F486292
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 416 | 1878 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0045152|Ga0495629_0045152_1992_2867 |
| Length | 291 |
| Sequence | MIRVSKIAHAAYETPDLNQQTEYYTEIIGLTLAAQEKDTVYLASTVDHHAVVLRKGSQAQCTRIGFQIPPSADLDEFQKQVASHGVVTERRKNAEPSISDMLVFKDPKGTVFKRDDFSHQKFQSKGIVPYKLGHVAFHVADVKHVTKFYCDVLGFRESDWMGDFFSFLRCGPDHHTINLMETGANRHFHTAFELRDWAHMQQACDFLSLHGYKLLWGPGRHGIGHNLFAYHRAPNGLITETFAELDRMNEELGYFEPRPWHRDHPQRPKVWVKDPSAANLWGILPSDEMMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 245 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 279 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 280 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 416 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.3 |
| Nodule | 0 |
| Rhizoplane | 8.31 |
| Rhizosphere | 87.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495629_0045152 | 3300046459 | Bacteria | 3092 |
| 2 | 2214745235 | 2209111006 | Bacteria | 3605 |
| 3 | ARSoilYngRDRAFT_c00289 | 3300000042 | Bacteria | 7363 |
| 4 | ARcpr5yngRDRAFT_c000271 | 3300000043 | Bacteria | 7411 |
| 5 | ARSoilOldRDRAFT_c000295 | 3300000044 | Bacteria | 6988 |
| 6 | ARCol0yngRDRAFT_1000053 | 3300000652 | Bacteria | 20284 |
| 7 | JGI24740J21852_10014159 | 3300001979 | Bacteria | 2953 |
| 8 | JGI24737J22298_10002175 | 3300001990 | Bacteria | 6980 |
| 9 | JGI24750J21931_1000807 | 3300002070 | Bacteria | 4345 |
| 10 | JGI24750J21931_1002444 | 3300002070 | Bacteria | 2238 |
| 11 | JGI24748J21848_1001444 | 3300002074 | Bacteria | 2616 |
| 12 | JGI24738J21930_10003423 | 3300002075 | Bacteria | 4004 |
| 13 | JGI24749J21850_1005224 | 3300002076 | Bacteria | 1822 |
| 14 | JGI24744J21845_10001325 | 3300002077 | Bacteria | 4886 |
| 15 | JGI24033J26618_1002454 | 3300002155 | Unclassified | 1900 |
| 16 | JGI24034J26672_10000436 | 3300002239 | Bacteria | 5413 |
| 17 | JGI24742J22300_10000131 | 3300002244 | Bacteria | 10972 |
| 18 | JGI24742J22300_10007537 | 3300002244 | Bacteria | 1796 |
| 19 | JGI25406J46586_10010069 | 3300003203 | Bacteria | 4211 |
| 20 | JGI25405J52794_10017289 | 3300003911 | Bacteria | 1431 |
| 21 | Ga0065716_1002255 | 3300005277 | Bacteria | 2031 |
| 22 | Ga0065704_10101333 | 3300005289 | Bacteria | 2241 |
| 23 | Ga0065712_10006389 | 3300005290 | Unclassified | 4475 |
| 24 | Ga0065712_10020432 | 3300005290 | Bacteria | 1802 |
| 25 | Ga0065715_10000953 | 3300005293 | Bacteria | 11199 |
| 26 | Ga0065715_10006553 | 3300005293 | Bacteria | 4537 |
| 27 | Ga0065707_10113298 | 3300005295 | Bacteria | 2332 |
| 28 | Ga0070676_10008398 | 3300005328 | Bacteria | 5565 |
| 29 | Ga0070676_10027396 | 3300005328 | Bacteria | 3232 |
| 30 | Ga0070683_100001740 | 3300005329 | Bacteria | 16946 |
| 31 | Ga0070690_100005830 | 3300005330 | Bacteria | 6942 |
| 32 | Ga0070690_100071996 | 3300005330 | Bacteria | 2247 |
| 33 | Ga0070670_100023972 | 3300005331 | Bacteria | 5249 |
| 34 | Ga0070670_100026485 | 3300005331 | Bacteria | 4988 |
| 35 | Ga0070677_10000553 | 3300005333 | Bacteria | 12761 |
| 36 | Ga0068869_100004139 | 3300005334 | Bacteria | 8994 |
| 37 | Ga0068869_100028847 | 3300005334 | Bacteria | 3881 |
| 38 | Ga0068869_100059369 | 3300005334 | Bacteria | 2800 |
| 39 | Ga0068869_100224315 | 3300005334 | Bacteria | 1491 |
| 40 | Ga0070666_10021676 | 3300005335 | Bacteria | 4163 |
| 41 | Ga0070666_10073203 | 3300005335 | Bacteria | 2334 |
| 42 | Ga0070680_100002899 | 3300005336 | Bacteria | 12742 |
| 43 | Ga0070680_100013552 | 3300005336 | Bacteria | 6353 |
| 44 | Ga0070682_100044407 | 3300005337 | Bacteria | 2751 |
| 45 | Ga0070682_100196384 | 3300005337 | Bacteria | 1420 |
| 46 | Ga0068868_100005781 | 3300005338 | Bacteria | 8712 |
| 47 | Ga0068868_100073271 | 3300005338 | Bacteria | 2734 |
| 48 | Ga0070660_100001515 | 3300005339 | Bacteria | 15924 |
| 49 | Ga0070660_100198358 | 3300005339 | Unclassified | 1627 |
| 50 | Ga0070689_100001241 | 3300005340 | Bacteria | 16240 |
| 51 | Ga0070691_10064595 | 3300005341 | Unclassified | 1766 |
| 52 | Ga0070687_100002230 | 3300005343 | Bacteria | 7186 |
| 53 | Ga0070687_100093250 | 3300005343 | Bacteria | 1670 |
| 54 | Ga0070661_100012739 | 3300005344 | Bacteria | 5886 |
| 55 | Ga0070661_100056802 | 3300005344 | Bacteria | 2868 |
| 56 | Ga0070692_10006992 | 3300005345 | Bacteria | 4944 |
| 57 | Ga0070692_10008859 | 3300005345 | Bacteria | 4507 |
| 58 | Ga0070692_10156883 | 3300005345 | Bacteria | 1301 |
| 59 | Ga0070668_100002506 | 3300005347 | Bacteria | 13524 |
| 60 | Ga0070668_100066945 | 3300005347 | Bacteria | 2789 |
| 61 | Ga0070668_100344455 | 3300005347 | Bacteria | 1260 |
| 62 | Ga0070668_100352522 | 3300005347 | Unclassified | 1246 |
| 63 | Ga0070669_100000743 | 3300005353 | Bacteria | 23727 |
| 64 | Ga0070675_100001086 | 3300005354 | Bacteria | 19628 |
| 65 | Ga0070675_100162845 | 3300005354 | Bacteria | 1919 |
| 66 | Ga0070675_100196384 | 3300005354 | Bacteria | 1750 |
| 67 | Ga0070671_100004095 | 3300005355 | Bacteria | 11513 |
| 68 | Ga0070671_100006476 | 3300005355 | Bacteria | 9362 |
| 69 | Ga0070671_100052468 | 3300005355 | Bacteria | 3390 |
| 70 | Ga0070671_100176242 | 3300005355 | Bacteria | 1809 |
| 71 | Ga0070674_100063066 | 3300005356 | Bacteria | 2592 |
| 72 | Ga0070674_100541386 | 3300005356 | Bacteria | 975 |
| 73 | Ga0070673_100000419 | 3300005364 | Bacteria | 22441 |
| 74 | Ga0070688_100003465 | 3300005365 | Bacteria | 8123 |
| 75 | Ga0070659_100007008 | 3300005366 | Bacteria | 8163 |
| 76 | Ga0070659_100022088 | 3300005366 | Bacteria | 4855 |
| 77 | Ga0070659_100055244 | 3300005366 | Bacteria | 3128 |
| 78 | Ga0070667_100279960 | 3300005367 | Bacteria | 1497 |
| 79 | Ga0070703_10001244 | 3300005406 | Bacteria | 7745 |
| 80 | Ga0070703_10004556 | 3300005406 | Bacteria | 3895 |
| 81 | Ga0070709_10011868 | 3300005434 | Bacteria | 4864 |
| 82 | Ga0070709_10021857 | 3300005434 | Plasmid | 3734 |
| 83 | Ga0070709_10042462 | 3300005434 | Bacteria | 2808 |
| 84 | Ga0070709_10073099 | 3300005434 | Unclassified | 2219 |
| 85 | Ga0070714_100004331 | 3300005435 | Bacteria | 10704 |
| 86 | Ga0070714_100087894 | 3300005435 | Bacteria | 2718 |
| 87 | Ga0070714_100203326 | 3300005435 | Unclassified | 1812 |
| 88 | Ga0070713_100005705 | 3300005436 | Bacteria | 8548 |
| 89 | Ga0070713_100016797 | 3300005436 | Bacteria | 5512 |
| 90 | Ga0070713_100023528 | 3300005436 | Bacteria | 4782 |
| 91 | Ga0070713_100031744 | 3300005436 | Bacteria | 4210 |
| 92 | Ga0070713_100121641 | 3300005436 | Bacteria | 2290 |
| 93 | Ga0070713_100167706 | 3300005436 | Bacteria | 1965 |
| 94 | Ga0070713_100364987 | 3300005436 | Bacteria | 1342 |
| 95 | Ga0070710_10000528 | 3300005437 | Bacteria | 18021 |
| 96 | Ga0070710_10004305 | 3300005437 | Bacteria | 6747 |
| 97 | Ga0070710_10008141 | 3300005437 | Bacteria | 5096 |
| 98 | Ga0070710_10068466 | 3300005437 | Bacteria | 2040 |
| 99 | Ga0070710_10075948 | 3300005437 | Bacteria | 1948 |
| 100 | Ga0070701_10000365 | 3300005438 | Bacteria | 15115 |
| 101 | Ga0070701_10007962 | 3300005438 | Bacteria | 4560 |
| 102 | Ga0070701_10059982 | 3300005438 | Bacteria | 2002 |
| 103 | Ga0070711_100003401 | 3300005439 | Bacteria | 9271 |
| 104 | Ga0070711_100021147 | 3300005439 | Bacteria | 4204 |
| 105 | Ga0070711_100039114 | 3300005439 | Bacteria | 3192 |
| 106 | Ga0070711_100073866 | 3300005439 | Bacteria | 2411 |
| 107 | Ga0070711_100363821 | 3300005439 | Bacteria | 1166 |
| 108 | Ga0070705_100001329 | 3300005440 | Bacteria | 13221 |
| 109 | Ga0070705_100001964 | 3300005440 | Bacteria | 10518 |
| 110 | Ga0070700_100008089 | 3300005441 | Bacteria | 5715 |
| 111 | Ga0070700_100008776 | 3300005441 | Bacteria | 5520 |
| 112 | Ga0070700_100065982 | 3300005441 | Bacteria | 2296 |
| 113 | Ga0070694_100002737 | 3300005444 | Bacteria | 10459 |
| 114 | Ga0070694_100021203 | 3300005444 | Bacteria | 4148 |
| 115 | Ga0070694_100180133 | 3300005444 | Bacteria | 1562 |
| 116 | Ga0070708_100041374 | 3300005445 | Bacteria | 4040 |
| 117 | Ga0070663_100019174 | 3300005455 | Bacteria | 4502 |
| 118 | Ga0070663_100217857 | 3300005455 | Bacteria | 1497 |
| 119 | Ga0070678_100005723 | 3300005456 | Bacteria | 7220 |
| 120 | Ga0070678_100083622 | 3300005456 | Bacteria | 2427 |
| 121 | Ga0070678_100202717 | 3300005456 | Bacteria | 1638 |
| 122 | Ga0070662_100025249 | 3300005457 | Bacteria | 4101 |
| 123 | Ga0070662_100180533 | 3300005457 | Bacteria | 1663 |
| 124 | Ga0070681_10010311 | 3300005458 | Bacteria | 9223 |
| 125 | Ga0070681_10019665 | 3300005458 | Bacteria | 6763 |
| 126 | Ga0070681_10189278 | 3300005458 | Bacteria | 1978 |
| 127 | Ga0068867_100000980 | 3300005459 | Bacteria | 19509 |
| 128 | Ga0070685_10014838 | 3300005466 | Bacteria | 4132 |
| 129 | Ga0070685_10015980 | 3300005466 | Bacteria | 3993 |
| 130 | Ga0070706_100361152 | 3300005467 | Bacteria | 1353 |
| 131 | Ga0070706_100563484 | 3300005467 | Bacteria | 1059 |
| 132 | Ga0070699_100000444 | 3300005518 | Bacteria | 39757 |
| 133 | Ga0070699_100001276 | 3300005518 | Bacteria | 23203 |
| 134 | Ga0070679_100004363 | 3300005530 | Bacteria | 13070 |
| 135 | Ga0070684_100013266 | 3300005535 | Bacteria | 6639 |
| 136 | Ga0070684_100053185 | 3300005535 | Bacteria | 3524 |
| 137 | Ga0070684_100233276 | 3300005535 | Bacteria | 1680 |
| 138 | Ga0070697_100017942 | 3300005536 | Bacteria | 5575 |
| 139 | Ga0070697_100066086 | 3300005536 | Bacteria | 2957 |
| 140 | Ga0070697_100273340 | 3300005536 | Unclassified | 1449 |
| 141 | Ga0068853_100006929 | 3300005539 | Bacteria | 9049 |
| 142 | Ga0070672_100002302 | 3300005543 | Bacteria | 12059 |
| 143 | Ga0070672_100055215 | 3300005543 | Bacteria | 3111 |
| 144 | Ga0070686_100012378 | 3300005544 | Bacteria | 4856 |
| 145 | Ga0070686_100014304 | 3300005544 | Bacteria | 4572 |
| 146 | Ga0070686_100017776 | 3300005544 | Bacteria | 4161 |
| 147 | Ga0070695_100000918 | 3300005545 | Bacteria | 15891 |
| 148 | Ga0070695_100012338 | 3300005545 | Bacteria | 5123 |
| 149 | Ga0070696_100000123 | 3300005546 | Bacteria | 40797 |
| 150 | Ga0070696_100002724 | 3300005546 | Bacteria | 11729 |
| 151 | Ga0070696_100221935 | 3300005546 | Unclassified | 1418 |
| 152 | Ga0070693_100001476 | 3300005547 | Bacteria | 10590 |
| 153 | Ga0070704_100000095 | 3300005549 | Bacteria | 30467 |
| 154 | Ga0070704_100037262 | 3300005549 | Bacteria | 3321 |
| 155 | Ga0068855_100066013 | 3300005563 | Bacteria | 4219 |
| 156 | Ga0068855_100279563 | 3300005563 | Bacteria | 1854 |
| 157 | Ga0070664_100105237 | 3300005564 | Bacteria | 2457 |
| 158 | Ga0070664_100353332 | 3300005564 | Bacteria | 1337 |
| 159 | Ga0068857_100002177 | 3300005577 | Bacteria | 15935 |
| 160 | Ga0068857_100011660 | 3300005577 | Bacteria | 7645 |
| 161 | Ga0068857_100087240 | 3300005577 | Bacteria | 2791 |
| 162 | Ga0068856_100003552 | 3300005614 | Bacteria | 15701 |
| 163 | Ga0068856_100058287 | 3300005614 | Bacteria | 3813 |
| 164 | Ga0068856_100227952 | 3300005614 | Bacteria | 1879 |
| 165 | Ga0070702_100016382 | 3300005615 | Bacteria | 3801 |
| 166 | Ga0070702_100018984 | 3300005615 | Bacteria | 3576 |
| 167 | Ga0070702_100087978 | 3300005615 | Bacteria | 1877 |
| 168 | Ga0068852_100051926 | 3300005616 | Bacteria | 3522 |
| 169 | Ga0068859_100001820 | 3300005617 | Bacteria | 21717 |
| 170 | Ga0068859_100005818 | 3300005617 | Bacteria | 12522 |
| 171 | Ga0068859_100063245 | 3300005617 | Bacteria | 3731 |
| 172 | Ga0068864_100000140 | 3300005618 | Bacteria | 69827 |
| 173 | Ga0068864_100230813 | 3300005618 | Bacteria | 1711 |
| 174 | Ga0068866_10001684 | 3300005718 | Bacteria | 9307 |
| 175 | Ga0068866_10204219 | 3300005718 | Bacteria | 1182 |
| 176 | Ga0068861_100013494 | 3300005719 | Bacteria | 5719 |
| 177 | Ga0068861_100095034 | 3300005719 | Bacteria | 2360 |
| 178 | Ga0068851_10033291 | 3300005834 | Bacteria | 2569 |
| 179 | Ga0068870_10000654 | 3300005840 | Bacteria | 13203 |
| 180 | Ga0068863_100000425 | 3300005841 | Bacteria | 42737 |
| 181 | Ga0068863_100027701 | 3300005841 | Bacteria | 5406 |
| 182 | Ga0068858_100095071 | 3300005842 | Bacteria | 2776 |
| 183 | Ga0068858_100167557 | 3300005842 | Bacteria | 2070 |
| 184 | Ga0068860_100002696 | 3300005843 | Bacteria | 18484 |
| 185 | Ga0068860_100064786 | 3300005843 | Bacteria | 3470 |
| 186 | Ga0068862_100020271 | 3300005844 | Bacteria | 5554 |
| 187 | Ga0068862_100089132 | 3300005844 | Bacteria | 2684 |
| 188 | Ga0081455_10001118 | 3300005937 | Bacteria | 33528 |
| 189 | Ga0081455_10011426 | 3300005937 | Bacteria | 8924 |
| 190 | Ga0081455_10088394 | 3300005937 | Bacteria | 2518 |
| 191 | Ga0081538_10002263 | 3300005981 | Bacteria | 19045 |
| 192 | Ga0081538_10060249 | 3300005981 | Bacteria | 2185 |
| 193 | Ga0081540_1000192 | 3300005983 | Bacteria | 63477 |
| 194 | Ga0081540_1006947 | 3300005983 | Bacteria | 8157 |
| 195 | Ga0081540_1024775 | 3300005983 | Bacteria | 3473 |
| 196 | Ga0081540_1039437 | 3300005983 | Bacteria | 2476 |
| 197 | Ga0081540_1058554 | 3300005983 | Bacteria | 1855 |
| 198 | Ga0081539_10001465 | 3300005985 | Bacteria | 40018 |
| 199 | Ga0070717_10001340 | 3300006028 | Bacteria | 16925 |
| 200 | Ga0070717_10011028 | 3300006028 | Bacteria | 6845 |
| 201 | Ga0070717_10044248 | 3300006028 | Bacteria | 3635 |
| 202 | Ga0075365_10025752 | 3300006038 | Bacteria | 3727 |
| 203 | Ga0075365_10032144 | 3300006038 | Bacteria | 3371 |
| 204 | Ga0075365_10261035 | 3300006038 | Bacteria | 1218 |
| 205 | Ga0075363_100071859 | 3300006048 | Bacteria | 1881 |
| 206 | Ga0075363_100243829 | 3300006048 | Bacteria | 1033 |
| 207 | Ga0075364_10209762 | 3300006051 | Bacteria | 1321 |
| 208 | Ga0075432_10094301 | 3300006058 | Bacteria | 1099 |
| 209 | Ga0070715_10000357 | 3300006163 | Bacteria | 11390 |
| 210 | Ga0070715_10012668 | 3300006163 | Unclassified | 3076 |
| 211 | Ga0070715_10024931 | 3300006163 | Bacteria | 2363 |
| 212 | Ga0070716_100044490 | 3300006173 | Bacteria | 2488 |
| 213 | Ga0070712_100001277 | 3300006175 | Bacteria | 15195 |
| 214 | Ga0070712_100008584 | 3300006175 | Bacteria | 6429 |
| 215 | Ga0070712_100115819 | 3300006175 | Bacteria | 2009 |
| 216 | Ga0070712_100195653 | 3300006175 | Bacteria | 1585 |
| 217 | Ga0070712_100206962 | 3300006175 | Bacteria | 1545 |
| 218 | Ga0070712_100207459 | 3300006175 | Bacteria | 1543 |
| 219 | Ga0070712_100263486 | 3300006175 | Bacteria | 1382 |
| 220 | Ga0070712_100477325 | 3300006175 | Bacteria | 1042 |
| 221 | Ga0075362_10050487 | 3300006177 | Bacteria | 1860 |
| 222 | Ga0075367_10039252 | 3300006178 | Bacteria | 2760 |
| 223 | Ga0075367_10082303 | 3300006178 | Bacteria | 1949 |
| 224 | Ga0097621_100002131 | 3300006237 | Bacteria | 13540 |
| 225 | Ga0075370_10071803 | 3300006353 | Bacteria | 1981 |
| 226 | Ga0068871_100008325 | 3300006358 | Bacteria | 7455 |
| 227 | Ga0075428_100019702 | 3300006844 | Bacteria | 7465 |
| 228 | Ga0075428_100028244 | 3300006844 | Bacteria | 6204 |
| 229 | Ga0075428_100610295 | 3300006844 | Bacteria | 1165 |
| 230 | Ga0075430_100014084 | 3300006846 | Bacteria | 6818 |
| 231 | Ga0075430_100037162 | 3300006846 | Bacteria | 4129 |
| 232 | Ga0075430_100041065 | 3300006846 | Bacteria | 3914 |
| 233 | Ga0075430_100060072 | 3300006846 | Bacteria | 3195 |
| 234 | Ga0075430_100077840 | 3300006846 | Bacteria | 2780 |
| 235 | Ga0075431_100004314 | 3300006847 | Bacteria | 13935 |
| 236 | Ga0075431_100017715 | 3300006847 | Bacteria | 7242 |
| 237 | Ga0075431_100021672 | 3300006847 | Bacteria | 6571 |
| 238 | Ga0075431_100246339 | 3300006847 | Bacteria | 1817 |
| 239 | Ga0075433_10140634 | 3300006852 | Bacteria | 2145 |
| 240 | Ga0075433_10148169 | 3300006852 | Bacteria | 2087 |
| 241 | Ga0075434_100021735 | 3300006871 | Bacteria | 6239 |
| 242 | Ga0075434_100034873 | 3300006871 | Bacteria | 4973 |
| 243 | Ga0075434_100058688 | 3300006871 | Bacteria | 3824 |
| 244 | Ga0075434_100183079 | 3300006871 | Bacteria | 2116 |
| 245 | Ga0075434_100358577 | 3300006871 | Bacteria | 1479 |
| 246 | Ga0075429_100155580 | 3300006880 | Bacteria | 2002 |
| 247 | Ga0075429_100218808 | 3300006880 | Bacteria | 1668 |
| 248 | Ga0075429_100431945 | 3300006880 | Bacteria | 1154 |
| 249 | Ga0068865_100001142 | 3300006881 | Bacteria | 15394 |
| 250 | Ga0068865_100036778 | 3300006881 | Bacteria | 3303 |
| 251 | Ga0068865_100093528 | 3300006881 | Bacteria | 2186 |
| 252 | Ga0068865_100112799 | 3300006881 | Bacteria | 2009 |
| 253 | Ga0068865_100126065 | 3300006881 | Bacteria | 1911 |
| 254 | Ga0075436_100093284 | 3300006914 | Unclassified | 2093 |
| 255 | Ga0075436_100102002 | 3300006914 | Bacteria | 1998 |
| 256 | Ga0097620_100001820 | 3300006931 | Bacteria | 21717 |
| 257 | Ga0097620_100005818 | 3300006931 | Bacteria | 12522 |
| 258 | Ga0097620_100063246 | 3300006931 | Bacteria | 3731 |
| 259 | Ga0097620_100316806 | 3300006931 | Bacteria | 1653 |
| 260 | Ga0075435_100022544 | 3300007076 | Bacteria | 4859 |
| 261 | Ga0075435_100125934 | 3300007076 | Bacteria | 2141 |
| 262 | Ga0099794_10036502 | 3300007265 | Bacteria | 2324 |
| 263 | Ga0105250_10032989 | 3300009092 | Bacteria | 2078 |
| 264 | Ga0105240_10109955 | 3300009093 | Bacteria | 3336 |
| 265 | Ga0105240_10175329 | 3300009093 | Bacteria | 2535 |
| 266 | Ga0111539_10006796 | 3300009094 | Bacteria | 14718 |
| 267 | Ga0111539_10014173 | 3300009094 | Bacteria | 9954 |
| 268 | Ga0111539_10081343 | 3300009094 | Bacteria | 3810 |
| 269 | Ga0111539_10188463 | 3300009094 | Bacteria | 2407 |
| 270 | Ga0111539_10479910 | 3300009094 | Bacteria | 1448 |
| 271 | Ga0111539_10499868 | 3300009094 | Bacteria | 1416 |
| 272 | Ga0111539_10568213 | 3300009094 | Bacteria | 1321 |
| 273 | Ga0111539_10803476 | 3300009094 | Bacteria | 1095 |
| 274 | Ga0105245_10000867 | 3300009098 | Bacteria | 27426 |
| 275 | Ga0105245_10023386 | 3300009098 | Bacteria | 5424 |
| 276 | Ga0105247_10116603 | 3300009101 | Bacteria | 1725 |
| 277 | Ga0114129_10017149 | 3300009147 | Bacteria | 10313 |
| 278 | Ga0114129_10041031 | 3300009147 | Bacteria | 6523 |
| 279 | Ga0114129_10045872 | 3300009147 | Bacteria | 6143 |
| 280 | Ga0114129_10080861 | 3300009147 | Bacteria | 4517 |
| 281 | Ga0114129_10172654 | 3300009147 | Bacteria | 2946 |
| 282 | Ga0114129_10233581 | 3300009147 | Bacteria | 2476 |
| 283 | Ga0114129_10329811 | 3300009147 | Bacteria | 2026 |
| 284 | Ga0114129_10504452 | 3300009147 | Bacteria | 1580 |
| 285 | Ga0105243_10002939 | 3300009148 | Bacteria | 14095 |
| 286 | Ga0105243_10018773 | 3300009148 | Bacteria | 5238 |
| 287 | Ga0105243_10143444 | 3300009148 | Bacteria | 2040 |
| 288 | Ga0105241_10007866 | 3300009174 | Bacteria | 7838 |
| 289 | Ga0105241_10036622 | 3300009174 | Bacteria | 3693 |
| 290 | Ga0105241_10172341 | 3300009174 | Bacteria | 1788 |
| 291 | Ga0105242_10001899 | 3300009176 | Bacteria | 16415 |
| 292 | Ga0105242_10014951 | 3300009176 | Bacteria | 6016 |
| 293 | Ga0105242_10064165 | 3300009176 | Bacteria | 3026 |
| 294 | Ga0105248_10003521 | 3300009177 | Bacteria | 17366 |
| 295 | Ga0105248_10029630 | 3300009177 | Bacteria | 6106 |
| 296 | Ga0105237_10102889 | 3300009545 | Bacteria | 2848 |
| 297 | Ga0105237_10135063 | 3300009545 | Bacteria | 2461 |
| 298 | Ga0105237_10139250 | 3300009545 | Unclassified | 2421 |
| 299 | Ga0105238_10037311 | 3300009551 | Bacteria | 4940 |
| 300 | Ga0105238_10119701 | 3300009551 | Bacteria | 2613 |
| 301 | Ga0105238_10146147 | 3300009551 | Bacteria | 2341 |
| 302 | Ga0105249_10002047 | 3300009553 | Bacteria | 17494 |
| 303 | Ga0105249_10002541 | 3300009553 | Bacteria | 15787 |
| 304 | Ga0105249_10553691 | 3300009553 | Bacteria | 1201 |
| 305 | Ga0105239_10021557 | 3300010375 | Bacteria | 7104 |
| 306 | Ga0105239_10037616 | 3300010375 | Bacteria | 5303 |
| 307 | Ga0105246_10001875 | 3300011119 | Bacteria | 12676 |
| 308 | Ga0157342_1006643 | 3300012507 | Unclassified | 1101 |
| 309 | Ga0157373_10100959 | 3300013100 | Bacteria | 2030 |
| 310 | Ga0157373_10248718 | 3300013100 | Bacteria | 1257 |
| 311 | Ga0157374_10001408 | 3300013296 | Bacteria | 20396 |
| 312 | Ga0157374_10110998 | 3300013296 | Bacteria | 2637 |
| 313 | Ga0157374_10214333 | 3300013296 | Unclassified | 1889 |
| 314 | Ga0157378_10004977 | 3300013297 | Bacteria | 11652 |
| 315 | Ga0157378_10246279 | 3300013297 | Unclassified | 1709 |
| 316 | Ga0163162_10011093 | 3300013306 | Bacteria | 8778 |
| 317 | Ga0163162_10012257 | 3300013306 | Bacteria | 8366 |
| 318 | Ga0163162_10130425 | 3300013306 | Bacteria | 2622 |
| 319 | Ga0163162_10295032 | 3300013306 | Bacteria | 1753 |
| 320 | Ga0157372_10017879 | 3300013307 | Bacteria | 7617 |
| 321 | Ga0157372_10770034 | 3300013307 | Unclassified | 1119 |
| 322 | Ga0157375_10001932 | 3300013308 | Bacteria | 17830 |
| 323 | Ga0157375_10113004 | 3300013308 | Bacteria | 2817 |
| 324 | Ga0163163_10034835 | 3300014325 | Bacteria | 4880 |
| 325 | Ga0163163_10301099 | 3300014325 | Bacteria | 1656 |
| 326 | Ga0163163_10352355 | 3300014325 | Bacteria | 1528 |
| 327 | Ga0157380_10014641 | 3300014326 | Bacteria | 5744 |
| 328 | Ga0157380_10018915 | 3300014326 | Bacteria | 5124 |
| 329 | Ga0157380_10157568 | 3300014326 | Bacteria | 1969 |
| 330 | Ga0157380_10202861 | 3300014326 | Bacteria | 1761 |
| 331 | Ga0157377_10000486 | 3300014745 | Bacteria | 17037 |
| 332 | Ga0157377_10039708 | 3300014745 | Bacteria | 2605 |
| 333 | Ga0157379_10006828 | 3300014968 | Bacteria | 9862 |
| 334 | Ga0157379_10057193 | 3300014968 | Bacteria | 3485 |
| 335 | Ga0157379_10133136 | 3300014968 | Unclassified | 2238 |
| 336 | Ga0157376_10068143 | 3300014969 | Bacteria | 3012 |
| 337 | Ga0157376_10709013 | 3300014969 | Bacteria | 1012 |
| 338 | Ga0213872_10028413 | 3300021361 | Bacteria | 2565 |
| 339 | Ga0213876_10033035 | 3300021384 | Bacteria | 2728 |
| 340 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 341 | Ga0207666_1000089 | 3300025271 | Bacteria | 14639 |
| 342 | Ga0207673_1002235 | 3300025290 | Bacteria | 2187 |
| 343 | Ga0207697_10000993 | 3300025315 | Bacteria | 15866 |
| 344 | Ga0207656_10049715 | 3300025321 | Bacteria | 1809 |
| 345 | Ga0207653_10008690 | 3300025885 | Bacteria | 3167 |
| 346 | Ga0207682_10000104 | 3300025893 | Bacteria | 38531 |
| 347 | Ga0207692_10000076 | 3300025898 | Bacteria | 28507 |
| 348 | Ga0207692_10026416 | 3300025898 | Bacteria | 2724 |
| 349 | Ga0207642_10001116 | 3300025899 | Bacteria | 8305 |
| 350 | Ga0207710_10088660 | 3300025900 | Bacteria | 1445 |
| 351 | Ga0207688_10001265 | 3300025901 | Bacteria | 13115 |
| 352 | Ga0207688_10002264 | 3300025901 | Bacteria | 10360 |
| 353 | Ga0207688_10029868 | 3300025901 | Bacteria | 3004 |
| 354 | Ga0207680_10006968 | 3300025903 | Bacteria | 5482 |
| 355 | Ga0207680_10018072 | 3300025903 | Bacteria | 3739 |
| 356 | Ga0207647_10001528 | 3300025904 | Bacteria | 17815 |
| 357 | Ga0207647_10060693 | 3300025904 | Bacteria | 2311 |
| 358 | Ga0207647_10258746 | 3300025904 | Bacteria | 997 |
| 359 | Ga0207685_10020579 | 3300025905 | Bacteria | 2196 |
| 360 | Ga0207685_10028679 | 3300025905 | Unclassified | 1963 |
| 361 | Ga0207699_10008588 | 3300025906 | Bacteria | 5049 |
| 362 | Ga0207699_10111324 | 3300025906 | Bacteria | 1755 |
| 363 | Ga0207699_10164078 | 3300025906 | Bacteria | 1481 |
| 364 | Ga0207699_10270969 | 3300025906 | Bacteria | 1176 |
| 365 | Ga0207645_10002130 | 3300025907 | Bacteria | 15831 |
| 366 | Ga0207645_10070174 | 3300025907 | Bacteria | 2241 |
| 367 | Ga0207643_10000035 | 3300025908 | Bacteria | 90905 |
| 368 | Ga0207643_10002863 | 3300025908 | Bacteria | 9308 |
| 369 | Ga0207684_10152225 | 3300025910 | Bacteria | 1990 |
| 370 | Ga0207654_10026417 | 3300025911 | Bacteria | 3144 |
| 371 | Ga0207707_10001935 | 3300025912 | Bacteria | 18839 |
| 372 | Ga0207707_10046635 | 3300025912 | Bacteria | 3775 |
| 373 | Ga0207707_10092137 | 3300025912 | Bacteria | 2648 |
| 374 | Ga0207695_10038532 | 3300025913 | Bacteria | 5144 |
| 375 | Ga0207693_10001480 | 3300025915 | Bacteria | 20759 |
| 376 | Ga0207693_10001843 | 3300025915 | Bacteria | 18573 |
| 377 | Ga0207693_10004775 | 3300025915 | Bacteria | 11395 |
| 378 | Ga0207693_10008913 | 3300025915 | Bacteria | 8193 |
| 379 | Ga0207693_10026826 | 3300025915 | Plasmid | 4557 |
| 380 | Ga0207693_10057698 | 3300025915 | Bacteria | 3042 |
| 381 | Ga0207693_10184433 | 3300025915 | Bacteria | 1643 |
| 382 | Ga0207693_10200058 | 3300025915 | Bacteria | 1571 |
| 383 | Ga0207693_10207692 | 3300025915 | Bacteria | 1539 |
| 384 | Ga0207693_10229672 | 3300025915 | Bacteria | 1457 |
| 385 | Ga0207663_10008697 | 3300025916 | Bacteria | 5328 |
| 386 | Ga0207663_10090454 | 3300025916 | Bacteria | 2029 |
| 387 | Ga0207663_10110263 | 3300025916 | Bacteria | 1866 |
| 388 | Ga0207663_10172413 | 3300025916 | Unclassified | 1538 |
| 389 | Ga0207663_10254950 | 3300025916 | Bacteria | 1293 |
| 390 | Ga0207660_10000451 | 3300025917 | Bacteria | 27028 |
| 391 | Ga0207660_10001146 | 3300025917 | Bacteria | 17678 |
| 392 | Ga0207660_10032704 | 3300025917 | Bacteria | 3592 |
| 393 | Ga0207662_10002323 | 3300025918 | Bacteria | 9527 |
| 394 | Ga0207662_10060397 | 3300025918 | Bacteria | 2274 |
| 395 | Ga0207657_10002025 | 3300025919 | Bacteria | 21900 |
| 396 | Ga0207657_10024447 | 3300025919 | Bacteria | 5591 |
| 397 | Ga0207649_10000309 | 3300025920 | Bacteria | 37243 |
| 398 | Ga0207649_10308122 | 3300025920 | Unclassified | 1160 |
| 399 | Ga0207652_10010263 | 3300025921 | Bacteria | 7538 |
| 400 | Ga0207652_10058859 | 3300025921 | Bacteria | 3311 |
| 401 | Ga0207646_10304826 | 3300025922 | Bacteria | 1439 |
| 402 | Ga0207681_10001488 | 3300025923 | Bacteria | 15114 |
| 403 | Ga0207694_10068334 | 3300025924 | Bacteria | 2775 |
| 404 | Ga0207694_10144188 | 3300025924 | Bacteria | 1916 |
| 405 | Ga0207694_10227863 | 3300025924 | Bacteria | 1521 |
| 406 | Ga0207650_10006726 | 3300025925 | Bacteria | 7838 |
| 407 | Ga0207650_10061427 | 3300025925 | Bacteria | 2806 |
| 408 | Ga0207659_10000091 | 3300025926 | Bacteria | 53079 |
| 409 | Ga0207659_10116261 | 3300025926 | Bacteria | 2042 |
| 410 | Ga0207687_10000161 | 3300025927 | Bacteria | 45255 |
| 411 | Ga0207687_10085640 | 3300025927 | Bacteria | 2287 |
| 412 | Ga0207700_10002812 | 3300025928 | Bacteria | 10019 |
| 413 | Ga0207700_10009232 | 3300025928 | Bacteria | 6151 |
| 414 | Ga0207700_10096860 | 3300025928 | Bacteria | 2344 |
| 415 | Ga0207700_10264668 | 3300025928 | Bacteria | 1473 |
| 416 | Ga0207700_10393120 | 3300025928 | Bacteria | 1214 |
| 417 | Ga0207700_10400254 | 3300025928 | Bacteria | 1203 |
| 418 | Ga0207700_10527315 | 3300025928 | Bacteria | 1047 |
| 419 | Ga0207664_10006249 | 3300025929 | Bacteria | 8182 |
| 420 | Ga0207664_10011444 | 3300025929 | Bacteria | 6308 |
| 421 | Ga0207664_10210631 | 3300025929 | Bacteria | 1681 |
| 422 | Ga0207664_10236410 | 3300025929 | Bacteria | 1590 |
| 423 | Ga0207644_10000245 | 3300025931 | Bacteria | 37122 |
| 424 | Ga0207644_10052208 | 3300025931 | Bacteria | 2937 |
| 425 | Ga0207644_10074056 | 3300025931 | Bacteria | 2498 |
| 426 | Ga0207644_10105600 | 3300025931 | Bacteria | 2122 |
| 427 | Ga0207690_10000771 | 3300025932 | Bacteria | 20713 |
| 428 | Ga0207690_10088403 | 3300025932 | Bacteria | 2182 |
| 429 | Ga0207706_10005499 | 3300025933 | Bacteria | 11813 |
| 430 | Ga0207706_10012450 | 3300025933 | Bacteria | 7751 |
| 431 | Ga0207706_10110642 | 3300025933 | Bacteria | 2416 |
| 432 | Ga0207686_10001194 | 3300025934 | Bacteria | 15062 |
| 433 | Ga0207686_10008989 | 3300025934 | Bacteria | 5408 |
| 434 | Ga0207686_10040051 | 3300025934 | Bacteria | 2847 |
| 435 | Ga0207709_10001001 | 3300025935 | Bacteria | 20987 |
| 436 | Ga0207709_10075536 | 3300025935 | Bacteria | 2154 |
| 437 | Ga0207709_10084032 | 3300025935 | Bacteria | 2060 |
| 438 | Ga0207670_10000526 | 3300025936 | Bacteria | 21144 |
| 439 | Ga0207670_10018175 | 3300025936 | Bacteria | 4267 |
| 440 | Ga0207670_10090762 | 3300025936 | Bacteria | 2159 |
| 441 | Ga0207670_10262025 | 3300025936 | Bacteria | 1340 |
| 442 | Ga0207669_10011592 | 3300025937 | Bacteria | 4297 |
| 443 | Ga0207704_10031210 | 3300025938 | Bacteria | 2999 |
| 444 | Ga0207704_10092693 | 3300025938 | Bacteria | 1989 |
| 445 | Ga0207665_10001028 | 3300025939 | Bacteria | 18828 |
| 446 | Ga0207665_10007368 | 3300025939 | Bacteria | 7271 |
| 447 | Ga0207665_10025516 | 3300025939 | Bacteria | 3900 |
| 448 | Ga0207665_10127780 | 3300025939 | Bacteria | 1801 |
| 449 | Ga0207665_10185695 | 3300025939 | Bacteria | 1508 |
| 450 | Ga0207691_10000336 | 3300025940 | Bacteria | 47166 |
| 451 | Ga0207691_10015407 | 3300025940 | Bacteria | 7273 |
| 452 | Ga0207711_10035966 | 3300025941 | Bacteria | 4200 |
| 453 | Ga0207711_10061529 | 3300025941 | Bacteria | 3237 |
| 454 | Ga0207711_10295596 | 3300025941 | Bacteria | 1493 |
| 455 | Ga0207689_10000168 | 3300025942 | Bacteria | 57089 |
| 456 | Ga0207689_10028925 | 3300025942 | Bacteria | 4633 |
| 457 | Ga0207689_10098550 | 3300025942 | Bacteria | 2401 |
| 458 | Ga0207689_10145944 | 3300025942 | Bacteria | 1949 |
| 459 | Ga0207661_10000575 | 3300025944 | Bacteria | 23433 |
| 460 | Ga0207661_10258176 | 3300025944 | Bacteria | 1551 |
| 461 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 462 | Ga0207679_10019432 | 3300025945 | Bacteria | 4563 |
| 463 | Ga0207679_10205302 | 3300025945 | Bacteria | 1649 |
| 464 | Ga0207667_10098793 | 3300025949 | Bacteria | 3012 |
| 465 | Ga0207651_10000233 | 3300025960 | Bacteria | 24032 |
| 466 | Ga0207651_10075434 | 3300025960 | Bacteria | 2406 |
| 467 | Ga0207712_10000768 | 3300025961 | Bacteria | 24025 |
| 468 | Ga0207712_10009092 | 3300025961 | Bacteria | 6285 |
| 469 | Ga0207668_10001470 | 3300025972 | Bacteria | 13811 |
| 470 | Ga0207668_10159635 | 3300025972 | Bacteria | 1755 |
| 471 | Ga0207668_10270678 | 3300025972 | Bacteria | 1388 |
| 472 | Ga0207640_10001231 | 3300025981 | Bacteria | 13954 |
| 473 | Ga0207658_10073032 | 3300025986 | Bacteria | 2603 |
| 474 | Ga0207677_10000997 | 3300026023 | Bacteria | 15626 |
| 475 | Ga0207677_10061228 | 3300026023 | Bacteria | 2605 |
| 476 | Ga0207703_10001880 | 3300026035 | Bacteria | 18666 |
| 477 | Ga0207703_10091454 | 3300026035 | Bacteria | 2559 |
| 478 | Ga0207639_10000421 | 3300026041 | Bacteria | 29387 |
| 479 | Ga0207678_10001561 | 3300026067 | Bacteria | 21040 |
| 480 | Ga0207678_10016361 | 3300026067 | Bacteria | 6513 |
| 481 | Ga0207678_10186746 | 3300026067 | Bacteria | 1771 |
| 482 | Ga0207708_10001793 | 3300026075 | Bacteria | 15836 |
| 483 | Ga0207708_10004956 | 3300026075 | Bacteria | 9812 |
| 484 | Ga0207708_10013704 | 3300026075 | Bacteria | 6058 |
| 485 | Ga0207702_10045251 | 3300026078 | Bacteria | 3703 |
| 486 | Ga0207641_10003563 | 3300026088 | Bacteria | 13757 |
| 487 | Ga0207641_10484983 | 3300026088 | Bacteria | 1198 |
| 488 | Ga0207648_10004259 | 3300026089 | Bacteria | 14771 |
| 489 | Ga0207648_10060537 | 3300026089 | Bacteria | 3302 |
| 490 | Ga0207648_10205886 | 3300026089 | Bacteria | 1746 |
| 491 | Ga0207674_10000535 | 3300026116 | Bacteria | 49820 |
| 492 | Ga0207674_10002113 | 3300026116 | Bacteria | 25122 |
| 493 | Ga0207674_10112624 | 3300026116 | Bacteria | 2694 |
| 494 | Ga0207675_100000365 | 3300026118 | Bacteria | 43342 |
| 495 | Ga0207683_10000667 | 3300026121 | Bacteria | 31542 |
| 496 | Ga0207683_10010556 | 3300026121 | Bacteria | 7880 |
| 497 | Ga0207698_10006961 | 3300026142 | Bacteria | 7075 |
| 498 | Ga0207698_10026318 | 3300026142 | Bacteria | 4114 |
| 499 | Ga0207698_10326536 | 3300026142 | Unclassified | 1439 |
| 500 | Ga0210002_1000583 | 3300027617 | Bacteria | 4951 |
| 501 | Ga0209983_1008797 | 3300027665 | Bacteria | 2060 |
| 502 | Ga0209998_10001636 | 3300027717 | Bacteria | 5367 |
| 503 | Ga0209974_10006220 | 3300027876 | Bacteria | 4179 |
| 504 | Ga0207428_10000636 | 3300027907 | Bacteria | 41316 |
| 505 | Ga0207428_10001024 | 3300027907 | Bacteria | 30931 |
| 506 | Ga0268266_10005119 | 3300028379 | Bacteria | 12356 |
| 507 | Ga0268265_10003727 | 3300028380 | Bacteria | 10834 |
| 508 | Ga0268265_10007391 | 3300028380 | Bacteria | 7418 |
| 509 | Ga0268264_10001508 | 3300028381 | Bacteria | 21696 |
| 510 | Ga0268264_10002415 | 3300028381 | Bacteria | 16442 |
| 511 | Ga0268264_10101929 | 3300028381 | Bacteria | 2497 |
| 512 | Ga0265338_10004828 | 3300028800 | Bacteria | 18005 |
| 513 | Ga0265338_10031592 | 3300028800 | Bacteria | 5188 |
| 514 | Ga0265330_10098784 | 3300031235 | Bacteria | 1250 |
| 515 | Ga0265332_10000319 | 3300031238 | Bacteria | 36874 |
| 516 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 517 | Ga0265325_10003344 | 3300031241 | Bacteria | 10523 |
| 518 | Ga0265325_10003410 | 3300031241 | Bacteria | 10388 |
| 519 | Ga0265325_10115243 | 3300031241 | Bacteria | 1301 |
| 520 | Ga0265329_10094961 | 3300031242 | Bacteria | 947 |
| 521 | Ga0265340_10058370 | 3300031247 | Bacteria | 1853 |
| 522 | Ga0265339_10000269 | 3300031249 | Bacteria | 41988 |
| 523 | Ga0265339_10019476 | 3300031249 | Bacteria | 3984 |
| 524 | Ga0265331_10013951 | 3300031250 | Bacteria | 4297 |
| 525 | Ga0265316_10064110 | 3300031344 | Bacteria | 2847 |
| 526 | Ga0265313_10001274 | 3300031595 | Bacteria | 23880 |
| 527 | Ga0265313_10001604 | 3300031595 | Bacteria | 21002 |
| 528 | Ga0265314_10000577 | 3300031711 | Bacteria | 46408 |
| 529 | Ga0265314_10093502 | 3300031711 | Bacteria | 1952 |
| 530 | Ga0265342_10000050 | 3300031712 | Bacteria | 124639 |
| 531 | Ga0265342_10000085 | 3300031712 | Bacteria | 100652 |
| 532 | Ga0373930_0000585 | 3300034816 | Bacteria | 5052 |
| 533 | Ga0373948_0000258 | 3300034817 | Bacteria | 6385 |
| 534 | Ga0373950_0003921 | 3300034818 | Bacteria | 2159 |
| 535 | Ga0373958_0000124 | 3300034819 | Bacteria | 8521 |
| 536 | Ga0373958_0005327 | 3300034819 | Bacteria | 1949 |
| 537 | Ga0373938_0000585 | 3300034957 | Bacteria | 5882 |
| 538 | Ga0373926_0006655 | 3300035083 | Bacteria | 3837 |
| 539 | Ga0373928_0000615 | 3300035084 | Bacteria | 6991 |
| 540 | Ga0373929_0000271 | 3300035085 | Bacteria | 9580 |
| 541 | Ga0373929_0003779 | 3300035085 | Bacteria | 2713 |
| 542 | Ga0373934_0006337 | 3300035086 | Bacteria | 4387 |
| 543 | Ga0373934_0111791 | 3300035086 | Unclassified | 1108 |
| 544 | Ga0373940_0003638 | 3300035088 | Bacteria | 3168 |
| 545 | Ga0373940_0025596 | 3300035088 | Bacteria | 1538 |
| 546 | Ga0373944_0038946 | 3300035089 | Bacteria | 1461 |
| 547 | Ga0373949_0002356 | 3300035090 | Bacteria | 4898 |
| 548 | Ga0373949_0002759 | 3300035090 | Bacteria | 4384 |
| 549 | Ga0373951_0003109 | 3300035091 | Bacteria | 4095 |
| 550 | Ga0373951_0004829 | 3300035091 | Bacteria | 3173 |
| 551 | Ga0373952_0016434 | 3300035092 | Bacteria | 1505 |
| 552 | Ga0373923_0024434 | 3300035111 | Bacteria | 2385 |
| 553 | Ga0373932_0004854 | 3300035112 | Bacteria | 3169 |
| 554 | Ga0373932_0010920 | 3300035112 | Bacteria | 2208 |
| 555 | Ga0373932_0019069 | 3300035112 | Bacteria | 1783 |
| 556 | Ga0373939_0001233 | 3300035114 | Bacteria | 6258 |
| 557 | Ga0373941_0021850 | 3300035115 | Unclassified | 1810 |
| 558 | Ga0373941_0109674 | 3300035115 | Bacteria | 971 |
| 559 | Ga0373945_0076492 | 3300035116 | Bacteria | 1276 |
| 560 | Ga0373953_0003874 | 3300035117 | Bacteria | 4712 |
| 561 | Ga0373953_0005397 | 3300035117 | Bacteria | 4147 |
| 562 | Ga0373953_0016741 | 3300035117 | Bacteria | 2682 |
| 563 | Ga0373953_0025943 | 3300035117 | Bacteria | 2243 |
| 564 | Ga0373954_0001845 | 3300035118 | Bacteria | 8744 |
| 565 | Ga0373954_0026156 | 3300035118 | Bacteria | 2673 |
| 566 | Ga0373957_0001073 | 3300035120 | Bacteria | 7213 |
| 567 | Ga0373960_0000880 | 3300035121 | Bacteria | 6379 |
| 568 | Ga0373960_0003195 | 3300035121 | Bacteria | 3706 |
| 569 | Ga0373943_0016099 | 3300035170 | Bacteria | 3406 |
| 570 | Ga0373943_0016942 | 3300035170 | Bacteria | 3331 |
| 571 | Ga0373943_0025782 | 3300035170 | Bacteria | 2749 |
| 572 | Ga0373955_0000732 | 3300035172 | Bacteria | 14065 |
| 573 | Ga0373955_0001003 | 3300035172 | Bacteria | 11993 |
| 574 | Ga0373955_0003829 | 3300035172 | Bacteria | 6631 |
| 575 | Ga0373955_0005598 | 3300035172 | Bacteria | 5649 |
| 576 | Ga0373942_0008727 | 3300035207 | Bacteria | 2368 |
| 577 | Ga0373961_0001257 | 3300035241 | Bacteria | 7751 |
| 578 | Ga0373962_0016674 | 3300035242 | Bacteria | 1897 |
| 579 | Ga0373924_0016437 | 3300035410 | Bacteria | 2824 |
| 580 | Ga0373931_0002231 | 3300035691 | Bacteria | 8563 |
| 581 | Ga0373931_0008138 | 3300035691 | Bacteria | 4968 |
| 582 | Ga0373935_0008410 | 3300035692 | Bacteria | 6176 |
| 583 | Ga0373933_0000562 | 3300035724 | Bacteria | 23168 |
| 584 | Ga0373933_0001283 | 3300035724 | Bacteria | 14787 |
| 585 | Ga0373933_0003500 | 3300035724 | Bacteria | 8743 |
| 586 | Ga0373947_0017002 | 3300035725 | Bacteria | 4180 |
| 587 | Ga0373947_0047748 | 3300035725 | Bacteria | 2566 |
| 588 | Ga0373937_0000935 | 3300036401 | Bacteria | 24779 |
| 589 | Ga0373937_0001648 | 3300036401 | Bacteria | 18759 |
| 590 | Ga0373937_0003782 | 3300036401 | Bacteria | 12800 |
| 591 | Ga0373937_0004562 | 3300036401 | Bacteria | 11760 |
| 592 | Ga0373925_0070415 | 3300037068 | Bacteria | 2644 |
| 593 | Ga0373925_0072197 | 3300037068 | Bacteria | 2611 |
| 594 | Ga0373925_0143037 | 3300037068 | Bacteria | 1873 |
| 595 | Ga0373925_0144080 | 3300037068 | Bacteria | 1866 |
| 596 | Ga0395899_0303483 | 3300037312 | Bacteria | 1080 |
| 597 | Ga0395898_0315859 | 3300037466 | Bacteria | 1491 |
| 598 | Ga0395898_0382342 | 3300037466 | Bacteria | 1343 |
| 599 | Ga0436365_0069514 | 3300039437 | Bacteria | 5139 |
| 600 | Ga0436365_0518063 | 3300039437 | Bacteria | 2880 |
| 601 | Ga0436365_1724574 | 3300039437 | Bacteria | 4597 |
| 602 | Ga0436361_0174868 | 3300039447 | Bacteria | 1230 |
| 603 | Ga0436361_0667785 | 3300039447 | Bacteria | 5283 |
| 604 | Ga0451800_0612411 | 3300041459 | Bacteria | 1106 |
| 605 | Ga0439463_038340 | 3300042016 | Bacteria | 1216 |
| 606 | Ga0450923_036232 | 3300042125 | Bacteria | 1023 |
| 607 | Ga0466966_0001275 | 3300044684 | Bacteria | 16132 |
| 608 | Ga0466961_0002805 | 3300044693 | Bacteria | 10838 |
| 609 | Ga0466963_0056152 | 3300044694 | Bacteria | 2619 |
| 610 | Ga0466957_0015701 | 3300044842 | Bacteria | 4424 |
| 611 | Ga0466957_0401730 | 3300044842 | Bacteria | 937 |
| 612 | Ga0466959_0010634 | 3300045049 | Bacteria | 6589 |
| 613 | Ga0466958_0011534 | 3300045836 | Bacteria | 4978 |
| 614 | Ga0495592_0000755 | 3300046454 | Bacteria | 22515 |
| 615 | Ga0495592_0008302 | 3300046454 | Bacteria | 7792 |
| 616 | Ga0495592_0024816 | 3300046454 | Bacteria | 4556 |
| 617 | Ga0495603_0018845 | 3300046455 | Bacteria | 4177 |
| 618 | Ga0495629_0107571 | 3300046459 | Bacteria | 1945 |
| 619 | Ga0495638_0009619 | 3300046460 | Bacteria | 6764 |
| 620 | Ga0495638_0028565 | 3300046460 | Bacteria | 3600 |
| 621 | Ga0495638_0111672 | 3300046460 | Bacteria | 1623 |
| 622 | Ga0495651_0008054 | 3300046462 | Bacteria | 8080 |
| 623 | Ga0495651_0039432 | 3300046462 | Bacteria | 3677 |
| 624 | Ga0495653_0003235 | 3300046463 | Bacteria | 13062 |
| 625 | Ga0495653_0020057 | 3300046463 | Bacteria | 5418 |
| 626 | Ga0495653_0033321 | 3300046463 | Bacteria | 4083 |
| 627 | Ga0495653_0309200 | 3300046463 | Bacteria | 1028 |
| 628 | Ga0495580_0217640 | 3300046472 | Bacteria | 1313 |
| 629 | Ga0495580_0314163 | 3300046472 | Unclassified | 1065 |
| 630 | Ga0495582_0074166 | 3300046473 | Bacteria | 1883 |
| 631 | Ga0495639_0119113 | 3300046475 | Unclassified | 1258 |
| 632 | Ga0495662_0036623 | 3300046476 | Bacteria | 2367 |
| 633 | Ga0495664_0004237 | 3300046477 | Bacteria | 7831 |
| 634 | Ga0495664_0207902 | 3300046477 | Bacteria | 1185 |
| 635 | Ga0495664_0216571 | 3300046477 | Unclassified | 1159 |
| 636 | Ga0495594_0049367 | 3300046499 | Bacteria | 2313 |
| 637 | Ga0495594_0111271 | 3300046499 | Bacteria | 1544 |
| 638 | Ga0495607_0178115 | 3300046501 | Bacteria | 1068 |
| 639 | Ga0495608_0000413 | 3300046511 | Bacteria | 29892 |
| 640 | Ga0495608_0000909 | 3300046511 | Bacteria | 20756 |
| 641 | Ga0495608_0037441 | 3300046511 | Bacteria | 3262 |
| 642 | Ga0495618_0000259 | 3300046514 | Bacteria | 38359 |
| 643 | Ga0495618_0003490 | 3300046514 | Bacteria | 9760 |
| 644 | Ga0495628_0005724 | 3300046516 | Bacteria | 10887 |
| 645 | Ga0495628_0026118 | 3300046516 | Bacteria | 4767 |
| 646 | Ga0495628_0352550 | 3300046516 | Bacteria | 1081 |
| 647 | Ga0495630_0037619 | 3300046517 | Bacteria | 3618 |
| 648 | Ga0495630_0091143 | 3300046517 | Bacteria | 2303 |
| 649 | Ga0495630_0139869 | 3300046517 | Bacteria | 1840 |
| 650 | Ga0495631_0069164 | 3300046518 | Bacteria | 1527 |
| 651 | Ga0495637_0111348 | 3300046520 | Bacteria | 1061 |
| 652 | Ga0495644_0008358 | 3300046523 | Bacteria | 3988 |
| 653 | Ga0495666_0103014 | 3300046526 | Bacteria | 1344 |
| 654 | Ga0495666_0142013 | 3300046526 | Bacteria | 1119 |
| 655 | Ga0495642_0032781 | 3300046528 | Bacteria | 2086 |
| 656 | Ga0495652_0003415 | 3300046529 | Bacteria | 15698 |
| 657 | Ga0495652_0004853 | 3300046529 | Bacteria | 12771 |
| 658 | Ga0495652_0007759 | 3300046529 | Bacteria | 9866 |
| 659 | Ga0495665_0020138 | 3300046531 | Bacteria | 3585 |
| 660 | Ga0495665_0106929 | 3300046531 | Bacteria | 1468 |
| 661 | Ga0495640_0001238 | 3300046533 | Bacteria | 20002 |
| 662 | Ga0495640_0002101 | 3300046533 | Bacteria | 15880 |
| 663 | Ga0495640_0052041 | 3300046533 | Bacteria | 2813 |
| 664 | Ga0495640_0072503 | 3300046533 | Bacteria | 2307 |
| 665 | Ga0495587_0000335 | 3300046536 | Bacteria | 33563 |
| 666 | Ga0495587_0004881 | 3300046536 | Bacteria | 8798 |
| 667 | Ga0495587_0049250 | 3300046536 | Bacteria | 2494 |
| 668 | Ga0495645_0006430 | 3300046543 | Bacteria | 8152 |
| 669 | Ga0495645_0020316 | 3300046543 | Bacteria | 4789 |
| 670 | Ga0495633_0014285 | 3300046558 | Bacteria | 4158 |
| 671 | Ga0495667_0000333 | 3300046559 | Bacteria | 29860 |
| 672 | Ga0495667_0000565 | 3300046559 | Bacteria | 23582 |
| 673 | Ga0495667_0001149 | 3300046559 | Bacteria | 17261 |
| 674 | Ga0495667_0049025 | 3300046559 | Plasmid | 2788 |
| 675 | Ga0495656_0006175 | 3300046615 | Bacteria | 4190 |
| 676 | Ga0495656_0047306 | 3300046615 | Bacteria | 1824 |
| 677 | Ga0495668_0099572 | 3300046616 | Bacteria | 1590 |
| 678 | Ga0495634_0031880 | 3300046642 | Bacteria | 3628 |
| 679 | Ga0495625_0120176 | 3300046660 | Bacteria | 1789 |
| 680 | Ga0495635_0003525 | 3300046663 | Bacteria | 10825 |
| 681 | Ga0495635_0008973 | 3300046663 | Bacteria | 6980 |
| 682 | Ga0495635_0015934 | 3300046663 | Bacteria | 5251 |
| 683 | Ga0495588_0031463 | 3300046674 | Bacteria | 2671 |
| 684 | Ga0495657_0006050 | 3300046675 | Bacteria | 9502 |
| 685 | Ga0495657_0008927 | 3300046675 | Bacteria | 7629 |
| 686 | Ga0495657_0030475 | 3300046675 | Bacteria | 3778 |
| 687 | Ga0495599_0002084 | 3300046678 | Bacteria | 11593 |
| 688 | Ga0495599_0002227 | 3300046678 | Bacteria | 11288 |
| 689 | Ga0495623_0006023 | 3300046679 | Bacteria | 7888 |
| 690 | Ga0495623_0071727 | 3300046679 | Bacteria | 2154 |
| 691 | Ga0495646_0000174 | 3300046680 | Bacteria | 32272 |
| 692 | Ga0495646_0001804 | 3300046680 | Bacteria | 12852 |
| 693 | Ga0495646_0113783 | 3300046680 | Bacteria | 1538 |
| 694 | Ga0495647_0005601 | 3300046681 | Bacteria | 4123 |
| 695 | Ga0495658_0009010 | 3300046683 | Bacteria | 4960 |
| 696 | Ga0495658_0038554 | 3300046683 | Plasmid | 2647 |
| 697 | Ga0495658_0122096 | 3300046683 | Unclassified | 1576 |
| 698 | Ga0495669_0046308 | 3300046684 | Bacteria | 1941 |
| 699 | Ga0495669_0120306 | 3300046684 | Bacteria | 1230 |
| 700 | Ga0495613_0026270 | 3300046689 | Bacteria | 4339 |
| 701 | Ga0495624_0054432 | 3300046690 | Bacteria | 2523 |
| 702 | Ga0495624_0129236 | 3300046690 | Bacteria | 1549 |
| 703 | Ga0495670_0059889 | 3300046691 | Bacteria | 1912 |
| 704 | Ga0495671_0125412 | 3300046692 | Bacteria | 1252 |
| 705 | Ga0495649_0111603 | 3300046694 | Bacteria | 1450 |
| 706 | Ga0495600_0009519 | 3300046809 | Bacteria | 6005 |
| 707 | Ga0495600_0010622 | 3300046809 | Bacteria | 5720 |
| 708 | Ga0495600_0027331 | 3300046809 | Bacteria | 3686 |
| 709 | Ga0495581_0075122 | 3300047315 | Bacteria | 1956 |
| 710 | Ga0495604_0000394 | 3300047317 | Bacteria | 39525 |
| 711 | Ga0495604_0002160 | 3300047317 | Bacteria | 15794 |
| 712 | Ga0495604_0014145 | 3300047317 | Bacteria | 6364 |
| 713 | Ga0495604_0020405 | 3300047317 | Bacteria | 5292 |
| 714 | Ga0495674_0003197 | 3300047319 | Bacteria | 15909 |
| 715 | Ga0495674_0007775 | 3300047319 | Bacteria | 10233 |
| 716 | Ga0495674_0019628 | 3300047319 | Bacteria | 6272 |
| 717 | Ga0495674_0066618 | 3300047319 | Bacteria | 3123 |
| 718 | Ga0495676_0097596 | 3300047321 | Bacteria | 2182 |
| 719 | Ga0495680_0000539 | 3300047322 | Bacteria | 42513 |
| 720 | Ga0495680_0011470 | 3300047322 | Bacteria | 7843 |
| 721 | Ga0495680_0024811 | 3300047322 | Bacteria | 4967 |
| 722 | Ga0495675_0000139 | 3300047444 | Bacteria | 50643 |
| 723 | Ga0495675_0020530 | 3300047444 | Bacteria | 4203 |
| 724 | Ga0495675_0032480 | 3300047444 | Bacteria | 3331 |
| 725 | Ga0495675_0053415 | 3300047444 | Bacteria | 2565 |
| 726 | Ga0495684_0019982 | 3300047471 | Bacteria | 5161 |
| 727 | Ga0495684_0023374 | 3300047471 | Bacteria | 4751 |
| 728 | Ga0495684_0046187 | 3300047471 | Bacteria | 3332 |
| 729 | Ga0495684_0133792 | 3300047471 | Bacteria | 1861 |
| 730 | Ga0495593_0025441 | 3300047673 | Bacteria | 3276 |
| 731 | Ga0495593_0164274 | 3300047673 | Bacteria | 1120 |
| 732 | Ga0495602_0000310 | 3300048088 | Bacteria | 45025 |
| 733 | Ga0495602_0003234 | 3300048088 | Bacteria | 16819 |
| 734 | Ga0495602_0035932 | 3300048088 | Bacteria | 4616 |
| 735 | Ga0495614_0034702 | 3300048089 | Bacteria | 2168 |
| 736 | Ga0496100_0006174 | 3300048903 | Bacteria | 6515 |
| 737 | Ga0496100_0020290 | 3300048903 | Plasmid | 3981 |
| 738 | Ga0496100_0040028 | 3300048903 | Bacteria | 2979 |
| 739 | Ga0496100_0106691 | 3300048903 | Bacteria | 1939 |
| 740 | Ga0496101_0000924 | 3300048904 | Bacteria | 17321 |
| 741 | Ga0496101_0012035 | 3300048904 | Bacteria | 5763 |
| 742 | Ga0496101_0079274 | 3300048904 | Bacteria | 2424 |
| 743 | Ga0496101_0104882 | 3300048904 | Bacteria | 2120 |
| 744 | Ga0496101_0176283 | 3300048904 | Bacteria | 1644 |
| 745 | Ga0496101_0178918 | 3300048904 | Bacteria | 1632 |
| 746 | Ga0496101_0385529 | 3300048904 | Bacteria | 1103 |
| 747 | Ga0496102_0021645 | 3300048905 | Bacteria | 5688 |
| 748 | Ga0496102_0025763 | 3300048905 | Bacteria | 5237 |
| 749 | Ga0496102_0029868 | 3300048905 | Bacteria | 4877 |
| 750 | Ga0496102_0224379 | 3300048905 | Bacteria | 1771 |
| 751 | Ga0496102_0511989 | 3300048905 | Unclassified | 1122 |
| 752 | Ga0496103_0005671 | 3300048906 | Bacteria | 7459 |
| 753 | Ga0496103_0037828 | 3300048906 | Bacteria | 2958 |
| 754 | Ga0496104_0000217 | 3300048907 | Bacteria | 50667 |
| 755 | Ga0496104_0000764 | 3300048907 | Bacteria | 27548 |
| 756 | Ga0496104_0034046 | 3300048907 | Bacteria | 4748 |
| 757 | Ga0496104_0037139 | 3300048907 | Bacteria | 4555 |
| 758 | Ga0496104_0047679 | 3300048907 | Bacteria | 4038 |
| 759 | Ga0496104_0100794 | 3300048907 | Bacteria | 2764 |
| 760 | Ga0496104_0114561 | 3300048907 | Bacteria | 2586 |
| 761 | Ga0496104_0126748 | 3300048907 | Bacteria | 2451 |
| 762 | Ga0496104_0142607 | 3300048907 | Bacteria | 2301 |
| 763 | Ga0496104_0216602 | 3300048907 | Bacteria | 1826 |
| 764 | Ga0496105_0012626 | 3300048908 | Bacteria | 6689 |
| 765 | Ga0496105_0058838 | 3300048908 | Bacteria | 3171 |
| 766 | Ga0496105_0191786 | 3300048908 | Bacteria | 1670 |
| 767 | Ga0496105_0212726 | 3300048908 | Bacteria | 1575 |
| 768 | Ga0496105_0268758 | 3300048908 | Bacteria | 1377 |
| 769 | Ga0496106_0000894 | 3300048909 | Bacteria | 21797 |
| 770 | Ga0496106_0003651 | 3300048909 | Bacteria | 11476 |
| 771 | Ga0496106_0005971 | 3300048909 | Bacteria | 8997 |
| 772 | Ga0496106_0069234 | 3300048909 | Bacteria | 2693 |
| 773 | Ga0496106_0096396 | 3300048909 | Bacteria | 2289 |
| 774 | Ga0496106_0280695 | 3300048909 | Bacteria | 1334 |
| 775 | Ga0496107_0005058 | 3300048910 | Bacteria | 8989 |
| 776 | Ga0496107_0053858 | 3300048910 | Bacteria | 2902 |
| 777 | Ga0496107_0101421 | 3300048910 | Bacteria | 2110 |
| 778 | Ga0496107_0118485 | 3300048910 | Bacteria | 1949 |
| 779 | Ga0496108_0000868 | 3300048911 | Bacteria | 23566 |
| 780 | Ga0496108_0043186 | 3300048911 | Bacteria | 3765 |
| 781 | Ga0496108_0087135 | 3300048911 | Bacteria | 2652 |
| 782 | Ga0496108_0239741 | 3300048911 | Bacteria | 1577 |
| 783 | Ga0496109_0000506 | 3300048912 | Bacteria | 33302 |
| 784 | Ga0496109_0039228 | 3300048912 | Bacteria | 4286 |
| 785 | Ga0496109_0053061 | 3300048912 | Bacteria | 3696 |
| 786 | Ga0496109_0059559 | 3300048912 | Bacteria | 3488 |
| 787 | Ga0496109_0120218 | 3300048912 | Bacteria | 2447 |
| 788 | Ga0496109_0173069 | 3300048912 | Bacteria | 2026 |
| 789 | Ga0496110_0063024 | 3300048913 | Bacteria | 3276 |
| 790 | Ga0496110_0098004 | 3300048913 | Bacteria | 2627 |
| 791 | Ga0496110_0111637 | 3300048913 | Bacteria | 2458 |
| 792 | Ga0496110_0124238 | 3300048913 | Bacteria | 2327 |
| 793 | Ga0496110_0220688 | 3300048913 | Bacteria | 1724 |
| 794 | Ga0496110_0281415 | 3300048913 | Bacteria | 1514 |
| 795 | Ga0496111_0072512 | 3300048914 | Bacteria | 2507 |
| 796 | Ga0496111_0142936 | 3300048914 | Bacteria | 1773 |
| 797 | Ga0496111_0306300 | 3300048914 | Bacteria | 1177 |
| 798 | Ga0496112_0049492 | 3300048915 | Bacteria | 4120 |
| 799 | Ga0496112_0294019 | 3300048915 | Bacteria | 1570 |
| 800 | Ga0496112_0412965 | 3300048915 | Bacteria | 1289 |
| 801 | Ga0496113_0046247 | 3300048916 | Bacteria | 3231 |
| 802 | Ga0496113_0171844 | 3300048916 | Bacteria | 1716 |
| 803 | Ga0496114_0013618 | 3300048917 | Bacteria | 6520 |
| 804 | Ga0496114_0019154 | 3300048917 | Bacteria | 5546 |
| 805 | Ga0496114_0042614 | 3300048917 | Bacteria | 3762 |
| 806 | Ga0496114_0043119 | 3300048917 | Bacteria | 3741 |
| 807 | Ga0496115_0004158 | 3300048918 | Bacteria | 10449 |
| 808 | Ga0496115_0018366 | 3300048918 | Bacteria | 5367 |
| 809 | Ga0496115_0033213 | 3300048918 | Bacteria | 4072 |
| 810 | Ga0496115_0111789 | 3300048918 | Bacteria | 2244 |
| 811 | Ga0496115_0121924 | 3300048918 | Bacteria | 2145 |
| 812 | Ga0496115_0175374 | 3300048918 | Unclassified | 1773 |
| 813 | Ga0501031_0002931 | 3300049568 | Bacteria | 10914 |
| 814 | Ga0501031_0006819 | 3300049568 | Bacteria | 7454 |
| 815 | Ga0501032_0030089 | 3300049569 | Bacteria | 3724 |
| 816 | Ga0501032_0065765 | 3300049569 | Bacteria | 2424 |
| 817 | Ga0501033_0011756 | 3300049570 | Bacteria | 6692 |
| 818 | Ga0501033_0012886 | 3300049570 | Bacteria | 6377 |
| 819 | Ga0501034_0018046 | 3300049571 | Bacteria | 7239 |
| 820 | Ga0501034_0095115 | 3300049571 | Bacteria | 2976 |
| 821 | Ga0501034_0169098 | 3300049571 | Bacteria | 2154 |
| 822 | Ga0501036_0004687 | 3300049572 | Bacteria | 11040 |
| 823 | Ga0501036_0011648 | 3300049572 | Bacteria | 7289 |
| 824 | Ga0501037_0005982 | 3300049573 | Bacteria | 8887 |
| 825 | Ga0501037_0019553 | 3300049573 | Bacteria | 4996 |
| 826 | Ga0501038_0030646 | 3300049574 | Bacteria | 4756 |
| 827 | Ga0501039_0001438 | 3300049575 | Bacteria | 17522 |
| 828 | Ga0501041_0104610 | 3300049577 | Bacteria | 1754 |
| 829 | Ga0501043_0017921 | 3300049579 | Bacteria | 5553 |
| 830 | Ga0501043_0203226 | 3300049579 | Bacteria | 1537 |
| 831 | Ga0501046_0010334 | 3300049580 | Bacteria | 8025 |
| 832 | Ga0501047_0010921 | 3300049581 | Bacteria | 8590 |
| 833 | Ga0501047_0010998 | 3300049581 | Bacteria | 8564 |
| 834 | Ga0501047_0031535 | 3300049581 | Bacteria | 5111 |
| 835 | Ga0501048_0004490 | 3300049582 | Bacteria | 10621 |
| 836 | Ga0501048_0413198 | 3300049582 | Bacteria | 965 |
| 837 | Ga0501067_0005740 | 3300049583 | Bacteria | 6886 |
| 838 | Ga0501068_0011311 | 3300049584 | Bacteria | 5035 |
| 839 | Ga0501069_0006487 | 3300049585 | Bacteria | 6116 |
| 840 | Ga0501070_0014059 | 3300049586 | Bacteria | 6738 |
| 841 | Ga0501070_0025502 | 3300049586 | Bacteria | 4958 |
| 842 | Ga0501070_0159730 | 3300049586 | Bacteria | 1858 |
| 843 | Ga0501070_0188395 | 3300049586 | Bacteria | 1696 |
| 844 | Ga0501071_0077893 | 3300049587 | Bacteria | 2422 |
| 845 | Ga0501072_0413864 | 3300049588 | Bacteria | 1069 |
| 846 | Ga0501073_0006774 | 3300049589 | Bacteria | 8529 |
| 847 | Ga0501074_0012936 | 3300049590 | Bacteria | 6067 |
| 848 | Ga0501076_0408016 | 3300049592 | Bacteria | 1117 |
| 849 | Ga0501077_0166512 | 3300049593 | Bacteria | 1400 |
| 850 | Ga0501079_0026795 | 3300049741 | Bacteria | 4419 |
| 851 | Ga0501080_0028534 | 3300049742 | Bacteria | 5193 |
| 852 | Ga0501081_0071525 | 3300049743 | Bacteria | 2418 |
| 853 | Ga0501083_0015045 | 3300049744 | Bacteria | 5415 |
| 854 | Ga0501035_0014526 | 3300049822 | Bacteria | 7268 |
| 855 | Ga0501035_0018612 | 3300049822 | Bacteria | 6396 |
| 856 | Ga0501044_0000193 | 3300049823 | Bacteria | 76794 |
| 857 | Ga0501044_0026928 | 3300049823 | Bacteria | 6083 |
| 858 | Ga0501044_0050174 | 3300049823 | Bacteria | 4307 |
| 859 | Ga0501044_0276295 | 3300049823 | Bacteria | 1615 |
| 860 | nmdc:mga03683_126932_c1 | 3300050489 | Bacteria | 1139 |
| 861 | nmdc:mga03683_59371_c1 | 3300050489 | Bacteria | 1613 |
| 862 | nmdc:mga0yw44_1168_c1 | 3300050492 | Bacteria | 10216 |
| 863 | nmdc:mga0yw44_393333_c1 | 3300050492 | Bacteria | 937 |
| 864 | nmdc:mga0yw44_86374_c1 | 3300050492 | Bacteria | 1976 |
| 865 | nmdc:mga0yw44_92657_c1 | 3300050492 | Bacteria | 1912 |
| 866 | nmdc:mga0k408_24007_c1 | 3300050493 | Bacteria | 3443 |
| 867 | nmdc:mga0k408_79482_c1 | 3300050493 | Bacteria | 1919 |
| 868 | nmdc:mga0k408_99043_c1 | 3300050493 | Bacteria | 1718 |
| 869 | nmdc:mga06z11_12529_c1 | 3300050494 | Bacteria | 3690 |
| 870 | nmdc:mga06z11_49678_c1 | 3300050494 | Bacteria | 2141 |
| 871 | nmdc:mga06z11_65020_c1 | 3300050494 | Bacteria | 1913 |
| 872 | nmdc:mga07m45_69470_c1 | 3300050496 | Bacteria | 2002 |
| 873 | nmdc:mga05p37_129066_c1 | 3300050507 | Bacteria | 3103 |
| 874 | nmdc:mga05p37_200042_c1 | 3300050507 | Bacteria | 2421 |
| 875 | nmdc:mga05p37_265489_c1 | 3300050507 | Unclassified | 2053 |
| 876 | nmdc:mga05p37_35469_c1 | 3300050507 | Bacteria | 6116 |
| 877 | nmdc:mga05p37_373263_c1 | 3300050507 | Bacteria | 1673 |
| 878 | nmdc:mga05p37_391044_c1 | 3300050507 | Bacteria | 1626 |
| 879 | nmdc:mga05p37_43990_c1 | 3300050507 | Bacteria | 5494 |
| 880 | nmdc:mga05p37_5345_c1 | 3300050507 | Bacteria | 15087 |
| 881 | nmdc:mga09592_148468_c1 | 3300050508 | Bacteria | 2022 |
| 882 | nmdc:mga09592_155548_c1 | 3300050508 | Bacteria | 1973 |
| 883 | nmdc:mga09592_183790_c1 | 3300050508 | Unclassified | 1809 |
| 884 | nmdc:mga0qj67_157449_c1 | 3300050509 | Bacteria | 1844 |
| 885 | nmdc:mga0qj67_61098_c1 | 3300050509 | Bacteria | 2991 |
| 886 | nmdc:mga0qj67_70762_c1 | 3300050509 | Unclassified | 2783 |
| 887 | nmdc:mga0qj67_86566_c1 | 3300050509 | Bacteria | 2514 |
| 888 | nmdc:mga06r32_128479_c1 | 3300050510 | Bacteria | 2504 |
| 889 | nmdc:mga06r32_92744_c1 | 3300050510 | Bacteria | 2953 |
| 890 | nmdc:mga08y16_105572_c1 | 3300050511 | Bacteria | 2932 |
| 891 | nmdc:mga08y16_2968_c1 | 3300050511 | Bacteria | 17488 |
| 892 | nmdc:mga08y16_391273_c1 | 3300050511 | Bacteria | 1424 |
| 893 | nmdc:mga08y16_8363_c1 | 3300050511 | Bacteria | 10827 |
| 894 | nmdc:mga0n895_101152_c1 | 3300050512 | Bacteria | 2892 |
| 895 | nmdc:mga0n895_12603_c1 | 3300050512 | Bacteria | 7589 |
| 896 | nmdc:mga0n895_142142_c1 | 3300050512 | Bacteria | 2429 |
| 897 | nmdc:mga0n895_602258_c1 | 3300050512 | Bacteria | 1101 |
| 898 | nmdc:mga0n895_91583_c1 | 3300050512 | Bacteria | 3043 |
| 899 | nmdc:mga0rr50_175655_c1 | 3300050513 | Bacteria | 1748 |
| 900 | nmdc:mga0rr50_402115_c1 | 3300050513 | Bacteria | 1157 |
| 901 | nmdc:mga08x19_217847_c1 | 3300050514 | Bacteria | 1311 |
| 902 | nmdc:mga0a205_152828_c1 | 3300050515 | Bacteria | 2207 |
| 903 | nmdc:mga0a205_40346_c1 | 3300050515 | Bacteria | 4493 |
| 904 | nmdc:mga0a205_75013_c1 | 3300050515 | Bacteria | 3268 |
| 905 | Ga0495601_0003097 | 3300053077 | Bacteria | 9495 |
| 906 | Ga0495601_0004245 | 3300053077 | Bacteria | 8274 |
| 907 | Ga0495601_0004639 | 3300053077 | Bacteria | 7956 |
| 908 | Ga0495601_0005848 | 3300053077 | Bacteria | 7172 |
| 909 | Ga0495601_0102456 | 3300053077 | Bacteria | 1850 |
| 910 | Ga0495612_0000183 | 3300053078 | Bacteria | 26502 |
| 911 | Ga0495612_0000857 | 3300053078 | Bacteria | 12364 |
| 912 | Ga0495612_0001353 | 3300053078 | Bacteria | 10099 |
| 913 | Ga0495612_0007748 | 3300053078 | Bacteria | 4382 |
| 914 | Ga0495612_0025192 | 3300053078 | Bacteria | 2389 |
| 915 | Ga0495595_0000207 | 3300053084 | Bacteria | 23763 |
| 916 | Ga0495595_0001895 | 3300053084 | Bacteria | 8123 |
| 917 | Ga0495595_0002395 | 3300053084 | Bacteria | 7321 |
| 918 | Ga0495595_0015608 | 3300053084 | Bacteria | 3239 |
| 919 | Ga0495619_0000108 | 3300053085 | Bacteria | 62197 |
| 920 | Ga0495619_0000225 | 3300053085 | Bacteria | 40938 |
| 921 | Ga0495619_0000650 | 3300053085 | Bacteria | 22811 |
| 922 | Ga0495619_0001982 | 3300053085 | Bacteria | 13624 |
| 923 | Ga0495619_0002633 | 3300053085 | Bacteria | 11726 |
| 924 | Ga0495619_0008701 | 3300053085 | Bacteria | 6419 |
| 925 | Ga0495619_0035311 | 3300053085 | Bacteria | 3251 |
| 926 | Ga0500644_0000428 | 3300053088 | Bacteria | 19683 |
| 927 | Ga0500651_0070006 | 3300053093 | Bacteria | 2184 |
| 928 | Ga0500641_0025612 | 3300053096 | Bacteria | 2283 |
| 929 | Ga0500641_0060086 | 3300053096 | Bacteria | 1581 |
| 930 | Ga0500650_0071339 | 3300053098 | Bacteria | 1623 |
| 931 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 932 | Ga0500616_0011892 | 3300053153 | Bacteria | 5116 |
| 933 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 934 | Ga0501084_0019048 | 3300054114 | Bacteria | 5716 |
| 935 | Ga0501084_0230516 | 3300054114 | Bacteria | 1563 |
| 936 | Ga0501082_0006937 | 3300060353 | Bacteria | 9790 |
| 937 | Ga0501082_0215839 | 3300060353 | Bacteria | 1669 |
| 938 | Ga0530510_0058419 | 3300061734 | Bacteria | 2789 |
| 939 | 2511131504 | 2510917022 | Bacteria | 6504556 |
| 940 | Ga0495629_0045152 | |||
| 941 | 2214745235 | |||
| 942 | ARSoilYngRDRAFT_c00289 | |||
| 943 | ARcpr5yngRDRAFT_c000271 | |||
| 944 | ARSoilOldRDRAFT_c000295 | |||
| 945 | ARCol0yngRDRAFT_1000053 | |||
| 946 | JGI24740J21852_10014159 | |||
| 947 | JGI24737J22298_10002175 | |||
| 948 | JGI24750J21931_1000807 | |||
| 949 | JGI24750J21931_1002444 | |||
| 950 | JGI24748J21848_1001444 | |||
| 951 | JGI24738J21930_10003423 | |||
| 952 | JGI24749J21850_1005224 | |||
| 953 | JGI24744J21845_10001325 | |||
| 954 | JGI24033J26618_1002454 | |||
| 955 | JGI24034J26672_10000436 | |||
| 956 | JGI24742J22300_10000131 | |||
| 957 | JGI24742J22300_10007537 | |||
| 958 | JGI25406J46586_10010069 | |||
| 959 | JGI25405J52794_10017289 | |||
| 960 | Ga0065716_1002255 | |||
| 961 | Ga0065704_10101333 | |||
| 962 | Ga0065712_10006389 | |||
| 963 | Ga0065712_10020432 | |||
| 964 | Ga0065715_10000953 | |||
| 965 | Ga0065715_10006553 | |||
| 966 | Ga0065707_10113298 | |||
| 967 | Ga0070676_10008398 | |||
| 968 | Ga0070676_10027396 | |||
| 969 | Ga0070683_100001740 | |||
| 970 | Ga0070690_100005830 | |||
| 971 | Ga0070690_100071996 | |||
| 972 | Ga0070670_100023972 | |||
| 973 | Ga0070670_100026485 | |||
| 974 | Ga0070677_10000553 | |||
| 975 | Ga0068869_100004139 | |||
| 976 | Ga0068869_100028847 | |||
| 977 | Ga0068869_100059369 | |||
| 978 | Ga0068869_100224315 | |||
| 979 | Ga0070666_10021676 | |||
| 980 | Ga0070666_10073203 | |||
| 981 | Ga0070680_100002899 | |||
| 982 | Ga0070680_100013552 | |||
| 983 | Ga0070682_100044407 | |||
| 984 | Ga0070682_100196384 | |||
| 985 | Ga0068868_100005781 | |||
| 986 | Ga0068868_100073271 | |||
| 987 | Ga0070660_100001515 | |||
| 988 | Ga0070660_100198358 | |||
| 989 | Ga0070689_100001241 | |||
| 990 | Ga0070691_10064595 | |||
| 991 | Ga0070687_100002230 | |||
| 992 | Ga0070687_100093250 | |||
| 993 | Ga0070661_100012739 | |||
| 994 | Ga0070661_100056802 | |||
| 995 | Ga0070692_10006992 | |||
| 996 | Ga0070692_10008859 | |||
| 997 | Ga0070692_10156883 | |||
| 998 | Ga0070668_100002506 | |||
| 999 | Ga0070668_100066945 | |||
| 1000 | Ga0070668_100344455 | |||
| 1001 | Ga0070668_100352522 | |||
| 1002 | Ga0070669_100000743 | |||
| 1003 | Ga0070675_100001086 | |||
| 1004 | Ga0070675_100162845 | |||
| 1005 | Ga0070675_100196384 | |||
| 1006 | Ga0070671_100004095 | |||
| 1007 | Ga0070671_100006476 | |||
| 1008 | Ga0070671_100052468 | |||
| 1009 | Ga0070671_100176242 | |||
| 1010 | Ga0070674_100063066 | |||
| 1011 | Ga0070674_100541386 | |||
| 1012 | Ga0070673_100000419 | |||
| 1013 | Ga0070688_100003465 | |||
| 1014 | Ga0070659_100007008 | |||
| 1015 | Ga0070659_100022088 | |||
| 1016 | Ga0070659_100055244 | |||
| 1017 | Ga0070667_100279960 | |||
| 1018 | Ga0070703_10001244 | |||
| 1019 | Ga0070703_10004556 | |||
| 1020 | Ga0070709_10011868 | |||
| 1021 | Ga0070709_10021857 | |||
| 1022 | Ga0070709_10042462 | |||
| 1023 | Ga0070709_10073099 | |||
| 1024 | Ga0070714_100004331 | |||
| 1025 | Ga0070714_100087894 | |||
| 1026 | Ga0070714_100203326 | |||
| 1027 | Ga0070713_100005705 | |||
| 1028 | Ga0070713_100016797 | |||
| 1029 | Ga0070713_100023528 | |||
| 1030 | Ga0070713_100031744 | |||
| 1031 | Ga0070713_100121641 | |||
| 1032 | Ga0070713_100167706 | |||
| 1033 | Ga0070713_100364987 | |||
| 1034 | Ga0070710_10000528 | |||
| 1035 | Ga0070710_10004305 | |||
| 1036 | Ga0070710_10008141 | |||
| 1037 | Ga0070710_10068466 | |||
| 1038 | Ga0070710_10075948 | |||
| 1039 | Ga0070701_10000365 | |||
| 1040 | Ga0070701_10007962 | |||
| 1041 | Ga0070701_10059982 | |||
| 1042 | Ga0070711_100003401 | |||
| 1043 | Ga0070711_100021147 | |||
| 1044 | Ga0070711_100039114 | |||
| 1045 | Ga0070711_100073866 | |||
| 1046 | Ga0070711_100363821 | |||
| 1047 | Ga0070705_100001329 | |||
| 1048 | Ga0070705_100001964 | |||
| 1049 | Ga0070700_100008089 | |||
| 1050 | Ga0070700_100008776 | |||
| 1051 | Ga0070700_100065982 | |||
| 1052 | Ga0070694_100002737 | |||
| 1053 | Ga0070694_100021203 | |||
| 1054 | Ga0070694_100180133 | |||
| 1055 | Ga0070708_100041374 | |||
| 1056 | Ga0070663_100019174 | |||
| 1057 | Ga0070663_100217857 | |||
| 1058 | Ga0070678_100005723 | |||
| 1059 | Ga0070678_100083622 | |||
| 1060 | Ga0070678_100202717 | |||
| 1061 | Ga0070662_100025249 | |||
| 1062 | Ga0070662_100180533 | |||
| 1063 | Ga0070681_10010311 | |||
| 1064 | Ga0070681_10019665 | |||
| 1065 | Ga0070681_10189278 | |||
| 1066 | Ga0068867_100000980 | |||
| 1067 | Ga0070685_10014838 | |||
| 1068 | Ga0070685_10015980 | |||
| 1069 | Ga0070706_100361152 | |||
| 1070 | Ga0070706_100563484 | |||
| 1071 | Ga0070699_100000444 | |||
| 1072 | Ga0070699_100001276 | |||
| 1073 | Ga0070679_100004363 | |||
| 1074 | Ga0070684_100013266 | |||
| 1075 | Ga0070684_100053185 | |||
| 1076 | Ga0070684_100233276 | |||
| 1077 | Ga0070697_100017942 | |||
| 1078 | Ga0070697_100066086 | |||
| 1079 | Ga0070697_100273340 | |||
| 1080 | Ga0068853_100006929 | |||
| 1081 | Ga0070672_100002302 | |||
| 1082 | Ga0070672_100055215 | |||
| 1083 | Ga0070686_100012378 | |||
| 1084 | Ga0070686_100014304 | |||
| 1085 | Ga0070686_100017776 | |||
| 1086 | Ga0070695_100000918 | |||
| 1087 | Ga0070695_100012338 | |||
| 1088 | Ga0070696_100000123 | |||
| 1089 | Ga0070696_100002724 | |||
| 1090 | Ga0070696_100221935 | |||
| 1091 | Ga0070693_100001476 | |||
| 1092 | Ga0070704_100000095 | |||
| 1093 | Ga0070704_100037262 | |||
| 1094 | Ga0068855_100066013 | |||
| 1095 | Ga0068855_100279563 | |||
| 1096 | Ga0070664_100105237 | |||
| 1097 | Ga0070664_100353332 | |||
| 1098 | Ga0068857_100002177 | |||
| 1099 | Ga0068857_100011660 | |||
| 1100 | Ga0068857_100087240 | |||
| 1101 | Ga0068856_100003552 | |||
| 1102 | Ga0068856_100058287 | |||
| 1103 | Ga0068856_100227952 | |||
| 1104 | Ga0070702_100016382 | |||
| 1105 | Ga0070702_100018984 | |||
| 1106 | Ga0070702_100087978 | |||
| 1107 | Ga0068852_100051926 | |||
| 1108 | Ga0068859_100001820 | |||
| 1109 | Ga0068859_100005818 | |||
| 1110 | Ga0068859_100063245 | |||
| 1111 | Ga0068864_100000140 | |||
| 1112 | Ga0068864_100230813 | |||
| 1113 | Ga0068866_10001684 | |||
| 1114 | Ga0068866_10204219 | |||
| 1115 | Ga0068861_100013494 | |||
| 1116 | Ga0068861_100095034 | |||
| 1117 | Ga0068851_10033291 | |||
| 1118 | Ga0068870_10000654 | |||
| 1119 | Ga0068863_100000425 | |||
| 1120 | Ga0068863_100027701 | |||
| 1121 | Ga0068858_100095071 | |||
| 1122 | Ga0068858_100167557 | |||
| 1123 | Ga0068860_100002696 | |||
| 1124 | Ga0068860_100064786 | |||
| 1125 | Ga0068862_100020271 | |||
| 1126 | Ga0068862_100089132 | |||
| 1127 | Ga0081455_10001118 | |||
| 1128 | Ga0081455_10011426 | |||
| 1129 | Ga0081455_10088394 | |||
| 1130 | Ga0081538_10002263 | |||
| 1131 | Ga0081538_10060249 | |||
| 1132 | Ga0081540_1000192 | |||
| 1133 | Ga0081540_1006947 | |||
| 1134 | Ga0081540_1024775 | |||
| 1135 | Ga0081540_1039437 | |||
| 1136 | Ga0081540_1058554 | |||
| 1137 | Ga0081539_10001465 | |||
| 1138 | Ga0070717_10001340 | |||
| 1139 | Ga0070717_10011028 | |||
| 1140 | Ga0070717_10044248 | |||
| 1141 | Ga0075365_10025752 | |||
| 1142 | Ga0075365_10032144 | |||
| 1143 | Ga0075365_10261035 | |||
| 1144 | Ga0075363_100071859 | |||
| 1145 | Ga0075363_100243829 | |||
| 1146 | Ga0075364_10209762 | |||
| 1147 | Ga0075432_10094301 | |||
| 1148 | Ga0070715_10000357 | |||
| 1149 | Ga0070715_10012668 | |||
| 1150 | Ga0070715_10024931 | |||
| 1151 | Ga0070716_100044490 | |||
| 1152 | Ga0070712_100001277 | |||
| 1153 | Ga0070712_100008584 | |||
| 1154 | Ga0070712_100115819 | |||
| 1155 | Ga0070712_100195653 | |||
| 1156 | Ga0070712_100206962 | |||
| 1157 | Ga0070712_100207459 | |||
| 1158 | Ga0070712_100263486 | |||
| 1159 | Ga0070712_100477325 | |||
| 1160 | Ga0075362_10050487 | |||
| 1161 | Ga0075367_10039252 | |||
| 1162 | Ga0075367_10082303 | |||
| 1163 | Ga0097621_100002131 | |||
| 1164 | Ga0075370_10071803 | |||
| 1165 | Ga0068871_100008325 | |||
| 1166 | Ga0075428_100019702 | |||
| 1167 | Ga0075428_100028244 | |||
| 1168 | Ga0075428_100610295 | |||
| 1169 | Ga0075430_100014084 | |||
| 1170 | Ga0075430_100037162 | |||
| 1171 | Ga0075430_100041065 | |||
| 1172 | Ga0075430_100060072 | |||
| 1173 | Ga0075430_100077840 | |||
| 1174 | Ga0075431_100004314 | |||
| 1175 | Ga0075431_100017715 | |||
| 1176 | Ga0075431_100021672 | |||
| 1177 | Ga0075431_100246339 | |||
| 1178 | Ga0075433_10140634 | |||
| 1179 | Ga0075433_10148169 | |||
| 1180 | Ga0075434_100021735 | |||
| 1181 | Ga0075434_100034873 | |||
| 1182 | Ga0075434_100058688 | |||
| 1183 | Ga0075434_100183079 | |||
| 1184 | Ga0075434_100358577 | |||
| 1185 | Ga0075429_100155580 | |||
| 1186 | Ga0075429_100218808 | |||
| 1187 | Ga0075429_100431945 | |||
| 1188 | Ga0068865_100001142 | |||
| 1189 | Ga0068865_100036778 | |||
| 1190 | Ga0068865_100093528 | |||
| 1191 | Ga0068865_100112799 | |||
| 1192 | Ga0068865_100126065 | |||
| 1193 | Ga0075436_100093284 | |||
| 1194 | Ga0075436_100102002 | |||
| 1195 | Ga0097620_100001820 | |||
| 1196 | Ga0097620_100005818 | |||
| 1197 | Ga0097620_100063246 | |||
| 1198 | Ga0097620_100316806 | |||
| 1199 | Ga0075435_100022544 | |||
| 1200 | Ga0075435_100125934 | |||
| 1201 | Ga0099794_10036502 | |||
| 1202 | Ga0105250_10032989 | |||
| 1203 | Ga0105240_10109955 | |||
| 1204 | Ga0105240_10175329 | |||
| 1205 | Ga0111539_10006796 | |||
| 1206 | Ga0111539_10014173 | |||
| 1207 | Ga0111539_10081343 | |||
| 1208 | Ga0111539_10188463 | |||
| 1209 | Ga0111539_10479910 | |||
| 1210 | Ga0111539_10499868 | |||
| 1211 | Ga0111539_10568213 | |||
| 1212 | Ga0111539_10803476 | |||
| 1213 | Ga0105245_10000867 | |||
| 1214 | Ga0105245_10023386 | |||
| 1215 | Ga0105247_10116603 | |||
| 1216 | Ga0114129_10017149 | |||
| 1217 | Ga0114129_10041031 | |||
| 1218 | Ga0114129_10045872 | |||
| 1219 | Ga0114129_10080861 | |||
| 1220 | Ga0114129_10172654 | |||
| 1221 | Ga0114129_10233581 | |||
| 1222 | Ga0114129_10329811 | |||
| 1223 | Ga0114129_10504452 | |||
| 1224 | Ga0105243_10002939 | |||
| 1225 | Ga0105243_10018773 | |||
| 1226 | Ga0105243_10143444 | |||
| 1227 | Ga0105241_10007866 | |||
| 1228 | Ga0105241_10036622 | |||
| 1229 | Ga0105241_10172341 | |||
| 1230 | Ga0105242_10001899 | |||
| 1231 | Ga0105242_10014951 | |||
| 1232 | Ga0105242_10064165 | |||
| 1233 | Ga0105248_10003521 | |||
| 1234 | Ga0105248_10029630 | |||
| 1235 | Ga0105237_10102889 | |||
| 1236 | Ga0105237_10135063 | |||
| 1237 | Ga0105237_10139250 | |||
| 1238 | Ga0105238_10037311 | |||
| 1239 | Ga0105238_10119701 | |||
| 1240 | Ga0105238_10146147 | |||
| 1241 | Ga0105249_10002047 | |||
| 1242 | Ga0105249_10002541 | |||
| 1243 | Ga0105249_10553691 | |||
| 1244 | Ga0105239_10021557 | |||
| 1245 | Ga0105239_10037616 | |||
| 1246 | Ga0105246_10001875 | |||
| 1247 | Ga0157342_1006643 | |||
| 1248 | Ga0157373_10100959 | |||
| 1249 | Ga0157373_10248718 | |||
| 1250 | Ga0157374_10001408 | |||
| 1251 | Ga0157374_10110998 | |||
| 1252 | Ga0157374_10214333 | |||
| 1253 | Ga0157378_10004977 | |||
| 1254 | Ga0157378_10246279 | |||
| 1255 | Ga0163162_10011093 | |||
| 1256 | Ga0163162_10012257 | |||
| 1257 | Ga0163162_10130425 | |||
| 1258 | Ga0163162_10295032 | |||
| 1259 | Ga0157372_10017879 | |||
| 1260 | Ga0157372_10770034 | |||
| 1261 | Ga0157375_10001932 | |||
| 1262 | Ga0157375_10113004 | |||
| 1263 | Ga0163163_10034835 | |||
| 1264 | Ga0163163_10301099 | |||
| 1265 | Ga0163163_10352355 | |||
| 1266 | Ga0157380_10014641 | |||
| 1267 | Ga0157380_10018915 | |||
| 1268 | Ga0157380_10157568 | |||
| 1269 | Ga0157380_10202861 | |||
| 1270 | Ga0157377_10000486 | |||
| 1271 | Ga0157377_10039708 | |||
| 1272 | Ga0157379_10006828 | |||
| 1273 | Ga0157379_10057193 | |||
| 1274 | Ga0157379_10133136 | |||
| 1275 | Ga0157376_10068143 | |||
| 1276 | Ga0157376_10709013 | |||
| 1277 | Ga0213872_10028413 | |||
| 1278 | Ga0213876_10033035 | |||
| 1279 | Ga0213875_10000003 | |||
| 1280 | Ga0207666_1000089 | |||
| 1281 | Ga0207673_1002235 | |||
| 1282 | Ga0207697_10000993 | |||
| 1283 | Ga0207656_10049715 | |||
| 1284 | Ga0207653_10008690 | |||
| 1285 | Ga0207682_10000104 | |||
| 1286 | Ga0207692_10000076 | |||
| 1287 | Ga0207692_10026416 | |||
| 1288 | Ga0207642_10001116 | |||
| 1289 | Ga0207710_10088660 | |||
| 1290 | Ga0207688_10001265 | |||
| 1291 | Ga0207688_10002264 | |||
| 1292 | Ga0207688_10029868 | |||
| 1293 | Ga0207680_10006968 | |||
| 1294 | Ga0207680_10018072 | |||
| 1295 | Ga0207647_10001528 | |||
| 1296 | Ga0207647_10060693 | |||
| 1297 | Ga0207647_10258746 | |||
| 1298 | Ga0207685_10020579 | |||
| 1299 | Ga0207685_10028679 | |||
| 1300 | Ga0207699_10008588 | |||
| 1301 | Ga0207699_10111324 | |||
| 1302 | Ga0207699_10164078 | |||
| 1303 | Ga0207699_10270969 | |||
| 1304 | Ga0207645_10002130 | |||
| 1305 | Ga0207645_10070174 | |||
| 1306 | Ga0207643_10000035 | |||
| 1307 | Ga0207643_10002863 | |||
| 1308 | Ga0207684_10152225 | |||
| 1309 | Ga0207654_10026417 | |||
| 1310 | Ga0207707_10001935 | |||
| 1311 | Ga0207707_10046635 | |||
| 1312 | Ga0207707_10092137 | |||
| 1313 | Ga0207695_10038532 | |||
| 1314 | Ga0207693_10001480 | |||
| 1315 | Ga0207693_10001843 | |||
| 1316 | Ga0207693_10004775 | |||
| 1317 | Ga0207693_10008913 | |||
| 1318 | Ga0207693_10026826 | |||
| 1319 | Ga0207693_10057698 | |||
| 1320 | Ga0207693_10184433 | |||
| 1321 | Ga0207693_10200058 | |||
| 1322 | Ga0207693_10207692 | |||
| 1323 | Ga0207693_10229672 | |||
| 1324 | Ga0207663_10008697 | |||
| 1325 | Ga0207663_10090454 | |||
| 1326 | Ga0207663_10110263 | |||
| 1327 | Ga0207663_10172413 | |||
| 1328 | Ga0207663_10254950 | |||
| 1329 | Ga0207660_10000451 | |||
| 1330 | Ga0207660_10001146 | |||
| 1331 | Ga0207660_10032704 | |||
| 1332 | Ga0207662_10002323 | |||
| 1333 | Ga0207662_10060397 | |||
| 1334 | Ga0207657_10002025 | |||
| 1335 | Ga0207657_10024447 | |||
| 1336 | Ga0207649_10000309 | |||
| 1337 | Ga0207649_10308122 | |||
| 1338 | Ga0207652_10010263 | |||
| 1339 | Ga0207652_10058859 | |||
| 1340 | Ga0207646_10304826 | |||
| 1341 | Ga0207681_10001488 | |||
| 1342 | Ga0207694_10068334 | |||
| 1343 | Ga0207694_10144188 | |||
| 1344 | Ga0207694_10227863 | |||
| 1345 | Ga0207650_10006726 | |||
| 1346 | Ga0207650_10061427 | |||
| 1347 | Ga0207659_10000091 | |||
| 1348 | Ga0207659_10116261 | |||
| 1349 | Ga0207687_10000161 | |||
| 1350 | Ga0207687_10085640 | |||
| 1351 | Ga0207700_10002812 | |||
| 1352 | Ga0207700_10009232 | |||
| 1353 | Ga0207700_10096860 | |||
| 1354 | Ga0207700_10264668 | |||
| 1355 | Ga0207700_10393120 | |||
| 1356 | Ga0207700_10400254 | |||
| 1357 | Ga0207700_10527315 | |||
| 1358 | Ga0207664_10006249 | |||
| 1359 | Ga0207664_10011444 | |||
| 1360 | Ga0207664_10210631 | |||
| 1361 | Ga0207664_10236410 | |||
| 1362 | Ga0207644_10000245 | |||
| 1363 | Ga0207644_10052208 | |||
| 1364 | Ga0207644_10074056 | |||
| 1365 | Ga0207644_10105600 | |||
| 1366 | Ga0207690_10000771 | |||
| 1367 | Ga0207690_10088403 | |||
| 1368 | Ga0207706_10005499 | |||
| 1369 | Ga0207706_10012450 | |||
| 1370 | Ga0207706_10110642 | |||
| 1371 | Ga0207686_10001194 | |||
| 1372 | Ga0207686_10008989 | |||
| 1373 | Ga0207686_10040051 | |||
| 1374 | Ga0207709_10001001 | |||
| 1375 | Ga0207709_10075536 | |||
| 1376 | Ga0207709_10084032 | |||
| 1377 | Ga0207670_10000526 | |||
| 1378 | Ga0207670_10018175 | |||
| 1379 | Ga0207670_10090762 | |||
| 1380 | Ga0207670_10262025 | |||
| 1381 | Ga0207669_10011592 | |||
| 1382 | Ga0207704_10031210 | |||
| 1383 | Ga0207704_10092693 | |||
| 1384 | Ga0207665_10001028 | |||
| 1385 | Ga0207665_10007368 | |||
| 1386 | Ga0207665_10025516 | |||
| 1387 | Ga0207665_10127780 | |||
| 1388 | Ga0207665_10185695 | |||
| 1389 | Ga0207691_10000336 | |||
| 1390 | Ga0207691_10015407 | |||
| 1391 | Ga0207711_10035966 | |||
| 1392 | Ga0207711_10061529 | |||
| 1393 | Ga0207711_10295596 | |||
| 1394 | Ga0207689_10000168 | |||
| 1395 | Ga0207689_10028925 | |||
| 1396 | Ga0207689_10098550 | |||
| 1397 | Ga0207689_10145944 | |||
| 1398 | Ga0207661_10000575 | |||
| 1399 | Ga0207661_10258176 | |||
| 1400 | Ga0207679_10000035 | |||
| 1401 | Ga0207679_10019432 | |||
| 1402 | Ga0207679_10205302 | |||
| 1403 | Ga0207667_10098793 | |||
| 1404 | Ga0207651_10000233 | |||
| 1405 | Ga0207651_10075434 | |||
| 1406 | Ga0207712_10000768 | |||
| 1407 | Ga0207712_10009092 | |||
| 1408 | Ga0207668_10001470 | |||
| 1409 | Ga0207668_10159635 | |||
| 1410 | Ga0207668_10270678 | |||
| 1411 | Ga0207640_10001231 | |||
| 1412 | Ga0207658_10073032 | |||
| 1413 | Ga0207677_10000997 | |||
| 1414 | Ga0207677_10061228 | |||
| 1415 | Ga0207703_10001880 | |||
| 1416 | Ga0207703_10091454 | |||
| 1417 | Ga0207639_10000421 | |||
| 1418 | Ga0207678_10001561 | |||
| 1419 | Ga0207678_10016361 | |||
| 1420 | Ga0207678_10186746 | |||
| 1421 | Ga0207708_10001793 | |||
| 1422 | Ga0207708_10004956 | |||
| 1423 | Ga0207708_10013704 | |||
| 1424 | Ga0207702_10045251 | |||
| 1425 | Ga0207641_10003563 | |||
| 1426 | Ga0207641_10484983 | |||
| 1427 | Ga0207648_10004259 | |||
| 1428 | Ga0207648_10060537 | |||
| 1429 | Ga0207648_10205886 | |||
| 1430 | Ga0207674_10000535 | |||
| 1431 | Ga0207674_10002113 | |||
| 1432 | Ga0207674_10112624 | |||
| 1433 | Ga0207675_100000365 | |||
| 1434 | Ga0207683_10000667 | |||
| 1435 | Ga0207683_10010556 | |||
| 1436 | Ga0207698_10006961 | |||
| 1437 | Ga0207698_10026318 | |||
| 1438 | Ga0207698_10326536 | |||
| 1439 | Ga0210002_1000583 | |||
| 1440 | Ga0209983_1008797 | |||
| 1441 | Ga0209998_10001636 | |||
| 1442 | Ga0209974_10006220 | |||
| 1443 | Ga0207428_10000636 | |||
| 1444 | Ga0207428_10001024 | |||
| 1445 | Ga0268266_10005119 | |||
| 1446 | Ga0268265_10003727 | |||
| 1447 | Ga0268265_10007391 | |||
| 1448 | Ga0268264_10001508 | |||
| 1449 | Ga0268264_10002415 | |||
| 1450 | Ga0268264_10101929 | |||
| 1451 | Ga0265338_10004828 | |||
| 1452 | Ga0265338_10031592 | |||
| 1453 | Ga0265330_10098784 | |||
| 1454 | Ga0265332_10000319 | |||
| 1455 | Ga0265325_10000019 | |||
| 1456 | Ga0265325_10003344 | |||
| 1457 | Ga0265325_10003410 | |||
| 1458 | Ga0265325_10115243 | |||
| 1459 | Ga0265329_10094961 | |||
| 1460 | Ga0265340_10058370 | |||
| 1461 | Ga0265339_10000269 | |||
| 1462 | Ga0265339_10019476 | |||
| 1463 | Ga0265331_10013951 | |||
| 1464 | Ga0265316_10064110 | |||
| 1465 | Ga0265313_10001274 | |||
| 1466 | Ga0265313_10001604 | |||
| 1467 | Ga0265314_10000577 | |||
| 1468 | Ga0265314_10093502 | |||
| 1469 | Ga0265342_10000050 | |||
| 1470 | Ga0265342_10000085 | |||
| 1471 | Ga0373930_0000585 | |||
| 1472 | Ga0373948_0000258 | |||
| 1473 | Ga0373950_0003921 | |||
| 1474 | Ga0373958_0000124 | |||
| 1475 | Ga0373958_0005327 | |||
| 1476 | Ga0373938_0000585 | |||
| 1477 | Ga0373926_0006655 | |||
| 1478 | Ga0373928_0000615 | |||
| 1479 | Ga0373929_0000271 | |||
| 1480 | Ga0373929_0003779 | |||
| 1481 | Ga0373934_0006337 | |||
| 1482 | Ga0373934_0111791 | |||
| 1483 | Ga0373940_0003638 | |||
| 1484 | Ga0373940_0025596 | |||
| 1485 | Ga0373944_0038946 | |||
| 1486 | Ga0373949_0002356 | |||
| 1487 | Ga0373949_0002759 | |||
| 1488 | Ga0373951_0003109 | |||
| 1489 | Ga0373951_0004829 | |||
| 1490 | Ga0373952_0016434 | |||
| 1491 | Ga0373923_0024434 | |||
| 1492 | Ga0373932_0004854 | |||
| 1493 | Ga0373932_0010920 | |||
| 1494 | Ga0373932_0019069 | |||
| 1495 | Ga0373939_0001233 | |||
| 1496 | Ga0373941_0021850 | |||
| 1497 | Ga0373941_0109674 | |||
| 1498 | Ga0373945_0076492 | |||
| 1499 | Ga0373953_0003874 | |||
| 1500 | Ga0373953_0005397 | |||
| 1501 | Ga0373953_0016741 | |||
| 1502 | Ga0373953_0025943 | |||
| 1503 | Ga0373954_0001845 | |||
| 1504 | Ga0373954_0026156 | |||
| 1505 | Ga0373957_0001073 | |||
| 1506 | Ga0373960_0000880 | |||
| 1507 | Ga0373960_0003195 | |||
| 1508 | Ga0373943_0016099 | |||
| 1509 | Ga0373943_0016942 | |||
| 1510 | Ga0373943_0025782 | |||
| 1511 | Ga0373955_0000732 | |||
| 1512 | Ga0373955_0001003 | |||
| 1513 | Ga0373955_0003829 | |||
| 1514 | Ga0373955_0005598 | |||
| 1515 | Ga0373942_0008727 | |||
| 1516 | Ga0373961_0001257 | |||
| 1517 | Ga0373962_0016674 | |||
| 1518 | Ga0373924_0016437 | |||
| 1519 | Ga0373931_0002231 | |||
| 1520 | Ga0373931_0008138 | |||
| 1521 | Ga0373935_0008410 | |||
| 1522 | Ga0373933_0000562 | |||
| 1523 | Ga0373933_0001283 | |||
| 1524 | Ga0373933_0003500 | |||
| 1525 | Ga0373947_0017002 | |||
| 1526 | Ga0373947_0047748 | |||
| 1527 | Ga0373937_0000935 | |||
| 1528 | Ga0373937_0001648 | |||
| 1529 | Ga0373937_0003782 | |||
| 1530 | Ga0373937_0004562 | |||
| 1531 | Ga0373925_0070415 | |||
| 1532 | Ga0373925_0072197 | |||
| 1533 | Ga0373925_0143037 | |||
| 1534 | Ga0373925_0144080 | |||
| 1535 | Ga0395899_0303483 | |||
| 1536 | Ga0395898_0315859 | |||
| 1537 | Ga0395898_0382342 | |||
| 1538 | Ga0436365_0069514 | |||
| 1539 | Ga0436365_0518063 | |||
| 1540 | Ga0436365_1724574 | |||
| 1541 | Ga0436361_0174868 | |||
| 1542 | Ga0436361_0667785 | |||
| 1543 | Ga0451800_0612411 | |||
| 1544 | Ga0439463_038340 | |||
| 1545 | Ga0450923_036232 | |||
| 1546 | Ga0466966_0001275 | |||
| 1547 | Ga0466961_0002805 | |||
| 1548 | Ga0466963_0056152 | |||
| 1549 | Ga0466957_0015701 | |||
| 1550 | Ga0466957_0401730 | |||
| 1551 | Ga0466959_0010634 | |||
| 1552 | Ga0466958_0011534 | |||
| 1553 | Ga0495592_0000755 | |||
| 1554 | Ga0495592_0008302 | |||
| 1555 | Ga0495592_0024816 | |||
| 1556 | Ga0495603_0018845 | |||
| 1557 | Ga0495629_0107571 | |||
| 1558 | Ga0495638_0009619 | |||
| 1559 | Ga0495638_0028565 | |||
| 1560 | Ga0495638_0111672 | |||
| 1561 | Ga0495651_0008054 | |||
| 1562 | Ga0495651_0039432 | |||
| 1563 | Ga0495653_0003235 | |||
| 1564 | Ga0495653_0020057 | |||
| 1565 | Ga0495653_0033321 | |||
| 1566 | Ga0495653_0309200 | |||
| 1567 | Ga0495580_0217640 | |||
| 1568 | Ga0495580_0314163 | |||
| 1569 | Ga0495582_0074166 | |||
| 1570 | Ga0495639_0119113 | |||
| 1571 | Ga0495662_0036623 | |||
| 1572 | Ga0495664_0004237 | |||
| 1573 | Ga0495664_0207902 | |||
| 1574 | Ga0495664_0216571 | |||
| 1575 | Ga0495594_0049367 | |||
| 1576 | Ga0495594_0111271 | |||
| 1577 | Ga0495607_0178115 | |||
| 1578 | Ga0495608_0000413 | |||
| 1579 | Ga0495608_0000909 | |||
| 1580 | Ga0495608_0037441 | |||
| 1581 | Ga0495618_0000259 | |||
| 1582 | Ga0495618_0003490 | |||
| 1583 | Ga0495628_0005724 | |||
| 1584 | Ga0495628_0026118 | |||
| 1585 | Ga0495628_0352550 | |||
| 1586 | Ga0495630_0037619 | |||
| 1587 | Ga0495630_0091143 | |||
| 1588 | Ga0495630_0139869 | |||
| 1589 | Ga0495631_0069164 | |||
| 1590 | Ga0495637_0111348 | |||
| 1591 | Ga0495644_0008358 | |||
| 1592 | Ga0495666_0103014 | |||
| 1593 | Ga0495666_0142013 | |||
| 1594 | Ga0495642_0032781 | |||
| 1595 | Ga0495652_0003415 | |||
| 1596 | Ga0495652_0004853 | |||
| 1597 | Ga0495652_0007759 | |||
| 1598 | Ga0495665_0020138 | |||
| 1599 | Ga0495665_0106929 | |||
| 1600 | Ga0495640_0001238 | |||
| 1601 | Ga0495640_0002101 | |||
| 1602 | Ga0495640_0052041 | |||
| 1603 | Ga0495640_0072503 | |||
| 1604 | Ga0495587_0000335 | |||
| 1605 | Ga0495587_0004881 | |||
| 1606 | Ga0495587_0049250 | |||
| 1607 | Ga0495645_0006430 | |||
| 1608 | Ga0495645_0020316 | |||
| 1609 | Ga0495633_0014285 | |||
| 1610 | Ga0495667_0000333 | |||
| 1611 | Ga0495667_0000565 | |||
| 1612 | Ga0495667_0001149 | |||
| 1613 | Ga0495667_0049025 | |||
| 1614 | Ga0495656_0006175 | |||
| 1615 | Ga0495656_0047306 | |||
| 1616 | Ga0495668_0099572 | |||
| 1617 | Ga0495634_0031880 | |||
| 1618 | Ga0495625_0120176 | |||
| 1619 | Ga0495635_0003525 | |||
| 1620 | Ga0495635_0008973 | |||
| 1621 | Ga0495635_0015934 | |||
| 1622 | Ga0495588_0031463 | |||
| 1623 | Ga0495657_0006050 | |||
| 1624 | Ga0495657_0008927 | |||
| 1625 | Ga0495657_0030475 | |||
| 1626 | Ga0495599_0002084 | |||
| 1627 | Ga0495599_0002227 | |||
| 1628 | Ga0495623_0006023 | |||
| 1629 | Ga0495623_0071727 | |||
| 1630 | Ga0495646_0000174 | |||
| 1631 | Ga0495646_0001804 | |||
| 1632 | Ga0495646_0113783 | |||
| 1633 | Ga0495647_0005601 | |||
| 1634 | Ga0495658_0009010 | |||
| 1635 | Ga0495658_0038554 | |||
| 1636 | Ga0495658_0122096 | |||
| 1637 | Ga0495669_0046308 | |||
| 1638 | Ga0495669_0120306 | |||
| 1639 | Ga0495613_0026270 | |||
| 1640 | Ga0495624_0054432 | |||
| 1641 | Ga0495624_0129236 | |||
| 1642 | Ga0495670_0059889 | |||
| 1643 | Ga0495671_0125412 | |||
| 1644 | Ga0495649_0111603 | |||
| 1645 | Ga0495600_0009519 | |||
| 1646 | Ga0495600_0010622 | |||
| 1647 | Ga0495600_0027331 | |||
| 1648 | Ga0495581_0075122 | |||
| 1649 | Ga0495604_0000394 | |||
| 1650 | Ga0495604_0002160 | |||
| 1651 | Ga0495604_0014145 | |||
| 1652 | Ga0495604_0020405 | |||
| 1653 | Ga0495674_0003197 | |||
| 1654 | Ga0495674_0007775 | |||
| 1655 | Ga0495674_0019628 | |||
| 1656 | Ga0495674_0066618 | |||
| 1657 | Ga0495676_0097596 | |||
| 1658 | Ga0495680_0000539 | |||
| 1659 | Ga0495680_0011470 | |||
| 1660 | Ga0495680_0024811 | |||
| 1661 | Ga0495675_0000139 | |||
| 1662 | Ga0495675_0020530 | |||
| 1663 | Ga0495675_0032480 | |||
| 1664 | Ga0495675_0053415 | |||
| 1665 | Ga0495684_0019982 | |||
| 1666 | Ga0495684_0023374 | |||
| 1667 | Ga0495684_0046187 | |||
| 1668 | Ga0495684_0133792 | |||
| 1669 | Ga0495593_0025441 | |||
| 1670 | Ga0495593_0164274 | |||
| 1671 | Ga0495602_0000310 | |||
| 1672 | Ga0495602_0003234 | |||
| 1673 | Ga0495602_0035932 | |||
| 1674 | Ga0495614_0034702 | |||
| 1675 | Ga0496100_0006174 | |||
| 1676 | Ga0496100_0020290 | |||
| 1677 | Ga0496100_0040028 | |||
| 1678 | Ga0496100_0106691 | |||
| 1679 | Ga0496101_0000924 | |||
| 1680 | Ga0496101_0012035 | |||
| 1681 | Ga0496101_0079274 | |||
| 1682 | Ga0496101_0104882 | |||
| 1683 | Ga0496101_0176283 | |||
| 1684 | Ga0496101_0178918 | |||
| 1685 | Ga0496101_0385529 | |||
| 1686 | Ga0496102_0021645 | |||
| 1687 | Ga0496102_0025763 | |||
| 1688 | Ga0496102_0029868 | |||
| 1689 | Ga0496102_0224379 | |||
| 1690 | Ga0496102_0511989 | |||
| 1691 | Ga0496103_0005671 | |||
| 1692 | Ga0496103_0037828 | |||
| 1693 | Ga0496104_0000217 | |||
| 1694 | Ga0496104_0000764 | |||
| 1695 | Ga0496104_0034046 | |||
| 1696 | Ga0496104_0037139 | |||
| 1697 | Ga0496104_0047679 | |||
| 1698 | Ga0496104_0100794 | |||
| 1699 | Ga0496104_0114561 | |||
| 1700 | Ga0496104_0126748 | |||
| 1701 | Ga0496104_0142607 | |||
| 1702 | Ga0496104_0216602 | |||
| 1703 | Ga0496105_0012626 | |||
| 1704 | Ga0496105_0058838 | |||
| 1705 | Ga0496105_0191786 | |||
| 1706 | Ga0496105_0212726 | |||
| 1707 | Ga0496105_0268758 | |||
| 1708 | Ga0496106_0000894 | |||
| 1709 | Ga0496106_0003651 | |||
| 1710 | Ga0496106_0005971 | |||
| 1711 | Ga0496106_0069234 | |||
| 1712 | Ga0496106_0096396 | |||
| 1713 | Ga0496106_0280695 | |||
| 1714 | Ga0496107_0005058 | |||
| 1715 | Ga0496107_0053858 | |||
| 1716 | Ga0496107_0101421 | |||
| 1717 | Ga0496107_0118485 | |||
| 1718 | Ga0496108_0000868 | |||
| 1719 | Ga0496108_0043186 | |||
| 1720 | Ga0496108_0087135 | |||
| 1721 | Ga0496108_0239741 | |||
| 1722 | Ga0496109_0000506 | |||
| 1723 | Ga0496109_0039228 | |||
| 1724 | Ga0496109_0053061 | |||
| 1725 | Ga0496109_0059559 | |||
| 1726 | Ga0496109_0120218 | |||
| 1727 | Ga0496109_0173069 | |||
| 1728 | Ga0496110_0063024 | |||
| 1729 | Ga0496110_0098004 | |||
| 1730 | Ga0496110_0111637 | |||
| 1731 | Ga0496110_0124238 | |||
| 1732 | Ga0496110_0220688 | |||
| 1733 | Ga0496110_0281415 | |||
| 1734 | Ga0496111_0072512 | |||
| 1735 | Ga0496111_0142936 | |||
| 1736 | Ga0496111_0306300 | |||
| 1737 | Ga0496112_0049492 | |||
| 1738 | Ga0496112_0294019 | |||
| 1739 | Ga0496112_0412965 | |||
| 1740 | Ga0496113_0046247 | |||
| 1741 | Ga0496113_0171844 | |||
| 1742 | Ga0496114_0013618 | |||
| 1743 | Ga0496114_0019154 | |||
| 1744 | Ga0496114_0042614 | |||
| 1745 | Ga0496114_0043119 | |||
| 1746 | Ga0496115_0004158 | |||
| 1747 | Ga0496115_0018366 | |||
| 1748 | Ga0496115_0033213 | |||
| 1749 | Ga0496115_0111789 | |||
| 1750 | Ga0496115_0121924 | |||
| 1751 | Ga0496115_0175374 | |||
| 1752 | Ga0501031_0002931 | |||
| 1753 | Ga0501031_0006819 | |||
| 1754 | Ga0501032_0030089 | |||
| 1755 | Ga0501032_0065765 | |||
| 1756 | Ga0501033_0011756 | |||
| 1757 | Ga0501033_0012886 | |||
| 1758 | Ga0501034_0018046 | |||
| 1759 | Ga0501034_0095115 | |||
| 1760 | Ga0501034_0169098 | |||
| 1761 | Ga0501036_0004687 | |||
| 1762 | Ga0501036_0011648 | |||
| 1763 | Ga0501037_0005982 | |||
| 1764 | Ga0501037_0019553 | |||
| 1765 | Ga0501038_0030646 | |||
| 1766 | Ga0501039_0001438 | |||
| 1767 | Ga0501041_0104610 | |||
| 1768 | Ga0501043_0017921 | |||
| 1769 | Ga0501043_0203226 | |||
| 1770 | Ga0501046_0010334 | |||
| 1771 | Ga0501047_0010921 | |||
| 1772 | Ga0501047_0010998 | |||
| 1773 | Ga0501047_0031535 | |||
| 1774 | Ga0501048_0004490 | |||
| 1775 | Ga0501048_0413198 | |||
| 1776 | Ga0501067_0005740 | |||
| 1777 | Ga0501068_0011311 | |||
| 1778 | Ga0501069_0006487 | |||
| 1779 | Ga0501070_0014059 | |||
| 1780 | Ga0501070_0025502 | |||
| 1781 | Ga0501070_0159730 | |||
| 1782 | Ga0501070_0188395 | |||
| 1783 | Ga0501071_0077893 | |||
| 1784 | Ga0501072_0413864 | |||
| 1785 | Ga0501073_0006774 | |||
| 1786 | Ga0501074_0012936 | |||
| 1787 | Ga0501076_0408016 | |||
| 1788 | Ga0501077_0166512 | |||
| 1789 | Ga0501079_0026795 | |||
| 1790 | Ga0501080_0028534 | |||
| 1791 | Ga0501081_0071525 | |||
| 1792 | Ga0501083_0015045 | |||
| 1793 | Ga0501035_0014526 | |||
| 1794 | Ga0501035_0018612 | |||
| 1795 | Ga0501044_0000193 | |||
| 1796 | Ga0501044_0026928 | |||
| 1797 | Ga0501044_0050174 | |||
| 1798 | Ga0501044_0276295 | |||
| 1799 | nmdc:mga03683_126932_c1 | |||
| 1800 | nmdc:mga03683_59371_c1 | |||
| 1801 | nmdc:mga0yw44_1168_c1 | |||
| 1802 | nmdc:mga0yw44_393333_c1 | |||
| 1803 | nmdc:mga0yw44_86374_c1 | |||
| 1804 | nmdc:mga0yw44_92657_c1 | |||
| 1805 | nmdc:mga0k408_24007_c1 | |||
| 1806 | nmdc:mga0k408_79482_c1 | |||
| 1807 | nmdc:mga0k408_99043_c1 | |||
| 1808 | nmdc:mga06z11_12529_c1 | |||
| 1809 | nmdc:mga06z11_49678_c1 | |||
| 1810 | nmdc:mga06z11_65020_c1 | |||
| 1811 | nmdc:mga07m45_69470_c1 | |||
| 1812 | nmdc:mga05p37_129066_c1 | |||
| 1813 | nmdc:mga05p37_200042_c1 | |||
| 1814 | nmdc:mga05p37_265489_c1 | |||
| 1815 | nmdc:mga05p37_35469_c1 | |||
| 1816 | nmdc:mga05p37_373263_c1 | |||
| 1817 | nmdc:mga05p37_391044_c1 | |||
| 1818 | nmdc:mga05p37_43990_c1 | |||
| 1819 | nmdc:mga05p37_5345_c1 | |||
| 1820 | nmdc:mga09592_148468_c1 | |||
| 1821 | nmdc:mga09592_155548_c1 | |||
| 1822 | nmdc:mga09592_183790_c1 | |||
| 1823 | nmdc:mga0qj67_157449_c1 | |||
| 1824 | nmdc:mga0qj67_61098_c1 | |||
| 1825 | nmdc:mga0qj67_70762_c1 | |||
| 1826 | nmdc:mga0qj67_86566_c1 | |||
| 1827 | nmdc:mga06r32_128479_c1 | |||
| 1828 | nmdc:mga06r32_92744_c1 | |||
| 1829 | nmdc:mga08y16_105572_c1 | |||
| 1830 | nmdc:mga08y16_2968_c1 | |||
| 1831 | nmdc:mga08y16_391273_c1 | |||
| 1832 | nmdc:mga08y16_8363_c1 | |||
| 1833 | nmdc:mga0n895_101152_c1 | |||
| 1834 | nmdc:mga0n895_12603_c1 | |||
| 1835 | nmdc:mga0n895_142142_c1 | |||
| 1836 | nmdc:mga0n895_602258_c1 | |||
| 1837 | nmdc:mga0n895_91583_c1 | |||
| 1838 | nmdc:mga0rr50_175655_c1 | |||
| 1839 | nmdc:mga0rr50_402115_c1 | |||
| 1840 | nmdc:mga08x19_217847_c1 | |||
| 1841 | nmdc:mga0a205_152828_c1 | |||
| 1842 | nmdc:mga0a205_40346_c1 | |||
| 1843 | nmdc:mga0a205_75013_c1 | |||
| 1844 | Ga0495601_0003097 | |||
| 1845 | Ga0495601_0004245 | |||
| 1846 | Ga0495601_0004639 | |||
| 1847 | Ga0495601_0005848 | |||
| 1848 | Ga0495601_0102456 | |||
| 1849 | Ga0495612_0000183 | |||
| 1850 | Ga0495612_0000857 | |||
| 1851 | Ga0495612_0001353 | |||
| 1852 | Ga0495612_0007748 | |||
| 1853 | Ga0495612_0025192 | |||
| 1854 | Ga0495595_0000207 | |||
| 1855 | Ga0495595_0001895 | |||
| 1856 | Ga0495595_0002395 | |||
| 1857 | Ga0495595_0015608 | |||
| 1858 | Ga0495619_0000108 | |||
| 1859 | Ga0495619_0000225 | |||
| 1860 | Ga0495619_0000650 | |||
| 1861 | Ga0495619_0001982 | |||
| 1862 | Ga0495619_0002633 | |||
| 1863 | Ga0495619_0008701 | |||
| 1864 | Ga0495619_0035311 | |||
| 1865 | Ga0500644_0000428 | |||
| 1866 | Ga0500651_0070006 | |||
| 1867 | Ga0500641_0025612 | |||
| 1868 | Ga0500641_0060086 | |||
| 1869 | Ga0500650_0071339 | |||
| 1870 | Ga0500616_0000006 | |||
| 1871 | Ga0500616_0011892 | |||
| 1872 | Ga0500645_000033 | |||
| 1873 | Ga0501084_0019048 | |||
| 1874 | Ga0501084_0230516 | |||
| 1875 | Ga0501082_0006937 | |||
| 1876 | Ga0501082_0215839 | |||
| 1877 | Ga0530510_0058419 | |||
| 1878 | 2511131504 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zsz-assembly1.cif.gz_A | catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 | 0.9227 | 2 | 248 |
| 1mpy-assembly1.cif.gz_D | structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 | 0.9215 | 3 | 246 |
| 5znh-assembly1.cif.gz_A | catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 | 0.9173 | 2 | 248 |
| 3lm4-assembly1.cif.gz_B | crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (strain rha1) | 0.9173 | 2 | 247 |
| 7q2a-assembly1.cif.gz_A | crystal structure of aphc in complex with 4-ethylcatechol | 0.9171 | 2 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b59F02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9331 | 135 | 248 | 3.10.180.10 |
| 5zszA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9283 | 135 | 248 | 3.10.180.10 |
| 5znhA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9281 | 135 | 248 | 3.10.180.10 |
| 1mpyA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9273 | 134 | 247 | 3.10.180.10 |
| 1eilA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8916 | 4 | 126 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2LIL4-F1-model_v4 | deleted | 0.9599 | 130 | 247 |
|
| AF-A0A5J6XS81-F1-model_v4 | VOC domain-containing protein | 0.9488 | 1 | 164 |
|
| AF-A0A345PE51-F1-model_v4 | VOC domain-containing protein | 0.9445 | 1 | 247 |
|
| AF-A0A212Q6K0-F1-model_v4 | deleted | 0.9427 | 1 | 220 |
|
| AF-A0A654CTN7-F1-model_v4 | Catechol-2,3-dioxygenase | 0.9407 | 132 | 247 |
GO:0051213
|