501 | Ga0436365_1186688 | 3300039437 | Bacteria | 17067 |
| 502 | Ga0436361_0292016 | 3300039447 | Bacteria | 6241 |
| 503 | Ga0436361_0340720 | 3300039447 | Bacteria | 2892 |
| 504 | Ga0436362_0554113 | 3300039453 | Bacteria | 162652 |
| 505 | Ga0436362_1252872 | 3300039453 | Bacteria | 1274 |
| 506 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 507 | Ga0439438_003831 | 3300041405 | Bacteria | 5935 |
| 508 | Ga0439438_031555 | 3300041405 | Bacteria | 1407 |
| 509 | Ga0439447_008214 | 3300041407 | Bacteria | 3248 |
| 510 | Ga0439447_008992 | 3300041407 | Bacteria | 3059 |
| 511 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 512 | Ga0439445_0000014 | 3300042004 | Bacteria | 23823 |
| 513 | Ga0439432_009149 | 3300042006 | Bacteria | 3460 |
| 514 | Ga0439432_011912 | 3300042006 | Bacteria | 2988 |
| 515 | Ga0439432_013062 | 3300042006 | Bacteria | 2830 |
| 516 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 517 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 518 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 519 | Ga0439452_000031 | 3300042010 | Bacteria | 196691 |
| 520 | Ga0439462_0053521 | 3300042015 | Bacteria | 1087 |
| 521 | Ga0439463_008381 | 3300042016 | Bacteria | 2549 |
| 522 | Ga0450912_000309 | 3300042116 | Bacteria | 2236 |
| 523 | Ga0450923_017616 | 3300042125 | Bacteria | 1358 |
| 524 | Ga0450907_000295 | 3300042146 | Bacteria | 16845 |
| 525 | Ga0439446_0051763 | 3300042156 | Bacteria | 1228 |
| 526 | Ga0439458_0000243 | 3300042157 | Bacteria | 13137 |
| 527 | Ga0439458_0001940 | 3300042157 | Bacteria | 5130 |
| 528 | Ga0439464_0003158 | 3300042439 | Bacteria | 4132 |
| 529 | Ga0451577_0019045 | 3300042876 | Bacteria | 6318 |
| 530 | Ga0466969_0000781 | 3300044656 | Bacteria | 17373 |
| 531 | Ga0466969_0028998 | 3300044656 | Bacteria | 2828 |
| 532 | Ga0466981_0000003 | 3300044669 | Bacteria | 248458 |
| 533 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 534 | Ga0466966_0000173 | 3300044684 | Bacteria | 42521 |
| 535 | Ga0466966_0000802 | 3300044684 | Bacteria | 19991 |
| 536 | Ga0466966_0000939 | 3300044684 | Bacteria | 18614 |
| 537 | Ga0466966_0058404 | 3300044684 | Bacteria | 2438 |
| 538 | Ga0466961_0000530 | 3300044693 | Bacteria | 24196 |
| 539 | Ga0466961_0001878 | 3300044693 | Bacteria | 13060 |
| 540 | Ga0466961_0039489 | 3300044693 | Bacteria | 3026 |
| 541 | Ga0466961_0076757 | 3300044693 | Bacteria | 2117 |
| 542 | Ga0466961_0079904 | 3300044693 | Bacteria | 2070 |
| 543 | Ga0466961_0085520 | 3300044693 | Bacteria | 1994 |
| 544 | Ga0466963_0012559 | 3300044694 | Bacteria | 5188 |
| 545 | Ga0466963_0025445 | 3300044694 | Bacteria | 3775 |
| 546 | Ga0466964_0194880 | 3300044706 | Bacteria | 969 |
| 547 | Ga0466971_0000414 | 3300044719 | Bacteria | 16681 |
| 548 | Ga0466968_0016031 | 3300044735 | Bacteria | 2978 |
| 549 | Ga0466970_0000836 | 3300044765 | Bacteria | 14806 |
| 550 | Ga0466970_0016422 | 3300044765 | Bacteria | 3817 |
| 551 | Ga0466957_0001326 | 3300044842 | Bacteria | 12924 |
| 552 | Ga0466957_0009306 | 3300044842 | Bacteria | 5605 |
| 553 | Ga0466957_0036436 | 3300044842 | Bacteria | 2957 |
| 554 | Ga0466957_0063314 | 3300044842 | Bacteria | 2273 |
| 555 | Ga0466957_0193361 | 3300044842 | Bacteria | 1334 |
| 556 | Ga0466959_0000108 | 3300045049 | Bacteria | 53075 |
| 557 | Ga0466959_0008432 | 3300045049 | Bacteria | 7288 |
| 558 | Ga0466959_0013571 | 3300045049 | Bacteria | 5907 |
| 559 | Ga0466959_0096742 | 3300045049 | Bacteria | 2116 |
| 560 | Ga0466959_0155022 | 3300045049 | Bacteria | 1612 |
| 561 | Ga0466958_0001249 | 3300045836 | Bacteria | 11903 |
| 562 | Ga0466958_0001949 | 3300045836 | Bacteria | 10125 |
| 563 | Ga0466958_0022630 | 3300045836 | Bacteria | 3684 |
| 564 | Ga0466958_0026893 | 3300045836 | Bacteria | 3401 |
| 565 | Ga0466967_0044572 | 3300045976 | Bacteria | 3848 |
| 566 | Ga0466967_0201029 | 3300045976 | Bacteria | 1887 |
| 567 | Ga0466967_0336944 | 3300045976 | Bacteria | 1458 |
| 568 | Ga0466967_0510636 | 3300045976 | Bacteria | 1180 |
| 569 | Ga0495617_066763 | 3300046452 | Bacteria | 1185 |
| 570 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 571 | Ga0495591_000050 | 3300046458 | Bacteria | 137772 |
| 572 | Ga0495591_000059 | 3300046458 | Bacteria | 130522 |
| 573 | Ga0495638_0021694 | 3300046460 | Bacteria | 4225 |
| 574 | Ga0495650_0000031 | 3300046471 | Bacteria | 433811 |
| 575 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 576 | Ga0495650_0000182 | 3300046471 | Bacteria | 137031 |
| 577 | Ga0495605_0016907 | 3300046474 | Bacteria | 3940 |
| 578 | Ga0495585_0004843 | 3300046492 | Bacteria | 8641 |
| 579 | Ga0495596_0013908 | 3300046500 | Bacteria | 3399 |
| 580 | Ga0495607_0045969 | 3300046501 | Bacteria | 2566 |
| 581 | Ga0495606_0003900 | 3300046507 | Bacteria | 15370 |
| 582 | Ga0495616_0034318 | 3300046513 | Bacteria | 2636 |
| 583 | Ga0495620_0009743 | 3300046515 | Bacteria | 5099 |
| 584 | Ga0495637_0085427 | 3300046520 | Bacteria | 1252 |
| 585 | Ga0495643_0017719 | 3300046522 | Bacteria | 4157 |
| 586 | Ga0495644_0012461 | 3300046523 | Bacteria | 3269 |
| 587 | Ga0495648_0001866 | 3300046524 | Bacteria | 20143 |
| 588 | Ga0495648_0015572 | 3300046524 | Bacteria | 5516 |
| 589 | Ga0495654_0000009 | 3300046530 | Bacteria | 381872 |
| 590 | Ga0495654_0000068 | 3300046530 | Bacteria | 125533 |
| 591 | Ga0495654_0000596 | 3300046530 | Bacteria | 28899 |
| 592 | Ga0495598_0006796 | 3300046537 | Bacteria | 2597 |
| 593 | Ga0495621_0000983 | 3300046539 | Bacteria | 7289 |
| 594 | Ga0495597_0002098 | 3300046542 | Bacteria | 13248 |
| 595 | Ga0495633_0000162 | 3300046558 | Bacteria | 87434 |
| 596 | Ga0495633_0010150 | 3300046558 | Bacteria | 5156 |
| 597 | Ga0495625_0003714 | 3300046660 | Bacteria | 14888 |
| 598 | Ga0495625_0049949 | 3300046660 | Bacteria | 3004 |
| 599 | Ga0495588_0047665 | 3300046674 | Bacteria | 2200 |
| 600 | Ga0495670_0015196 | 3300046691 | Bacteria | 3786 |
| 601 | Ga0495649_0000165 | 3300046694 | Bacteria | 57643 |
| 602 | Ga0495649_0004029 | 3300046694 | Bacteria | 9675 |
| 603 | Ga0495649_0004333 | 3300046694 | Bacteria | 9308 |
| 604 | Ga0495649_0007728 | 3300046694 | Bacteria | 6529 |
| 605 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 606 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 607 | Ga0495660_0000015 | 3300046810 | Bacteria | 324892 |
| 608 | Ga0495660_0045452 | 3300046810 | Bacteria | 2410 |
| 609 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 610 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 611 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 612 | Ga0495676_0276541 | 3300047321 | Bacteria | 1138 |
| 613 | Ga0495679_000309 | 3300047446 | Bacteria | 39033 |
| 614 | Ga0495679_003403 | 3300047446 | Bacteria | 7665 |
| 615 | Ga0495679_006075 | 3300047446 | Bacteria | 5267 |
| 616 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 617 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 618 | Ga0496100_0002186 | 3300048903 | Bacteria | 9870 |
| 619 | Ga0496101_0000157 | 3300048904 | Bacteria | 57989 |
| 620 | Ga0496102_0017189 | 3300048905 | Bacteria | 6334 |
| 621 | Ga0496104_0000158 | 3300048907 | Bacteria | 61536 |
| 622 | Ga0496104_0002904 | 3300048907 | Bacteria | 14766 |
| 623 | Ga0496105_0005660 | 3300048908 | Bacteria | 9509 |
| 624 | Ga0496105_0096668 | 3300048908 | Bacteria | 2439 |
| 625 | Ga0496109_0035306 | 3300048912 | Bacteria | 4509 |
| 626 | Ga0496110_0110046 | 3300048913 | Bacteria | 2475 |
| 627 | Ga0496112_0123313 | 3300048915 | Bacteria | 2562 |
| 628 | Ga0496113_0083843 | 3300048916 | Bacteria | 2446 |
| 629 | Ga0496113_0399362 | 3300048916 | Bacteria | 1104 |
| 630 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 631 | Ga0496116_0000094 | 3300048919 | Bacteria | 205588 |
| 632 | Ga0496116_0000110 | 3300048919 | Bacteria | 185668 |
| 633 | Ga0496116_0000140 | 3300048919 | Bacteria | 151165 |
| 634 | Ga0496116_0000625 | 3300048919 | Bacteria | 46424 |
| 635 | Ga0496116_0005122 | 3300048919 | Bacteria | 12308 |
| 636 | Ga0496116_0042463 | 3300048919 | Bacteria | 3107 |
| 637 | Ga0496116_0076052 | 3300048919 | Bacteria | 2105 |
| 638 | Ga0496117_0000009 | 3300048920 | Bacteria | 613759 |
| 639 | Ga0496117_0000138 | 3300048920 | Bacteria | 159456 |
| 640 | Ga0496117_0000154 | 3300048920 | Bacteria | 146606 |
| 641 | Ga0496117_0000380 | 3300048920 | Bacteria | 76671 |
| 642 | Ga0496117_0000835 | 3300048920 | Bacteria | 47629 |
| 643 | Ga0496117_0007932 | 3300048920 | Bacteria | 10201 |
| 644 | Ga0496117_0012591 | 3300048920 | Bacteria | 7441 |
| 645 | Ga0496117_0015662 | 3300048920 | Bacteria | 6444 |
| 646 | Ga0496117_0079691 | 3300048920 | Bacteria | 2156 |
| 647 | Ga0496117_0109624 | 3300048920 | Bacteria | 1723 |
| 648 | Ga0496118_0000017 | 3300048921 | Bacteria | 549445 |
| 649 | Ga0496118_0000150 | 3300048921 | Bacteria | 123251 |
| 650 | Ga0496118_0000158 | 3300048921 | Bacteria | 121361 |
| 651 | Ga0496118_0001286 | 3300048921 | Bacteria | 38322 |
| 652 | Ga0496118_0003879 | 3300048921 | Bacteria | 18358 |
| 653 | Ga0496118_0005328 | 3300048921 | Bacteria | 14648 |
| 654 | Ga0496118_0009114 | 3300048921 | Bacteria | 10097 |
| 655 | Ga0496118_0034368 | 3300048921 | Bacteria | 4138 |
| 656 | Ga0496118_0038462 | 3300048921 | Bacteria | 3834 |
| 657 | Ga0496118_0055527 | 3300048921 | Bacteria | 2987 |
| 658 | Ga0496118_0218215 | 3300048921 | Bacteria | 1112 |
| 659 | Ga0496119_0000012 | 3300048922 | Bacteria | 411917 |
| 660 | Ga0496119_0000027 | 3300048922 | Bacteria | 249124 |
| 661 | Ga0496119_0000049 | 3300048922 | Bacteria | 185482 |
| 662 | Ga0496119_0004375 | 3300048922 | Bacteria | 14096 |
| 663 | Ga0496119_0004462 | 3300048922 | Bacteria | 13925 |
| 664 | Ga0496119_0006885 | 3300048922 | Bacteria | 10375 |
| 665 | Ga0496119_0015911 | 3300048922 | Bacteria | 5758 |
| 666 | Ga0496119_0017287 | 3300048922 | Bacteria | 5432 |
| 667 | Ga0496119_0018326 | 3300048922 | Bacteria | 5220 |
| 668 | Ga0496119_0020904 | 3300048922 | Bacteria | 4749 |
| 669 | Ga0496119_0026577 | 3300048922 | Bacteria | 4009 |
| 670 | Ga0496120_0000004 | 3300048923 | Bacteria | 534793 |
| 671 | Ga0496120_0000022 | 3300048923 | Bacteria | 249124 |
| 672 | Ga0496120_0000048 | 3300048923 | Bacteria | 187988 |
| 673 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 674 | Ga0496120_0000057 | 3300048923 | Bacteria | 177460 |
| 675 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 676 | Ga0496120_0001027 | 3300048923 | Bacteria | 37319 |
| 677 | Ga0496120_0002674 | 3300048923 | Bacteria | 17528 |
| 678 | Ga0496120_0003623 | 3300048923 | Bacteria | 13860 |
| 679 | Ga0496120_0004742 | 3300048923 | Bacteria | 11163 |
| 680 | Ga0496120_0032115 | 3300048923 | Bacteria | 3169 |
| 681 | Ga0496120_0042229 | 3300048923 | Bacteria | 2664 |
| 682 | Ga0496121_0000389 | 3300048924 | Bacteria | 89759 |
| 683 | Ga0496121_0001226 | 3300048924 | Bacteria | 44634 |
| 684 | Ga0496121_0007606 | 3300048924 | Bacteria | 13034 |
| 685 | Ga0496121_0012388 | 3300048924 | Bacteria | 9311 |
| 686 | Ga0496121_0013317 | 3300048924 | Bacteria | 8852 |
| 687 | Ga0496121_0016076 | 3300048924 | Bacteria | 7755 |
| 688 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 689 | Ga0496122_0000007 | 3300048925 | Bacteria | 606493 |
| 690 | Ga0496122_0000088 | 3300048925 | Bacteria | 207600 |
| 691 | Ga0496122_0002515 | 3300048925 | Bacteria | 25867 |
| 692 | Ga0496122_0002765 | 3300048925 | Bacteria | 24195 |
| 693 | Ga0496122_0014001 | 3300048925 | Bacteria | 7793 |
| 694 | Ga0496122_0027761 | 3300048925 | Bacteria | 4827 |
| 695 | Ga0496122_0029152 | 3300048925 | Bacteria | 4662 |
| 696 | Ga0496122_0033217 | 3300048925 | Bacteria | 4249 |
| 697 | Ga0496122_0154784 | 3300048925 | Bacteria | 1408 |
| 698 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 699 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 700 | Ga0496123_0000139 | 3300048926 | Bacteria | 151469 |
| 701 | Ga0496123_0000811 | 3300048926 | Bacteria | 50435 |
| 702 | Ga0496123_0001770 | 3300048926 | Bacteria | 28492 |
| 703 | Ga0496123_0002175 | 3300048926 | Bacteria | 25005 |
| 704 | Ga0496123_0008368 | 3300048926 | Bacteria | 9513 |
| 705 | Ga0496123_0012229 | 3300048926 | Bacteria | 7341 |
| 706 | Ga0496123_0012648 | 3300048926 | Bacteria | 7167 |
| 707 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 708 | Ga0496124_0000025 | 3300048927 | Bacteria | 405471 |
| 709 | Ga0496124_0000045 | 3300048927 | Bacteria | 287396 |
| 710 | Ga0496124_0000484 | 3300048927 | Bacteria | 68281 |
| 711 | Ga0496124_0001484 | 3300048927 | Bacteria | 34470 |
| 712 | Ga0496124_0004039 | 3300048927 | Bacteria | 17427 |
| 713 | Ga0496124_0020650 | 3300048927 | Bacteria | 6079 |
| 714 | Ga0496124_0033130 | 3300048927 | Bacteria | 4548 |
| 715 | Ga0496124_0059533 | 3300048927 | Bacteria | 3208 |
| 716 | Ga0496124_0110800 | 3300048927 | Bacteria | 2209 |
| 717 | Ga0496124_0125319 | 3300048927 | Bacteria | 2047 |
| 718 | Ga0496124_0174349 | 3300048927 | Bacteria | 1662 |
| 719 | Ga0496124_0229331 | 3300048927 | Bacteria | 1390 |
| 720 | Ga0496125_0000013 | 3300048928 | Bacteria | 628761 |
| 721 | Ga0496125_0000065 | 3300048928 | Bacteria | 249830 |
| 722 | Ga0496125_0001229 | 3300048928 | Bacteria | 38359 |
| 723 | Ga0496125_0001911 | 3300048928 | Bacteria | 28512 |
| 724 | Ga0496125_0006272 | 3300048928 | Bacteria | 12922 |
| 725 | Ga0496125_0015636 | 3300048928 | Bacteria | 7323 |
| 726 | Ga0496125_0017742 | 3300048928 | Bacteria | 6774 |
| 727 | Ga0496126_0000865 | 3300048929 | Bacteria | 53248 |
| 728 | Ga0496126_0004050 | 3300048929 | Bacteria | 17821 |
| 729 | Ga0496126_0036320 | 3300048929 | Bacteria | 4607 |
| 730 | Ga0496126_0037033 | 3300048929 | Bacteria | 4556 |
| 731 | Ga0496126_0046052 | 3300048929 | Bacteria | 4004 |
| 732 | Ga0496126_0127556 | 3300048929 | Bacteria | 2201 |
| 733 | Ga0496126_0143447 | 3300048929 | Bacteria | 2053 |
| 734 | Ga0496126_0167588 | 3300048929 | Bacteria | 1873 |
| 735 | Ga0496126_0171269 | 3300048929 | Bacteria | 1849 |
| 736 | Ga0496126_0181350 | 3300048929 | Bacteria | 1788 |
| 737 | Ga0495678_000777 | 3300049459 | Bacteria | 28686 |
| 738 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 739 | Ga0501034_0231124 | 3300049571 | Bacteria | 1798 |
| 740 | Ga0501043_0118373 | 3300049579 | Bacteria | 2078 |
| 741 | Ga0501047_0000381 | 3300049581 | Bacteria | 50014 |
| 742 | Ga0501047_0254628 | 3300049581 | Bacteria | 1604 |
| 743 | Ga0501067_0131767 | 3300049583 | Unclassified | 1391 |
| 744 | Ga0501069_0001456 | 3300049585 | Bacteria | 11649 |
| 745 | Ga0501070_0157613 | 3300049586 | Bacteria | 1872 |
| 746 | Ga0501072_0381748 | 3300049588 | Bacteria | 1118 |
| 747 | Ga0501080_0017723 | 3300049742 | Bacteria | 6590 |
| 748 | Ga0501035_0012306 | 3300049822 | Bacteria | 7911 |
| 749 | nmdc:mga00v17_1439_c1 | 3300050491 | Bacteria | 4629 |
| 750 | nmdc:mga0qj67_7355_c1 | 3300050509 | Bacteria | 8139 |
| 751 | nmdc:mga06r32_469768_c1 | 3300050510 | Unclassified | 1236 |
| 752 | Ga0500635_0005491 | 3300053080 | Bacteria | 3330 |
| 753 | Ga0495595_0254822 | 3300053084 | Bacteria | 879 |
| 754 | Ga0500644_0004127 | 3300053088 | Bacteria | 3618 |
| 755 | Ga0500651_0010951 | 3300053093 | Bacteria | 5455 |
| 756 | Ga0500651_0132105 | 3300053093 | Bacteria | 1509 |
| 757 | Ga0500566_0172253 | 3300053094 | Bacteria | 1118 |
| 758 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 759 | Ga0500559_0057407 | 3300053136 | Bacteria | 1729 |
| 760 | Ga0500568_0004359 | 3300053139 | Bacteria | 7574 |
| 761 | Ga0500573_0004957 | 3300053140 | Bacteria | 7071 |
| 762 | Ga0501082_0044900 | 3300060353 | Bacteria | 3811 |
| 763 | Ga0466962_0000176 | 3300061719 | Bacteria | 26558 |
| 764 | Ga0466962_0004914 | 3300061719 | Bacteria | 6427 |
| 765 | Ga0466962_0073495 | 3300061719 | Bacteria | 1634 |
| 766 | 2506577645 | 2506520007 | Bacteria | 5442880 |
| 767 | 2506582783 | 2506520008 | Bacteria | 5443009 |
| 768 | 2508851580 | 2508501071 | Bacteria | 5454741 |
| 769 | 2511379891 | 2511231025 | Bacteria | 5324661 |
| 770 | 2511434743 | 2511231035 | Bacteria | 5341610 |
| 771 | 2538424298 | 2537561728 | Bacteria | 5149301 |
| 772 | 2547697163 | 2547132181 | Bacteria | 4945084 |
| 773 | 2548648745 | 2547132416 | Bacteria | 4633861 |
| 774 | 2555261269 | 2554235234 | Bacteria | 5762085 |
| 775 | 2562463319 | 2561511199 | Bacteria | 5155034 |
| 776 | 2585829846 | 2585427591 | Bacteria | 5482980 |
| 777 | 2585835024 | 2585427592 | Bacteria | 5370892 |
| 778 | 2599411461 | 2599185169 | Bacteria | 5441380 |
| 779 | 2599926340 | 2599185299 | Bacteria | 4854625 |
| 780 | 2601522943 | 2600255254 | Bacteria | 5281859 |
| 781 | 2601527970 | 2600255255 | Bacteria | 5282785 |
| 782 | 2601534803 | 2600255256 | Bacteria | 5597742 |
| 783 | 2601539568 | 2600255257 | Bacteria | 5597196 |
| 784 | 2601614804 | 2600255280 | Bacteria | 5292309 |
| 785 | 2601619521 | 2600255281 | Bacteria | 5288753 |
| 786 | 2601641884 | 2600255287 | Bacteria | 5210468 |
| 787 | 2601646721 | 2600255288 | Bacteria | 5282738 |
| 788 | 2601656334 | 2600255289 | Bacteria | 5281907 |
| 789 | 2601658274 | 2600255290 | Bacteria | 5282218 |
| 790 | 2601665898 | 2600255291 | Bacteria | 5217298 |
| 791 | 2601698755 | 2600255298 | Bacteria | 5215185 |
| 792 | 2601701627 | 2600255299 | Bacteria | 5218662 |
| 793 | 2601706795 | 2600255300 | Bacteria | 5287774 |
| 794 | 2601711099 | 2600255301 | Bacteria | 5280532 |
| 795 | 2601716113 | 2600255302 | Bacteria | 5288235 |
| 796 | 2601719691 | 2600255303 | Bacteria | 5219315 |
| 797 | 2601726519 | 2600255304 | Bacteria | 5283973 |
| 798 | 2601731060 | 2600255305 | Bacteria | 5282329 |
| 799 | 2601736075 | 2600255306 | Bacteria | 5281613 |
| 800 | 2601741511 | 2600255307 | Bacteria | 5439064 |
| 801 | 2601752235 | 2600255309 | Bacteria | 5431045 |
| 802 | 2601757918 | 2600255310 | Bacteria | 5600903 |
| 803 | 2601764276 | 2600255311 | Bacteria | 5598766 |
| 804 | 2602019076 | 2600255392 | Bacteria | 5437392 |
| 805 | 2603637092 | 2602042046 | Bacteria | 5483348 |
| 806 | 2603645048 | 2602042047 | Bacteria | 4697674 |
| 807 | 2603661385 | 2602042052 | Bacteria | 5215873 |
| 808 | 2603664339 | 2602042053 | Bacteria | 5214361 |
| 809 | 2603699149 | 2602042066 | Bacteria | 4423871 |
| 810 | 2603705164 | 2602042067 | Bacteria | 4863713 |
| 811 | 2603838455 | 2602042103 | Bacteria | 5284714 |
| 812 | 2603843532 | 2602042104 | Bacteria | 5281639 |
| 813 | 2603848606 | 2602042105 | Bacteria | 5282303 |
| 814 | 2603853679 | 2602042106 | Bacteria | 5282744 |
| 815 | 2603868792 | 2602042109 | Bacteria | 5152801 |
| 816 | 2603871733 | 2602042110 | Bacteria | 5283285 |
| 817 | 2603876635 | 2602042111 | Bacteria | 5212080 |
| 818 | 2606048923 | 2603880178 | Bacteria | 5283018 |
| 819 | 2606068769 | 2603880184 | Bacteria | 5217896 |
| 820 | 2606144562 | 2603880202 | Bacteria | 5284684 |
| 821 | 2606176326 | 2603880211 | Bacteria | 5284226 |
| 822 | 2608669878 | 2608642108 | Bacteria | 4104624 |
| 823 | 2609909870 | 2609459761 | Bacteria | 5513740 |
| 824 | 2637224285 | 2636415599 | Bacteria | 5718434 |
| 825 | 2643882612 | 2643221574 | Bacteria | 2789653 |
| 826 | 2644352498 | 2643221663 | Bacteria | 3425771 |
| 827 | 2644549431 | 2643221699 | Bacteria | 5731501 |
| 828 | 2644550481 | 2643221699 | Bacteria | 5731501 |
| 829 | 2649120099 | 2648501241 | Bacteria | 5312320 |
| 830 | 2650897088 | 2648501693 | Bacteria | 5069560 |
| 831 | 2652972856 | 2651869818 | Bacteria | 5864031 |
| 832 | 2656278670 | 2654587920 | Bacteria | 5475511 |
| 833 | 2671101335 | 2667528172 | Bacteria | 5170840 |
| 834 | 2671108747 | 2667528173 | Bacteria | 5375747 |
| 835 | 2671585536 | 2671180115 | Bacteria | 5353919 |
| 836 | 2676405687 | 2675903046 | Bacteria | 5451247 |
| 837 | 2681996422 | 2681812866 | Bacteria | 4552357 |
| 838 | 2682006229 | 2681812869 | Bacteria | 5014465 |
| 839 | 2686353995 | 2684622997 | Bacteria | 4624240 |
| 840 | 2689444138 | 2687453601 | Bacteria | 5546041 |
| 841 | 2691330201 | 2690315857 | Bacteria | 4396207 |
| 842 | 2707101961 | 2706794495 | Bacteria | 4536932 |
| 843 | 2712469431 | 2711768156 | Bacteria | 4471618 |
| 844 | 2739791996 | 2739367756 | Bacteria | 4553612 |
| 845 | 2753856715 | 2751185917 | Bacteria | 4551186 |
| 846 | 2765589809 | 2765235842 | Bacteria | 4799256 |
| 847 | 2772438167 | 2772190666 | Bacteria | 5117644 |
| 848 | 2775539744 | 2775506706 | Bacteria | 4873073 |
| 849 | 2777020743 | 2775507074 | Bacteria | 5532402 |
| 850 | 2791925054 | 2791354903 | Bacteria | 4937680 |
| 851 | 2792310371 | 2791355010 | Bacteria | 4864581 |
| 852 | 2793404946 | 2791355275 | Bacteria | 4429597 |
| 853 | 2807176492 | 2806310673 | Bacteria | 4801221 |
| 854 | 2809125550 | 2808606414 | Bacteria | 4917181 |
| 855 | 2813728110 | 2811995292 | Bacteria | 5303342 |
| 856 | 2814695654 | 2814123068 | Bacteria | 5687681 |
| 857 | 2821120829 | 2821118458 | Bacteria | 4714306 |
| 858 | 2823375463 | 2823373977 | Bacteria | 4779415 |
| 859 | 2844428166 | 2844425489 | Bacteria | 4854065 |
| 860 | 2844528976 | 2844528606 | Bacteria | 4733806 |
| 861 | 2846542088 | 2846540461 | Bacteria | 5471451 |
| 862 | 2847086795 | 2847085930 | Bacteria | 5070450 |
| 863 | 2847799148 | 2847797336 | Bacteria | 5176640 |
| 864 | 2852107601 | 2852103415 | Bacteria | 5193810 |
| 865 | 2854602361 | 2854601825 | Bacteria | 4797592 |
| 866 | 2855199668 | 2855195626 | Bacteria | 4927512 |
| 867 | 2858467691 | 2858466076 | Bacteria | 4722413 |
| 868 | 2865017448 | 2865014394 | Bacteria | 4764573 |
| 869 | 2869553494 | 2869551831 | Bacteria | 5474685 |
| 870 | 2871274131 | 2871272651 | Bacteria | 5042015 |
| 871 | 2871285256 | 2871282230 | Bacteria | 4917173 |
| 872 | 2876602933 | 2876601092 | Bacteria | 5114497 |
| 873 | 2881613964 | 2881609920 | Bacteria | 4405319 |
| 874 | 2881716541 | 2881714928 | Bacteria | 2469486 |
| 875 | 2884088154 | 2884086401 | Bacteria | 5005459 |
| 876 | 2887631988 | 2887630918 | Bacteria | 3239855 |
| 877 | 2888368182 | 2888366609 | Bacteria | 5155009 |
| 878 | 2888374207 | 2888373701 | Bacteria | 5098052 |
| 879 | 2891672160 | 2891670763 | Bacteria | 4967099 |
| 880 | 2896429545 | 2896429255 | Bacteria | 2557483 |
| 881 | 2900052291 | 2900051742 | Bacteria | 4985156 |
| 882 | 2904475557 | 2904474040 | Bacteria | 5504324 |
| 883 | 2904507975 | 2904504865 | Bacteria | 5152820 |
| 884 | 2904515606 | 2904513164 | Bacteria | 5476410 |
| 885 | 2908672261 | 2908669403 | Bacteria | 5740494 |
| 886 | 2916179317 | 2916178963 | Bacteria | 5265078 |
| 887 | 2919111279 | 2919108558 | Bacteria | 5897419 |
| 888 | 2919151726 | 2919150387 | Bacteria | 5500879 |
| 889 | 2919495762 | 2919493220 | Bacteria | 4598500 |
| 890 | 2919500320 | 2919497567 | Bacteria | 4408621 |
| 891 | 2919535310 | 2919534386 | Bacteria | 4577686 |
| 892 | 2919543401 | 2919543075 | Bacteria | 4728703 |
| 893 | 2919692183 | 2919688452 | Bacteria | 4595932 |
| 894 | 2923528442 | 2923525760 | Bacteria | 4472324 |
| 895 | 2923635630 | 2923634449 | Bacteria | 4753480 |
| 896 | 2927144395 | 2927143783 | Bacteria | 5504251 |
| 897 | 2927833402 | 2927833300 | Bacteria | 4923934 |
| 898 | 2928974064 | 2928972540 | Bacteria | 3058286 |
| 899 | 2932408386 | 2932406140 | Bacteria | 5134491 |
| 900 | 2935625973 | 2935625433 | Bacteria | 5042964 |
| 901 | 2937542655 | 2937539931 | Bacteria | 4639830 |
| 902 | 2937969908 | 2937967321 | Bacteria | 5094075 |
| 903 | 2939569831 | 2939568625 | Bacteria | 4542555 |
| 904 | 2939573075 | 2939573065 | Bacteria | 4926053 |
| 905 | 2939580047 | 2939577877 | Bacteria | 5132791 |
| 906 | 2939606942 | 2939602548 | Bacteria | 4950493 |
| 907 | 2939608890 | 2939607340 | Bacteria | 4719256 |
| 908 | 2939618272 | 2939617950 | Bacteria | 4820956 |
| 909 | 2939643165 | 2939642701 | Bacteria | 4475280 |
| 910 | 2941489202 | 2941485952 | Bacteria | 3591484 |
| 911 | 2945877070 | 2945874760 | Bacteria | 5527237 |
| 912 | 2945952380 | 2945951305 | Bacteria | 4918162 |
| 913 | 2969081325 | 2969079654 | Bacteria | 5439582 |
| 914 | 2971822744 | 2971820967 | Bacteria | 5823634 |
| 915 | 2974311322 | 2974310843 | Bacteria | 4947816 |
| 916 | 2974439061 | 2974435778 | Bacteria | 4876478 |
| 917 | 2977240969 | 2977240413 | Bacteria | 3191065 |
| 918 | 2978978869 | 2978975091 | Bacteria | 4704313 |
| 919 | 2984497357 | 2984494565 | Bacteria | 5000175 |
| 920 | 2984563788 | 2984559226 | Bacteria | 5683096 |
| 921 | 2984596521 | 2984595703 | Bacteria | 5682994 |
| 922 | 2990261308 | 2990261002 | Bacteria | 4919493 |
| 923 | 3000378596 | 3000376612 | Bacteria | 4705565 |
| 924 | 640937148 | 640753048 | Bacteria | 5495657 |
| 925 | 8004597522 | 8004592986 | Bacteria | 5122074 |
| 926 | 8015397712 | 8015394850 | Bacteria | 5064660 |
| 927 | 8016735232 | 8016733728 | Bacteria | 5274317 |
| 928 | 8018223226 | 8018221730 | Bacteria | 4616064 |
| 929 | 8018409460 | 8018405270 | Bacteria | 4978981 |
| 930 | 8019501287 | 8019499862 | Bacteria | 5169538 |
| 931 | 8019505391 | 8019504834 | Bacteria | 4819156 |
| 932 | 8054360671 | 8054357960 | Bacteria | 2867777 |
| 933 | 8054846421 | 8054844752 | Bacteria | 4450330 |
| 934 | 8054851742 | 8054849141 | Bacteria | 5232694 |
| 935 | 8055088021 | 8055087960 | Bacteria | 4784273 |
| 936 | 8055095287 | 8055092621 | Bacteria | 4873875 |
| 937 | 8055098417 | 8055097453 | Bacteria | 4865496 |
| 938 | 8055695401 | 8055693939 | Bacteria | 4772047 |
| 939 | 8057307016 | 8057304971 | Bacteria | 4649742 |
| 940 | Ga0157370_10115790 | |||
| 941 | SwRhRL2b_contig_3798929 | |||
| 942 | SwRhRL2b_contig_513557 | |||
| 943 | JGI24740J21852_10023081 | |||
| 944 | JGI24737J22298_10028251 | |||
| 945 | JGI25162J39368_1000019 | |||
| 946 | JGI25163J39215_1000121 | |||
| 947 | JGI25164J39214_1000011 | |||
| 948 | JGI25152J39213_1000139 | |||
| 949 | rootH2_10014876 | |||
| 950 | rootL2_10108836 | |||
| 951 | rootH1_10208222 | |||
| 952 | Ga0006562J51391_1018770 | |||
| 953 | Ga0055538_1000021 | |||
| 954 | Ga0055539_1000026 | |||
| 955 | Ga0055533_1000035 | |||
| 956 | Ga0055525_1000045 | |||
| 957 | Ga0055536_1000238 | |||
| 958 | Ga0055536_1032714 | |||
| 959 | Ga0055541_1000020 | |||
| 960 | Ga0058692_1000099 | |||
| 961 | Ga0058692_1000261 | |||
| 962 | Ga0058692_1000468 | |||
| 963 | Ga0058692_1000698 | |||
| 964 | Ga0058692_1001871 | |||
| 965 | Ga0058692_1004106 | |||
| 966 | Ga0058692_1005849 | |||
| 967 | Ga0058692_1008705 | |||
| 968 | Ga0058692_1009958 | |||
| 969 | Ga0065703_1021842 | |||
| 970 | Ga0065704_10000261 | |||
| 971 | Ga0065704_10000708 | |||
| 972 | Ga0065704_10003611 | |||
| 973 | Ga0065704_10070657 | |||
| 974 | Ga0065704_10216388 | |||
| 975 | Ga0070658_10000013 | |||
| 976 | Ga0070658_10028617 | |||
| 977 | Ga0070658_10054019 | |||
| 978 | Ga0070658_10203163 | |||
| 979 | Ga0070683_100077457 | |||
| 980 | Ga0070680_100000478 | |||
| 981 | Ga0070660_100001747 | |||
| 982 | Ga0070660_100017863 | |||
| 983 | Ga0070660_100041749 | |||
| 984 | Ga0070661_100001603 | |||
| 985 | Ga0070661_100070963 | |||
| 986 | Ga0070661_100101326 | |||
| 987 | Ga0070692_10000649 | |||
| 988 | Ga0070692_10030078 | |||
| 989 | Ga0070668_100009419 | |||
| 990 | Ga0070668_100249144 | |||
| 991 | Ga0070675_100287179 | |||
| 992 | Ga0070671_100006902 | |||
| 993 | Ga0070671_100053006 | |||
| 994 | Ga0070673_100167009 | |||
| 995 | Ga0070659_100004808 | |||
| 996 | Ga0070659_100062581 | |||
| 997 | Ga0070659_100089858 | |||
| 998 | Ga0070659_100305819 | |||
| 999 | Ga0070667_100467219 | |||
| 1000 | Ga0070714_100103913 | |||
| 1001 | Ga0070714_100154029 | |||
| 1002 | Ga0070714_100188197 | |||
| 1003 | Ga0070713_100014588 | |||
| 1004 | Ga0070700_100088547 | |||
| 1005 | Ga0070663_100006997 | |||
| 1006 | Ga0070662_100012504 | |||
| 1007 | Ga0070662_100135774 | |||
| 1008 | Ga0070681_10015206 | |||
| 1009 | Ga0070679_100000007 | |||
| 1010 | Ga0070679_100103249 | |||
| 1011 | Ga0070684_100099249 | |||
| 1012 | Ga0070672_100220113 | |||
| 1013 | Ga0070686_100000138 | |||
| 1014 | Ga0070693_100243291 | |||
| 1015 | Ga0070665_100000075 | |||
| 1016 | Ga0070665_100000464 | |||
| 1017 | Ga0070665_100003847 | |||
| 1018 | Ga0070665_100230239 | |||
| 1019 | Ga0070665_100345473 | |||
| 1020 | Ga0070665_100593139 | |||
| 1021 | Ga0068855_100038568 | |||
| 1022 | Ga0068855_100172518 | |||
| 1023 | Ga0068857_100000207 | |||
| 1024 | Ga0068857_100004075 | |||
| 1025 | Ga0068857_100169541 | |||
| 1026 | Ga0068856_100008083 | |||
| 1027 | Ga0068856_100285568 | |||
| 1028 | Ga0068856_100630567 | |||
| 1029 | Ga0068856_100650749 | |||
| 1030 | Ga0068852_100003835 | |||
| 1031 | Ga0068852_100311461 | |||
| 1032 | Ga0068859_100002770 | |||
| 1033 | Ga0068859_100032361 | |||
| 1034 | Ga0068864_100115678 | |||
| 1035 | Ga0068863_100000122 | |||
| 1036 | Ga0068863_100023539 | |||
| 1037 | Ga0068863_100115542 | |||
| 1038 | Ga0068860_100018206 | |||
| 1039 | Ga0068860_100253458 | |||
| 1040 | Ga0068860_100409340 | |||
| 1041 | Ga0068862_100090529 | |||
| 1042 | Ga0068862_100103380 | |||
| 1043 | Ga0068862_100122166 | |||
| 1044 | Ga0081455_10026221 | |||
| 1045 | Ga0070717_10054160 | |||
| 1046 | Ga0075364_10004013 | |||
| 1047 | Ga0070716_100037943 | |||
| 1048 | Ga0075366_10052235 | |||
| 1049 | Ga0075430_100018405 | |||
| 1050 | Ga0075431_100499102 | |||
| 1051 | Ga0097620_100002770 | |||
| 1052 | Ga0097620_100032361 | |||
| 1053 | Ga0079104_1000018 | |||
| 1054 | Ga0079104_1000163 | |||
| 1055 | Ga0079104_1000282 | |||
| 1056 | Ga0079104_1000384 | |||
| 1057 | Ga0079104_1000391 | |||
| 1058 | Ga0079104_1001061 | |||
| 1059 | Ga0079104_1005390 | |||
| 1060 | Ga0079104_1006102 | |||
| 1061 | Ga0105251_10000141 | |||
| 1062 | Ga0105251_10000349 | |||
| 1063 | Ga0105251_10000471 | |||
| 1064 | Ga0105251_10001340 | |||
| 1065 | Ga0105251_10002019 | |||
| 1066 | Ga0105251_10004707 | |||
| 1067 | Ga0105251_10006665 | |||
| 1068 | Ga0105251_10010251 | |||
| 1069 | Ga0105251_10022944 | |||
| 1070 | Ga0105251_10053068 | |||
| 1071 | Ga0105251_10091942 | |||
| 1072 | Ga0105251_10196047 | |||
| 1073 | Ga0105244_10000009 | |||
| 1074 | Ga0105244_10000123 | |||
| 1075 | Ga0105244_10000347 | |||
| 1076 | Ga0105244_10000636 | |||
| 1077 | Ga0105244_10000818 | |||
| 1078 | Ga0105244_10002573 | |||
| 1079 | Ga0105244_10003693 | |||
| 1080 | Ga0105244_10005634 | |||
| 1081 | Ga0105244_10007967 | |||
| 1082 | Ga0105244_10024207 | |||
| 1083 | Ga0105244_10041144 | |||
| 1084 | Ga0105244_10049734 | |||
| 1085 | Ga0105250_10000002 | |||
| 1086 | Ga0105250_10000100 | |||
| 1087 | Ga0105250_10000601 | |||
| 1088 | Ga0105250_10001115 | |||
| 1089 | Ga0105250_10001849 | |||
| 1090 | Ga0105250_10002145 | |||
| 1091 | Ga0105250_10008211 | |||
| 1092 | Ga0105240_10009039 | |||
| 1093 | Ga0105240_10188986 | |||
| 1094 | Ga0105240_10203458 | |||
| 1095 | Ga0105245_10099199 | |||
| 1096 | Ga0105247_10000025 | |||
| 1097 | Ga0105243_10033993 | |||
| 1098 | Ga0105241_10000005 | |||
| 1099 | Ga0105248_10691697 | |||
| 1100 | Ga0105237_10497238 | |||
| 1101 | Ga0105238_10081994 | |||
| 1102 | Ga0105249_10082479 | |||
| 1103 | Ga0105239_10668242 | |||
| 1104 | Ga0105246_10039694 | |||
| 1105 | Ga0157373_10000110 | |||
| 1106 | Ga0157373_10048988 | |||
| 1107 | Ga0157373_10068289 | |||
| 1108 | Ga0157373_10148992 | |||
| 1109 | Ga0157371_10000098 | |||
| 1110 | Ga0157371_10000673 | |||
| 1111 | Ga0157371_10002717 | |||
| 1112 | Ga0157371_10003439 | |||
| 1113 | Ga0157371_10005924 | |||
| 1114 | Ga0157371_10006411 | |||
| 1115 | Ga0157371_10007406 | |||
| 1116 | Ga0157371_10012018 | |||
| 1117 | Ga0157371_10059481 | |||
| 1118 | Ga0157371_10081337 | |||
| 1119 | Ga0157370_10000445 | |||
| 1120 | Ga0157370_10000707 | |||
| 1121 | Ga0157370_10005108 | |||
| 1122 | Ga0157370_10016493 | |||
| 1123 | Ga0157370_10181254 | |||
| 1124 | Ga0157370_10181396 | |||
| 1125 | Ga0157369_10000988 | |||
| 1126 | Ga0157369_10006229 | |||
| 1127 | Ga0157369_10019715 | |||
| 1128 | Ga0157369_10077912 | |||
| 1129 | Ga0157369_10124326 | |||
| 1130 | Ga0157369_10249797 | |||
| 1131 | Ga0157369_10300009 | |||
| 1132 | Ga0157378_10391212 | |||
| 1133 | Ga0163162_10072654 | |||
| 1134 | Ga0157372_10054735 | |||
| 1135 | Ga0157372_10055595 | |||
| 1136 | Ga0157372_10072400 | |||
| 1137 | Ga0157372_10091434 | |||
| 1138 | Ga0157372_10126381 | |||
| 1139 | Ga0157372_10254223 | |||
| 1140 | Ga0157372_10357124 | |||
| 1141 | Ga0157375_10572828 | |||
| 1142 | Ga0163163_10007998 | |||
| 1143 | Ga0182008_10022168 | |||
| 1144 | Ga0182008_10036789 | |||
| 1145 | Ga0157377_10133047 | |||
| 1146 | Ga0182006_1000018 | |||
| 1147 | Ga0182006_1030626 | |||
| 1148 | Ga0182007_10017056 | |||
| 1149 | Ga0183366_1001 | |||
| 1150 | Ga0183370_1001 | |||
| 1151 | Ga0183365_10001 | |||
| 1152 | Ga0183369_1001 | |||
| 1153 | Ga0183368_1001 | |||
| 1154 | Ga0163161_10000001 | |||
| 1155 | Ga0163161_10084750 | |||
| 1156 | Ga0206353_11324343 | |||
| 1157 | Ga0213873_10000006 | |||
| 1158 | Ga0213872_10008462 | |||
| 1159 | Ga0213872_10077011 | |||
| 1160 | Ga0213876_10000004 | |||
| 1161 | Ga0213876_10000034 | |||
| 1162 | Ga0213876_10004247 | |||
| 1163 | Ga0213876_10016435 | |||
| 1164 | Ga0213876_10058546 | |||
| 1165 | Ga0209760_100004 | |||
| 1166 | Ga0209784_100001 | |||
| 1167 | Ga0209566_100001 | |||
| 1168 | Ga0209674_100002 | |||
| 1169 | Ga0209563_100002 | |||
| 1170 | Ga0207427_100012 | |||
| 1171 | Ga0209437_100001 | |||
| 1172 | Ga0209437_100238 | |||
| 1173 | Ga0209677_100002 | |||
| 1174 | Ga0209129_1000077 | |||
| 1175 | Ga0209233_1012128 | |||
| 1176 | Ga0209676_1000252 | |||
| 1177 | Ga0209676_1004310 | |||
| 1178 | Ga0209050_1003880 | |||
| 1179 | Ga0209257_1000060 | |||
| 1180 | Ga0207696_1000001 | |||
| 1181 | Ga0207696_1000013 | |||
| 1182 | Ga0207696_1000021 | |||
| 1183 | Ga0207696_1000053 | |||
| 1184 | Ga0207696_1000058 | |||
| 1185 | Ga0207696_1001994 | |||
| 1186 | Ga0207696_1002267 | |||
| 1187 | Ga0207696_1003430 | |||
| 1188 | Ga0207696_1003689 | |||
| 1189 | Ga0207696_1003913 | |||
| 1190 | Ga0207655_1000002 | |||
| 1191 | Ga0207655_1000004 | |||
| 1192 | Ga0207655_1000007 | |||
| 1193 | Ga0207655_1000036 | |||
| 1194 | Ga0207655_1000447 | |||
| 1195 | Ga0207655_1000604 | |||
| 1196 | Ga0207655_1000642 | |||
| 1197 | Ga0207655_1000829 | |||
| 1198 | Ga0207655_1003843 | |||
| 1199 | Ga0207655_1007692 | |||
| 1200 | Ga0207655_1010282 | |||
| 1201 | Ga0207655_1028073 | |||
| 1202 | Ga0207655_1081764 | |||
| 1203 | Ga0207713_1000001 | |||
| 1204 | Ga0207713_1000012 | |||
| 1205 | Ga0207713_1000015 | |||
| 1206 | Ga0207713_1000092 | |||
| 1207 | Ga0207713_1000132 | |||
| 1208 | Ga0207713_1000142 | |||
| 1209 | Ga0207713_1000383 | |||
| 1210 | Ga0207713_1010431 | |||
| 1211 | Ga0207713_1012963 | |||
| 1212 | Ga0207713_1018658 | |||
| 1213 | Ga0207713_1023685 | |||
| 1214 | Ga0207713_1032191 | |||
| 1215 | Ga0207713_1100090 | |||
| 1216 | Ga0207710_10000150 | |||
| 1217 | Ga0207688_10067675 | |||
| 1218 | Ga0207680_10204119 | |||
| 1219 | Ga0207647_10007732 | |||
| 1220 | Ga0207647_10010023 | |||
| 1221 | Ga0207705_10000002 | |||
| 1222 | Ga0207705_10000003 | |||
| 1223 | Ga0207705_10032612 | |||
| 1224 | Ga0207705_10310592 | |||
| 1225 | Ga0207654_10000007 | |||
| 1226 | Ga0207707_10027457 | |||
| 1227 | Ga0207695_10010391 | |||
| 1228 | Ga0207695_10016024 | |||
| 1229 | Ga0207695_10235004 | |||
| 1230 | Ga0207671_10320448 | |||
| 1231 | Ga0207660_10000536 | |||
| 1232 | Ga0207657_10004480 | |||
| 1233 | Ga0207657_10023582 | |||
| 1234 | Ga0207657_10027500 | |||
| 1235 | Ga0207649_10000329 | |||
| 1236 | Ga0207649_10001485 | |||
| 1237 | Ga0207649_10018803 | |||
| 1238 | Ga0207652_10000001 | |||
| 1239 | Ga0207652_10000002 | |||
| 1240 | Ga0207681_10054989 | |||
| 1241 | Ga0207694_10050905 | |||
| 1242 | Ga0207659_10028215 | |||
| 1243 | Ga0207664_10168119 | |||
| 1244 | Ga0207644_10000299 | |||
| 1245 | Ga0207644_10000833 | |||
| 1246 | Ga0207644_10022554 | |||
| 1247 | Ga0207690_10005730 | |||
| 1248 | Ga0207690_10009302 | |||
| 1249 | Ga0207690_10025124 | |||
| 1250 | Ga0207690_10051399 | |||
| 1251 | Ga0207706_10006757 | |||
| 1252 | Ga0207706_10124010 | |||
| 1253 | Ga0207706_10273573 | |||
| 1254 | Ga0207709_10005891 | |||
| 1255 | Ga0207669_10008692 | |||
| 1256 | Ga0207691_10087794 | |||
| 1257 | Ga0207691_10221782 | |||
| 1258 | Ga0207711_10112771 | |||
| 1259 | Ga0207661_10021552 | |||
| 1260 | Ga0207667_10013015 | |||
| 1261 | Ga0207667_10015306 | |||
| 1262 | Ga0207651_10319221 | |||
| 1263 | Ga0207651_10465115 | |||
| 1264 | Ga0207668_10000082 | |||
| 1265 | Ga0207668_10082088 | |||
| 1266 | Ga0207668_10238423 | |||
| 1267 | Ga0207640_10000838 | |||
| 1268 | Ga0207640_10059204 | |||
| 1269 | Ga0207639_10043827 | |||
| 1270 | Ga0207639_10073093 | |||
| 1271 | Ga0207639_10112571 | |||
| 1272 | Ga0207678_10004283 | |||
| 1273 | Ga0207678_10029828 | |||
| 1274 | Ga0207678_10213377 | |||
| 1275 | Ga0207708_10072486 | |||
| 1276 | Ga0207702_10031878 | |||
| 1277 | Ga0207702_10075148 | |||
| 1278 | Ga0207702_10143550 | |||
| 1279 | Ga0207641_10000001 | |||
| 1280 | Ga0207641_10011857 | |||
| 1281 | Ga0207676_10018047 | |||
| 1282 | Ga0207674_10000132 | |||
| 1283 | Ga0207674_10007565 | |||
| 1284 | Ga0207698_10015058 | |||
| 1285 | Ga0207698_10177272 | |||
| 1286 | Ga0209281_1000004 | |||
| 1287 | Ga0209281_1000006 | |||
| 1288 | Ga0209281_1000014 | |||
| 1289 | Ga0209281_1000027 | |||
| 1290 | Ga0209281_1000064 | |||
| 1291 | Ga0209281_1000071 | |||
| 1292 | Ga0209281_1000257 | |||
| 1293 | Ga0209281_1000370 | |||
| 1294 | Ga0209281_1000714 | |||
| 1295 | Ga0209281_1001392 | |||
| 1296 | Ga0209281_1004837 | |||
| 1297 | Ga0209371_1000001 | |||
| 1298 | Ga0209371_1000002 | |||
| 1299 | Ga0209371_1000005 | |||
| 1300 | Ga0209371_1000015 | |||
| 1301 | Ga0209371_1000099 | |||
| 1302 | Ga0209371_1000100 | |||
| 1303 | Ga0209371_1000120 | |||
| 1304 | Ga0209371_1000731 | |||
| 1305 | Ga0209371_1000778 | |||
| 1306 | Ga0209371_1000964 | |||
| 1307 | Ga0209371_1001841 | |||
| 1308 | Ga0209371_1002061 | |||
| 1309 | Ga0209371_1003104 | |||
| 1310 | Ga0209371_1003934 | |||
| 1311 | Ga0209371_1007662 | |||
| 1312 | Ga0209371_1009080 | |||
| 1313 | Ga0268266_10000103 | |||
| 1314 | Ga0268266_10000286 | |||
| 1315 | Ga0268266_10000514 | |||
| 1316 | Ga0268266_10195106 | |||
| 1317 | Ga0268265_10119029 | |||
| 1318 | Ga0268264_10010903 | |||
| 1319 | Ga0268264_10012883 | |||
| 1320 | Ga0268256_1000001 | |||
| 1321 | Ga0268256_1000002 | |||
| 1322 | Ga0268256_1000006 | |||
| 1323 | Ga0268256_1000018 | |||
| 1324 | Ga0268256_1000035 | |||
| 1325 | Ga0268256_1000089 | |||
| 1326 | Ga0268256_1000423 | |||
| 1327 | Ga0268256_1000714 | |||
| 1328 | Ga0268256_1000873 | |||
| 1329 | Ga0268256_1001822 | |||
| 1330 | Ga0268256_1003781 | |||
| 1331 | Ga0268256_1004445 | |||
| 1332 | Ga0268256_1005198 | |||
| 1333 | Ga0265327_10016858 | |||
| 1334 | Ga0307408_100001207 | |||
| 1335 | Ga0307405_10001717 | |||
| 1336 | Ga0307413_10000666 | |||
| 1337 | Ga0307413_10177276 | |||
| 1338 | Ga0307410_10002549 | |||
| 1339 | Ga0307410_10159736 | |||
| 1340 | Ga0307410_10177615 | |||
| 1341 | Ga0307410_10205837 | |||
| 1342 | Ga0307406_10001991 | |||
| 1343 | Ga0307406_10003346 | |||
| 1344 | Ga0307406_10296136 | |||
| 1345 | Ga0307407_10000195 | |||
| 1346 | Ga0307412_10002981 | |||
| 1347 | Ga0307412_10081574 | |||
| 1348 | Ga0307412_10343388 | |||
| 1349 | Ga0307409_100026891 | |||
| 1350 | Ga0307409_100082730 | |||
| 1351 | Ga0307409_100370035 | |||
| 1352 | Ga0307416_100001750 | |||
| 1353 | Ga0307414_10001053 | |||
| 1354 | Ga0307414_10003789 | |||
| 1355 | Ga0307414_10005946 | |||
| 1356 | Ga0307414_10037640 | |||
| 1357 | Ga0307414_10076705 | |||
| 1358 | Ga0307414_10235849 | |||
| 1359 | Ga0307414_10238395 | |||
| 1360 | Ga0307414_10356926 | |||
| 1361 | Ga0307411_10000206 | |||
| 1362 | Ga0307411_10002634 | |||
| 1363 | Ga0307411_10030860 | |||
| 1364 | Ga0307411_10193156 | |||
| 1365 | Ga0307411_10263980 | |||
| 1366 | Ga0307415_100008908 | |||
| 1367 | Ga0307415_100089979 | |||
| 1368 | Ga0316593_10041632 | |||
| 1369 | Ga0395899_0000184 | |||
| 1370 | Ga0395899_0000264 | |||
| 1371 | Ga0395899_0008407 | |||
| 1372 | Ga0395899_0033067 | |||
| 1373 | Ga0395899_0050095 | |||
| 1374 | Ga0395899_0080052 | |||
| 1375 | Ga0395899_0089388 | |||
| 1376 | Ga0395899_0100835 | |||
| 1377 | Ga0395899_0188198 | |||
| 1378 | Ga0395899_0240342 | |||
| 1379 | Ga0395900_0000723 | |||
| 1380 | Ga0395900_0003562 | |||
| 1381 | Ga0395900_0015186 | |||
| 1382 | Ga0395900_0015753 | |||
| 1383 | Ga0395900_0016216 | |||
| 1384 | Ga0395900_0018901 | |||
| 1385 | Ga0395900_0023262 | |||
| 1386 | Ga0395900_0036036 | |||
| 1387 | Ga0395900_0063713 | |||
| 1388 | Ga0395900_0143855 | |||
| 1389 | Ga0395900_0167208 | |||
| 1390 | Ga0395900_0248444 | |||
| 1391 | Ga0395900_0259066 | |||
| 1392 | Ga0395900_0489788 | |||
| 1393 | Ga0395900_0493594 | |||
| 1394 | Ga0395900_0540726 | |||
| 1395 | Ga0395898_0000087 | |||
| 1396 | Ga0395898_0004020 | |||
| 1397 | Ga0395898_0011911 | |||
| 1398 | Ga0395898_0018469 | |||
| 1399 | Ga0395898_0101522 | |||
| 1400 | Ga0395898_0106782 | |||
| 1401 | Ga0395898_0144648 | |||
| 1402 | Ga0395898_0170038 | |||
| 1403 | Ga0395898_0418492 | |||
| 1404 | Ga0395905_0000005 | |||
| 1405 | Ga0395905_0000070 | |||
| 1406 | Ga0395905_0002000 | |||
| 1407 | Ga0395905_0002910 | |||
| 1408 | Ga0395905_0005131 | |||
| 1409 | Ga0395905_0006920 | |||
| 1410 | Ga0395905_0017740 | |||
| 1411 | Ga0395905_0020118 | |||
| 1412 | Ga0395905_0022485 | |||
| 1413 | Ga0395905_0036963 | |||
| 1414 | Ga0395905_0040140 | |||
| 1415 | Ga0395905_0051191 | |||
| 1416 | Ga0395905_0069944 | |||
| 1417 | Ga0395905_0102146 | |||
| 1418 | Ga0395905_0346261 | |||
| 1419 | Ga0395905_0488463 | |||
| 1420 | Ga0395901_0001808 | |||
| 1421 | Ga0395901_0004038 | |||
| 1422 | Ga0395901_0015103 | |||
| 1423 | Ga0395901_0015235 | |||
| 1424 | Ga0395901_0024583 | |||
| 1425 | Ga0395901_0035231 | |||
| 1426 | Ga0395901_0036907 | |||
| 1427 | Ga0395901_0039387 | |||
| 1428 | Ga0395901_0081178 | |||
| 1429 | Ga0395901_0113760 | |||
| 1430 | Ga0395901_0162518 | |||
| 1431 | Ga0395901_0205851 | |||
| 1432 | Ga0395901_0430976 | |||
| 1433 | Ga0395901_0642065 | |||
| 1434 | Ga0400483_152581 | |||
| 1435 | Ga0436365_0674409 | |||
| 1436 | Ga0436365_0689373 | |||
| 1437 | Ga0436365_0965775 | |||
| 1438 | Ga0436365_0970858 | |||
| 1439 | Ga0436365_1116037 | |||
| 1440 | Ga0436365_1186688 | |||
| 1441 | Ga0436361_0292016 | |||
| 1442 | Ga0436361_0340720 | |||
| 1443 | Ga0436362_0554113 | |||
| 1444 | Ga0436362_1252872 | |||
| 1445 | Ga0439438_000002 | |||
| 1446 | Ga0439438_003831 | |||
| 1447 | Ga0439438_031555 | |||
| 1448 | Ga0439447_008214 | |||
| 1449 | Ga0439447_008992 | |||
| 1450 | Ga0439466_0000001 | |||
| 1451 | Ga0439445_0000014 | |||
| 1452 | Ga0439432_009149 | |||
| 1453 | Ga0439432_011912 | |||
| 1454 | Ga0439432_013062 | |||
| 1455 | Ga0439452_000001 | |||
| 1456 | Ga0439452_000002 | |||
| 1457 | Ga0439452_000020 | |||
| 1458 | Ga0439452_000031 | |||
| 1459 | Ga0439462_0053521 | |||
| 1460 | Ga0439463_008381 | |||
| 1461 | Ga0450912_000309 | |||
| 1462 | Ga0450923_017616 | |||
| 1463 | Ga0450907_000295 | |||
| 1464 | Ga0439446_0051763 | |||
| 1465 | Ga0439458_0000243 | |||
| 1466 | Ga0439458_0001940 | |||
| 1467 | Ga0439464_0003158 | |||
| 1468 | Ga0451577_0019045 | |||
| 1469 | Ga0466969_0000781 | |||
| 1470 | Ga0466969_0028998 | |||
| 1471 | Ga0466981_0000003 | |||
| 1472 | Ga0466966_0000039 | |||
| 1473 | Ga0466966_0000173 | |||
| 1474 | Ga0466966_0000802 | |||
| 1475 | Ga0466966_0000939 | |||
| 1476 | Ga0466966_0058404 | |||
| 1477 | Ga0466961_0000530 | |||
| 1478 | Ga0466961_0001878 | |||
| 1479 | Ga0466961_0039489 | |||
| 1480 | Ga0466961_0076757 | |||
| 1481 | Ga0466961_0079904 | |||
| 1482 | Ga0466961_0085520 | |||
| 1483 | Ga0466963_0012559 | |||
| 1484 | Ga0466963_0025445 | |||
| 1485 | Ga0466964_0194880 | |||
| 1486 | Ga0466971_0000414 | |||
| 1487 | Ga0466968_0016031 | |||
| 1488 | Ga0466970_0000836 | |||
| 1489 | Ga0466970_0016422 | |||
| 1490 | Ga0466957_0001326 | |||
| 1491 | Ga0466957_0009306 | |||
| 1492 | Ga0466957_0036436 | |||
| 1493 | Ga0466957_0063314 | |||
| 1494 | Ga0466957_0193361 | |||
| 1495 | Ga0466959_0000108 | |||
| 1496 | Ga0466959_0008432 | |||
| 1497 | Ga0466959_0013571 | |||
| 1498 | Ga0466959_0096742 | |||
| 1499 | Ga0466959_0155022 | |||
| 1500 | Ga0466958_0001249 | |||
| 1501 | Ga0466958_0001949 | |||
| 1502 | Ga0466958_0022630 | |||
| 1503 | Ga0466958_0026893 | |||
| 1504 | Ga0466967_0044572 | |||
| 1505 | Ga0466967_0201029 | |||
| 1506 | Ga0466967_0336944 | |||
| 1507 | Ga0466967_0510636 | |||
| 1508 | Ga0495617_066763 | |||
| 1509 | Ga0495627_000018 | |||
| 1510 | Ga0495591_000050 | |||
| 1511 | Ga0495591_000059 | |||
| 1512 | Ga0495638_0021694 | |||
| 1513 | Ga0495650_0000031 | |||
| 1514 | Ga0495650_0000047 | |||
| 1515 | Ga0495650_0000182 | |||
| 1516 | Ga0495605_0016907 | |||
| 1517 | Ga0495585_0004843 | |||
| 1518 | Ga0495596_0013908 | |||
| 1519 | Ga0495607_0045969 | |||
| 1520 | Ga0495606_0003900 | |||
| 1521 | Ga0495616_0034318 | |||
| 1522 | Ga0495620_0009743 | |||
| 1523 | Ga0495637_0085427 | |||
| 1524 | Ga0495643_0017719 | |||
| 1525 | Ga0495644_0012461 | |||
| 1526 | Ga0495648_0001866 | |||
| 1527 | Ga0495648_0015572 | |||
| 1528 | Ga0495654_0000009 | |||
| 1529 | Ga0495654_0000068 | |||
| 1530 | Ga0495654_0000596 | |||
| 1531 | Ga0495598_0006796 | |||
| 1532 | Ga0495621_0000983 | |||
| 1533 | Ga0495597_0002098 | |||
| 1534 | Ga0495633_0000162 | |||
| 1535 | Ga0495633_0010150 | |||
| 1536 | Ga0495625_0003714 | |||
| 1537 | Ga0495625_0049949 | |||
| 1538 | Ga0495588_0047665 | |||
| 1539 | Ga0495670_0015196 | |||
| 1540 | Ga0495649_0000165 | |||
| 1541 | Ga0495649_0004029 | |||
| 1542 | Ga0495649_0004333 | |||
| 1543 | Ga0495649_0007728 | |||
| 1544 | Ga0495589_0000002 | |||
| 1545 | Ga0495660_0000004 | |||
| 1546 | Ga0495660_0000015 | |||
| 1547 | Ga0495660_0045452 | |||
| 1548 | Ga0495672_0000001 | |||
| 1549 | Ga0495672_0000009 | |||
| 1550 | Ga0495672_0000015 | |||
| 1551 | Ga0495676_0276541 | |||
| 1552 | Ga0495679_000309 | |||
| 1553 | Ga0495679_003403 | |||
| 1554 | Ga0495679_006075 | |||
| 1555 | Ga0495673_0000007 | |||
| 1556 | Ga0495673_0000019 | |||
| 1557 | Ga0496100_0002186 | |||
| 1558 | Ga0496101_0000157 | |||
| 1559 | Ga0496102_0017189 | |||
| 1560 | Ga0496104_0000158 | |||
| 1561 | Ga0496104_0002904 | |||
| 1562 | Ga0496105_0005660 | |||
| 1563 | Ga0496105_0096668 | |||
| 1564 | Ga0496109_0035306 | |||
| 1565 | Ga0496110_0110046 | |||
| 1566 | Ga0496112_0123313 | |||
| 1567 | Ga0496113_0083843 | |||
| 1568 | Ga0496113_0399362 | |||
| 1569 | Ga0496116_0000023 | |||
| 1570 | Ga0496116_0000094 | |||
| 1571 | Ga0496116_0000110 | |||
| 1572 | Ga0496116_0000140 | |||
| 1573 | Ga0496116_0000625 | |||
| 1574 | Ga0496116_0005122 | |||
| 1575 | Ga0496116_0042463 | |||
| 1576 | Ga0496116_0076052 | |||
| 1577 | Ga0496117_0000009 | |||
| 1578 | Ga0496117_0000138 | |||
| 1579 | Ga0496117_0000154 | |||
| 1580 | Ga0496117_0000380 | |||
| 1581 | Ga0496117_0000835 | |||
| 1582 | Ga0496117_0007932 | |||
| 1583 | Ga0496117_0012591 | |||
| 1584 | Ga0496117_0015662 | |||
| 1585 | Ga0496117_0079691 | |||
| 1586 | Ga0496117_0109624 | |||
| 1587 | Ga0496118_0000017 | |||
| 1588 | Ga0496118_0000150 | |||
| 1589 | Ga0496118_0000158 | |||
| 1590 | Ga0496118_0001286 | |||
| 1591 | Ga0496118_0003879 | |||
| 1592 | Ga0496118_0005328 | |||
| 1593 | Ga0496118_0009114 | |||
| 1594 | Ga0496118_0034368 | |||
| 1595 | Ga0496118_0038462 | |||
| 1596 | Ga0496118_0055527 | |||
| 1597 | Ga0496118_0218215 | |||
| 1598 | Ga0496119_0000012 | |||
| 1599 | Ga0496119_0000027 | |||
| 1600 | Ga0496119_0000049 | |||
| 1601 | Ga0496119_0004375 | |||
| 1602 | Ga0496119_0004462 | |||
| 1603 | Ga0496119_0006885 | |||
| 1604 | Ga0496119_0015911 | |||
| 1605 | Ga0496119_0017287 | |||
| 1606 | Ga0496119_0018326 | |||
| 1607 | Ga0496119_0020904 | |||
| 1608 | Ga0496119_0026577 | |||
| 1609 | Ga0496120_0000004 | |||
| 1610 | Ga0496120_0000022 | |||
| 1611 | Ga0496120_0000048 | |||
| 1612 | Ga0496120_0000052 | |||
| 1613 | Ga0496120_0000057 | |||
| 1614 | Ga0496120_0000137 | |||
| 1615 | Ga0496120_0001027 | |||
| 1616 | Ga0496120_0002674 | |||
| 1617 | Ga0496120_0003623 | |||
| 1618 | Ga0496120_0004742 | |||
| 1619 | Ga0496120_0032115 | |||
| 1620 | Ga0496120_0042229 | |||
| 1621 | Ga0496121_0000389 | |||
| 1622 | Ga0496121_0001226 | |||
| 1623 | Ga0496121_0007606 | |||
| 1624 | Ga0496121_0012388 | |||
| 1625 | Ga0496121_0013317 | |||
| 1626 | Ga0496121_0016076 | |||
| 1627 | Ga0496122_0000003 | |||
| 1628 | Ga0496122_0000007 | |||
| 1629 | Ga0496122_0000088 | |||
| 1630 | Ga0496122_0002515 | |||
| 1631 | Ga0496122_0002765 | |||
| 1632 | Ga0496122_0014001 | |||
| 1633 | Ga0496122_0027761 | |||
| 1634 | Ga0496122_0029152 | |||
| 1635 | Ga0496122_0033217 | |||
| 1636 | Ga0496122_0154784 | |||
| 1637 | Ga0496123_0000004 | |||
| 1638 | Ga0496123_0000012 | |||
| 1639 | Ga0496123_0000139 | |||
| 1640 | Ga0496123_0000811 | |||
| 1641 | Ga0496123_0001770 | |||
| 1642 | Ga0496123_0002175 | |||
| 1643 | Ga0496123_0008368 | |||
| 1644 | Ga0496123_0012229 | |||
| 1645 | Ga0496123_0012648 | |||
| 1646 | Ga0496124_0000017 | |||
| 1647 | Ga0496124_0000025 | |||
| 1648 | Ga0496124_0000045 | |||
| 1649 | Ga0496124_0000484 | |||
| 1650 | Ga0496124_0001484 | |||
| 1651 | Ga0496124_0004039 | |||
| 1652 | Ga0496124_0020650 | |||
| 1653 | Ga0496124_0033130 | |||
| 1654 | Ga0496124_0059533 | |||
| 1655 | Ga0496124_0110800 | |||
| 1656 | Ga0496124_0125319 | |||
| 1657 | Ga0496124_0174349 | |||
| 1658 | Ga0496124_0229331 | |||
| 1659 | Ga0496125_0000013 | |||
| 1660 | Ga0496125_0000065 | |||
| 1661 | Ga0496125_0001229 | |||
| 1662 | Ga0496125_0001911 | |||
| 1663 | Ga0496125_0006272 | |||
| 1664 | Ga0496125_0015636 | |||
| 1665 | Ga0496125_0017742 | |||
| 1666 | Ga0496126_0000865 | |||
| 1667 | Ga0496126_0004050 | |||
| 1668 | Ga0496126_0036320 | |||
| 1669 | Ga0496126_0037033 | |||
| 1670 | Ga0496126_0046052 | |||
| 1671 | Ga0496126_0127556 | |||
| 1672 | Ga0496126_0143447 | |||
| 1673 | Ga0496126_0167588 | |||
| 1674 | Ga0496126_0171269 | |||
| 1675 | Ga0496126_0181350 | |||
| 1676 | Ga0495678_000777 | |||
| 1677 | Ga0495682_0000001 | |||
| 1678 | Ga0501034_0231124 | |||
| 1679 | Ga0501043_0118373 | |||
| 1680 | Ga0501047_0000381 | |||
| 1681 | Ga0501047_0254628 | |||
| 1682 | Ga0501067_0131767 | |||
| 1683 | Ga0501069_0001456 | |||
| 1684 | Ga0501070_0157613 | |||
| 1685 | Ga0501072_0381748 | |||
| 1686 | Ga0501080_0017723 | |||
| 1687 | Ga0501035_0012306 | |||
| 1688 | nmdc:mga00v17_1439_c1 | |||
| 1689 | nmdc:mga0qj67_7355_c1 | |||
| 1690 | nmdc:mga06r32_469768_c1 | |||
| 1691 | Ga0500635_0005491 | |||
| 1692 | Ga0495595_0254822 | |||
| 1693 | Ga0500644_0004127 | |||
| 1694 | Ga0500651_0010951 | |||
| 1695 | Ga0500651_0132105 | |||
| 1696 | Ga0500566_0172253 | |||
| 1697 | Ga0500621_000002 | |||
| 1698 | Ga0500559_0057407 | |||
| 1699 | Ga0500568_0004359 | |||
| 1700 | Ga0500573_0004957 | |||
| 1701 | Ga0501082_0044900 | |||
| 1702 | Ga0466962_0000176 | |||
| 1703 | Ga0466962_0004914 | |||
| 1704 | Ga0466962_0073495 | |||
| 1705 | 2506577645 | |||
| 1706 | 2506582783 | |||
| 1707 | 2508851580 | |||
| 1708 | 2511379891 | |||
| 1709 | 2511434743 | |||
| 1710 | 2538424298 | |||
| 1711 | 2547697163 | |||
| 1712 | 2548648745 | |||
| 1713 | 2555261269 | |||
| 1714 | 2562463319 | |||
| 1715 | 2585829846 | |||
| 1716 | 2585835024 | |||
| 1717 | 2599411461 | |||
| 1718 | 2599926340 | |||
| 1719 | 2601522943 | |||
| 1720 | 2601527970 | |||
| 1721 | 2601534803 | |||
| 1722 | 2601539568 | |||
| 1723 | 2601614804 | |||
| 1724 | 2601619521 | |||
| 1725 | 2601641884 | |||
| 1726 | 2601646721 | |||
| 1727 | 2601656334 | |||
| 1728 | 2601658274 | |||
| 1729 | 2601665898 | |||
| 1730 | 2601698755 | |||
| 1731 | 2601701627 | |||
| 1732 | 2601706795 | |||
| 1733 | 2601711099 | |||
| 1734 | 2601716113 | |||
| 1735 | 2601719691 | |||
| 1736 | 2601726519 | |||
| 1737 | 2601731060 | |||
| 1738 | 2601736075 | |||
| 1739 | 2601741511 | |||
| 1740 | 2601752235 | |||
| 1741 | 2601757918 | |||
| 1742 | 2601764276 | |||
| 1743 | 2602019076 | |||
| 1744 | 2603637092 | |||
| 1745 | 2603645048 | |||
| 1746 | 2603661385 | |||
| 1747 | 2603664339 | |||
| 1748 | 2603699149 | |||
| 1749 | 2603705164 | |||
| 1750 | 2603838455 | |||
| 1751 | 2603843532 | |||
| 1752 | 2603848606 | |||
| 1753 | 2603853679 | |||
| 1754 | 2603868792 | |||
| 1755 | 2603871733 | |||
| 1756 | 2603876635 | |||
| 1757 | 2606048923 | |||
| 1758 | 2606068769 | |||
| 1759 | 2606144562 | |||
| 1760 | 2606176326 | |||
| 1761 | 2608669878 | |||
| 1762 | 2609909870 | |||
| 1763 | 2637224285 | |||
| 1764 | 2643882612 | |||
| 1765 | 2644352498 | |||
| 1766 | 2644549431 | |||
| 1767 | 2644550481 | |||
| 1768 | 2649120099 | |||
| 1769 | 2650897088 | |||
| 1770 | 2652972856 | |||
| 1771 | 2656278670 | |||
| 1772 | 2671101335 | |||
| 1773 | 2671108747 | |||
| 1774 | 2671585536 | |||
| 1775 | 2676405687 | |||
| 1776 | 2681996422 | |||
| 1777 | 2682006229 | |||
| 1778 | 2686353995 | |||
| 1779 | 2689444138 | |||
| 1780 | 2691330201 | |||
| 1781 | 2707101961 | |||
| 1782 | 2712469431 | |||
| 1783 | 2739791996 | |||
| 1784 | 2753856715 | |||
| 1785 | 2765589809 | |||
| 1786 | 2772438167 | |||
| 1787 | 2775539744 | |||
| 1788 | 2777020743 | |||
| 1789 | 2791925054 | |||
| 1790 | 2792310371 | |||
| 1791 | 2793404946 | |||
| 1792 | 2807176492 | |||
| 1793 | 2809125550 | |||
| 1794 | 2813728110 | |||
| 1795 | 2814695654 | |||
| 1796 | 2821120829 | |||
| 1797 | 2823375463 | |||
| 1798 | 2844428166 | |||
| 1799 | 2844528976 | |||
| 1800 | 2846542088 | |||
| 1801 | 2847086795 | |||
| 1802 | 2847799148 | |||
| 1803 | 2852107601 | |||
| 1804 | 2854602361 | |||
| 1805 | 2855199668 | |||
| 1806 | 2858467691 | |||
| 1807 | 2865017448 | |||
| 1808 | 2869553494 | |||
| 1809 | 2871274131 | |||
| 1810 | 2871285256 | |||
| 1811 | 2876602933 | |||
| 1812 | 2881613964 | |||
| 1813 | 2881716541 | |||
| 1814 | 2884088154 | |||
| 1815 | 2887631988 | |||
| 1816 | 2888368182 | |||
| 1817 | 2888374207 | |||
| 1818 | 2891672160 | |||
| 1819 | 2896429545 | |||
| 1820 | 2900052291 | |||
| 1821 | 2904475557 | |||
| 1822 | 2904507975 | |||
| 1823 | 2904515606 | |||
| 1824 | 2908672261 | |||
| 1825 | 2916179317 | |||
| 1826 | 2919111279 | |||
| 1827 | 2919151726 | |||
| 1828 | 2919495762 | |||
| 1829 | 2919500320 | |||
| 1830 | 2919535310 | |||
| 1831 | 2919543401 | |||
| 1832 | 2919692183 | |||
| 1833 | 2923528442 | |||
| 1834 | 2923635630 | |||
| 1835 | 2927144395 | |||
| 1836 | 2927833402 | |||
| 1837 | 2928974064 | |||
| 1838 | 2932408386 | |||
| 1839 | 2935625973 | |||
| 1840 | 2937542655 | |||
| 1841 | 2937969908 | |||
| 1842 | 2939569831 | |||
| 1843 | 2939573075 | |||
| 1844 | 2939580047 | |||
| 1845 | 2939606942 | |||
| 1846 | 2939608890 | |||
| 1847 | 2939618272 | |||
| 1848 | 2939643165 | |||
| 1849 | 2941489202 | |||
| 1850 | 2945877070 | |||
| 1851 | 2945952380 | |||
| 1852 | 2969081325 | |||
| 1853 | 2971822744 | |||
| 1854 | 2974311322 | |||
| 1855 | 2974439061 | |||
| 1856 | 2977240969 | |||
| 1857 | 2978978869 | |||
| 1858 | 2984497357 | |||
| 1859 | 2984563788 | |||
| 1860 | 2984596521 | |||
| 1861 | 2990261308 | |||
| 1862 | 3000378596 | |||
| 1863 | 640937148 | |||
| 1864 | 8004597522 | |||
| 1865 | 8015397712 | |||
| 1866 | 8016735232 | |||
| 1867 | 8018223226 | |||
| 1868 | 8018409460 | |||
| 1869 | 8019501287 | |||
| 1870 | 8019505391 | |||
| 1871 | 8054360671 | |||
| 1872 | 8054846421 | |||
| 1873 | 8054851742 | |||
| 1874 | 8055088021 | |||
| 1875 | 8055095287 | |||
| 1876 | 8055098417 | |||
| 1877 | 8055695401 | |||
| 1878 | 8057307016 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ubi-assembly1.cif.gz_A | catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp | 0.99 | 5 | 220 |
| 5ub9-assembly1.cif.gz_A | catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni | 0.9768 | 6 | 225 |
| 5ubi-assembly1.cif.gz_A | catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp | 0.9765 | 5 | 220 |
| 5ub9-assembly1.cif.gz_A | catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni | 0.9681 | 6 | 225 |
| 4yb6-assembly1.cif.gz_A | adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine | 0.9193 | 5 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1q1kA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9917 | 102 | 190 | 3.40.190.10 |
| 4yb6F01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9704 | 6 | 225 | 3.40.190.10 |
| 1q1kA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.97 | 102 | 190 | 3.40.190.10 |
| 4yb6F01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9554 | 6 | 225 | 3.40.190.10 |
| 2vd3B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9529 | 102 | 190 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1WWX8-F1-model_v4 | deleted | 0.9981 | 1 | 215 |
|
| AF-A0A2J4V0M8-F1-model_v4 | deleted | 0.9957 | 1 | 216 |
|
| AF-A0A7G2K1D4-F1-model_v4 | ATP phosphoribosyltransferase (EC 2.4.2.17) | 0.9941 | 62 | 194 |
GO:0000105
GO:0003879 GO:0005737 |
| AF-A0A059UMJ5-F1-model_v4 | ATP phosphoribosyltransferase (EC 2.4.2.17) | 0.9918 | 49 | 189 |
GO:0000105
GO:0003879 GO:0005737 |
| AF-A0A3S4IKW2-F1-model_v4 | ATP phosphoribosyltransferase (EC 2.4.2.17) | 0.9909 | 53 | 212 |
GO:0000105
GO:0003879 GO:0005737 |