F486292

General Info

Members Datasets Scaffolds Average Seq Length
939 416 1878 295

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0045152|Ga0495629_0045152_1992_2867
Length 291
Sequence MIRVSKIAHAAYETPDLNQQTEYYTEIIGLTLAAQEKDTVYLASTVDHHAVVLRKGSQAQCTRIGFQIPPSADLDEFQKQVASHGVVTERRKNAEPSISDMLVFKDPKGTVFKRDDFSHQKFQSKGIVPYKLGHVAFHVADVKHVTKFYCDVLGFRESDWMGDFFSFLRCGPDHHTINLMETGANRHFHTAFELRDWAHMQQACDFLSLHGYKLLWGPGRHGIGHNLFAYHRAPNGLITETFAELDRMNEELGYFEPRPWHRDHPQRPKVWVKDPSAANLWGILPSDEMMK

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
280 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
414 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
415 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
416 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 8.31
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0045152 3300046459 Bacteria 3092
2 2214745235 2209111006 Bacteria 3605
3 ARSoilYngRDRAFT_c00289 3300000042 Bacteria 7363
4 ARcpr5yngRDRAFT_c000271 3300000043 Bacteria 7411
5 ARSoilOldRDRAFT_c000295 3300000044 Bacteria 6988
6 ARCol0yngRDRAFT_1000053 3300000652 Bacteria 20284
7 JGI24740J21852_10014159 3300001979 Bacteria 2953
8 JGI24737J22298_10002175 3300001990 Bacteria 6980
9 JGI24750J21931_1000807 3300002070 Bacteria 4345
10 JGI24750J21931_1002444 3300002070 Bacteria 2238
11 JGI24748J21848_1001444 3300002074 Bacteria 2616
12 JGI24738J21930_10003423 3300002075 Bacteria 4004
13 JGI24749J21850_1005224 3300002076 Bacteria 1822
14 JGI24744J21845_10001325 3300002077 Bacteria 4886
15 JGI24033J26618_1002454 3300002155 Unclassified 1900
16 JGI24034J26672_10000436 3300002239 Bacteria 5413
17 JGI24742J22300_10000131 3300002244 Bacteria 10972
18 JGI24742J22300_10007537 3300002244 Bacteria 1796
19 JGI25406J46586_10010069 3300003203 Bacteria 4211
20 JGI25405J52794_10017289 3300003911 Bacteria 1431
21 Ga0065716_1002255 3300005277 Bacteria 2031
22 Ga0065704_10101333 3300005289 Bacteria 2241
23 Ga0065712_10006389 3300005290 Unclassified 4475
24 Ga0065712_10020432 3300005290 Bacteria 1802
25 Ga0065715_10000953 3300005293 Bacteria 11199
26 Ga0065715_10006553 3300005293 Bacteria 4537
27 Ga0065707_10113298 3300005295 Bacteria 2332
28 Ga0070676_10008398 3300005328 Bacteria 5565
29 Ga0070676_10027396 3300005328 Bacteria 3232
30 Ga0070683_100001740 3300005329 Bacteria 16946
31 Ga0070690_100005830 3300005330 Bacteria 6942
32 Ga0070690_100071996 3300005330 Bacteria 2247
33 Ga0070670_100023972 3300005331 Bacteria 5249
34 Ga0070670_100026485 3300005331 Bacteria 4988
35 Ga0070677_10000553 3300005333 Bacteria 12761
36 Ga0068869_100004139 3300005334 Bacteria 8994
37 Ga0068869_100028847 3300005334 Bacteria 3881
38 Ga0068869_100059369 3300005334 Bacteria 2800
39 Ga0068869_100224315 3300005334 Bacteria 1491
40 Ga0070666_10021676 3300005335 Bacteria 4163
41 Ga0070666_10073203 3300005335 Bacteria 2334
42 Ga0070680_100002899 3300005336 Bacteria 12742
43 Ga0070680_100013552 3300005336 Bacteria 6353
44 Ga0070682_100044407 3300005337 Bacteria 2751
45 Ga0070682_100196384 3300005337 Bacteria 1420
46 Ga0068868_100005781 3300005338 Bacteria 8712
47 Ga0068868_100073271 3300005338 Bacteria 2734
48 Ga0070660_100001515 3300005339 Bacteria 15924
49 Ga0070660_100198358 3300005339 Unclassified 1627
50 Ga0070689_100001241 3300005340 Bacteria 16240
51 Ga0070691_10064595 3300005341 Unclassified 1766
52 Ga0070687_100002230 3300005343 Bacteria 7186
53 Ga0070687_100093250 3300005343 Bacteria 1670
54 Ga0070661_100012739 3300005344 Bacteria 5886
55 Ga0070661_100056802 3300005344 Bacteria 2868
56 Ga0070692_10006992 3300005345 Bacteria 4944
57 Ga0070692_10008859 3300005345 Bacteria 4507
58 Ga0070692_10156883 3300005345 Bacteria 1301
59 Ga0070668_100002506 3300005347 Bacteria 13524
60 Ga0070668_100066945 3300005347 Bacteria 2789
61 Ga0070668_100344455 3300005347 Bacteria 1260
62 Ga0070668_100352522 3300005347 Unclassified 1246
63 Ga0070669_100000743 3300005353 Bacteria 23727
64 Ga0070675_100001086 3300005354 Bacteria 19628
65 Ga0070675_100162845 3300005354 Bacteria 1919
66 Ga0070675_100196384 3300005354 Bacteria 1750
67 Ga0070671_100004095 3300005355 Bacteria 11513
68 Ga0070671_100006476 3300005355 Bacteria 9362
69 Ga0070671_100052468 3300005355 Bacteria 3390
70 Ga0070671_100176242 3300005355 Bacteria 1809
71 Ga0070674_100063066 3300005356 Bacteria 2592
72 Ga0070674_100541386 3300005356 Bacteria 975
73 Ga0070673_100000419 3300005364 Bacteria 22441
74 Ga0070688_100003465 3300005365 Bacteria 8123
75 Ga0070659_100007008 3300005366 Bacteria 8163
76 Ga0070659_100022088 3300005366 Bacteria 4855
77 Ga0070659_100055244 3300005366 Bacteria 3128
78 Ga0070667_100279960 3300005367 Bacteria 1497
79 Ga0070703_10001244 3300005406 Bacteria 7745
80 Ga0070703_10004556 3300005406 Bacteria 3895
81 Ga0070709_10011868 3300005434 Bacteria 4864
82 Ga0070709_10021857 3300005434 Plasmid 3734
83 Ga0070709_10042462 3300005434 Bacteria 2808
84 Ga0070709_10073099 3300005434 Unclassified 2219
85 Ga0070714_100004331 3300005435 Bacteria 10704
86 Ga0070714_100087894 3300005435 Bacteria 2718
87 Ga0070714_100203326 3300005435 Unclassified 1812
88 Ga0070713_100005705 3300005436 Bacteria 8548
89 Ga0070713_100016797 3300005436 Bacteria 5512
90 Ga0070713_100023528 3300005436 Bacteria 4782
91 Ga0070713_100031744 3300005436 Bacteria 4210
92 Ga0070713_100121641 3300005436 Bacteria 2290
93 Ga0070713_100167706 3300005436 Bacteria 1965
94 Ga0070713_100364987 3300005436 Bacteria 1342
95 Ga0070710_10000528 3300005437 Bacteria 18021
96 Ga0070710_10004305 3300005437 Bacteria 6747
97 Ga0070710_10008141 3300005437 Bacteria 5096
98 Ga0070710_10068466 3300005437 Bacteria 2040
99 Ga0070710_10075948 3300005437 Bacteria 1948
100 Ga0070701_10000365 3300005438 Bacteria 15115
101 Ga0070701_10007962 3300005438 Bacteria 4560
102 Ga0070701_10059982 3300005438 Bacteria 2002
103 Ga0070711_100003401 3300005439 Bacteria 9271
104 Ga0070711_100021147 3300005439 Bacteria 4204
105 Ga0070711_100039114 3300005439 Bacteria 3192
106 Ga0070711_100073866 3300005439 Bacteria 2411
107 Ga0070711_100363821 3300005439 Bacteria 1166
108 Ga0070705_100001329 3300005440 Bacteria 13221
109 Ga0070705_100001964 3300005440 Bacteria 10518
110 Ga0070700_100008089 3300005441 Bacteria 5715
111 Ga0070700_100008776 3300005441 Bacteria 5520
112 Ga0070700_100065982 3300005441 Bacteria 2296
113 Ga0070694_100002737 3300005444 Bacteria 10459
114 Ga0070694_100021203 3300005444 Bacteria 4148
115 Ga0070694_100180133 3300005444 Bacteria 1562
116 Ga0070708_100041374 3300005445 Bacteria 4040
117 Ga0070663_100019174 3300005455 Bacteria 4502
118 Ga0070663_100217857 3300005455 Bacteria 1497
119 Ga0070678_100005723 3300005456 Bacteria 7220
120 Ga0070678_100083622 3300005456 Bacteria 2427
121 Ga0070678_100202717 3300005456 Bacteria 1638
122 Ga0070662_100025249 3300005457 Bacteria 4101
123 Ga0070662_100180533 3300005457 Bacteria 1663
124 Ga0070681_10010311 3300005458 Bacteria 9223
125 Ga0070681_10019665 3300005458 Bacteria 6763
126 Ga0070681_10189278 3300005458 Bacteria 1978
127 Ga0068867_100000980 3300005459 Bacteria 19509
128 Ga0070685_10014838 3300005466 Bacteria 4132
129 Ga0070685_10015980 3300005466 Bacteria 3993
130 Ga0070706_100361152 3300005467 Bacteria 1353
131 Ga0070706_100563484 3300005467 Bacteria 1059
132 Ga0070699_100000444 3300005518 Bacteria 39757
133 Ga0070699_100001276 3300005518 Bacteria 23203
134 Ga0070679_100004363 3300005530 Bacteria 13070
135 Ga0070684_100013266 3300005535 Bacteria 6639
136 Ga0070684_100053185 3300005535 Bacteria 3524
137 Ga0070684_100233276 3300005535 Bacteria 1680
138 Ga0070697_100017942 3300005536 Bacteria 5575
139 Ga0070697_100066086 3300005536 Bacteria 2957
140 Ga0070697_100273340 3300005536 Unclassified 1449
141 Ga0068853_100006929 3300005539 Bacteria 9049
142 Ga0070672_100002302 3300005543 Bacteria 12059
143 Ga0070672_100055215 3300005543 Bacteria 3111
144 Ga0070686_100012378 3300005544 Bacteria 4856
145 Ga0070686_100014304 3300005544 Bacteria 4572
146 Ga0070686_100017776 3300005544 Bacteria 4161
147 Ga0070695_100000918 3300005545 Bacteria 15891
148 Ga0070695_100012338 3300005545 Bacteria 5123
149 Ga0070696_100000123 3300005546 Bacteria 40797
150 Ga0070696_100002724 3300005546 Bacteria 11729
151 Ga0070696_100221935 3300005546 Unclassified 1418
152 Ga0070693_100001476 3300005547 Bacteria 10590
153 Ga0070704_100000095 3300005549 Bacteria 30467
154 Ga0070704_100037262 3300005549 Bacteria 3321
155 Ga0068855_100066013 3300005563 Bacteria 4219
156 Ga0068855_100279563 3300005563 Bacteria 1854
157 Ga0070664_100105237 3300005564 Bacteria 2457
158 Ga0070664_100353332 3300005564 Bacteria 1337
159 Ga0068857_100002177 3300005577 Bacteria 15935
160 Ga0068857_100011660 3300005577 Bacteria 7645
161 Ga0068857_100087240 3300005577 Bacteria 2791
162 Ga0068856_100003552 3300005614 Bacteria 15701
163 Ga0068856_100058287 3300005614 Bacteria 3813
164 Ga0068856_100227952 3300005614 Bacteria 1879
165 Ga0070702_100016382 3300005615 Bacteria 3801
166 Ga0070702_100018984 3300005615 Bacteria 3576
167 Ga0070702_100087978 3300005615 Bacteria 1877
168 Ga0068852_100051926 3300005616 Bacteria 3522
169 Ga0068859_100001820 3300005617 Bacteria 21717
170 Ga0068859_100005818 3300005617 Bacteria 12522
171 Ga0068859_100063245 3300005617 Bacteria 3731
172 Ga0068864_100000140 3300005618 Bacteria 69827
173 Ga0068864_100230813 3300005618 Bacteria 1711
174 Ga0068866_10001684 3300005718 Bacteria 9307
175 Ga0068866_10204219 3300005718 Bacteria 1182
176 Ga0068861_100013494 3300005719 Bacteria 5719
177 Ga0068861_100095034 3300005719 Bacteria 2360
178 Ga0068851_10033291 3300005834 Bacteria 2569
179 Ga0068870_10000654 3300005840 Bacteria 13203
180 Ga0068863_100000425 3300005841 Bacteria 42737
181 Ga0068863_100027701 3300005841 Bacteria 5406
182 Ga0068858_100095071 3300005842 Bacteria 2776
183 Ga0068858_100167557 3300005842 Bacteria 2070
184 Ga0068860_100002696 3300005843 Bacteria 18484
185 Ga0068860_100064786 3300005843 Bacteria 3470
186 Ga0068862_100020271 3300005844 Bacteria 5554
187 Ga0068862_100089132 3300005844 Bacteria 2684
188 Ga0081455_10001118 3300005937 Bacteria 33528
189 Ga0081455_10011426 3300005937 Bacteria 8924
190 Ga0081455_10088394 3300005937 Bacteria 2518
191 Ga0081538_10002263 3300005981 Bacteria 19045
192 Ga0081538_10060249 3300005981 Bacteria 2185
193 Ga0081540_1000192 3300005983 Bacteria 63477
194 Ga0081540_1006947 3300005983 Bacteria 8157
195 Ga0081540_1024775 3300005983 Bacteria 3473
196 Ga0081540_1039437 3300005983 Bacteria 2476
197 Ga0081540_1058554 3300005983 Bacteria 1855
198 Ga0081539_10001465 3300005985 Bacteria 40018
199 Ga0070717_10001340 3300006028 Bacteria 16925
200 Ga0070717_10011028 3300006028 Bacteria 6845
201 Ga0070717_10044248 3300006028 Bacteria 3635
202 Ga0075365_10025752 3300006038 Bacteria 3727
203 Ga0075365_10032144 3300006038 Bacteria 3371
204 Ga0075365_10261035 3300006038 Bacteria 1218
205 Ga0075363_100071859 3300006048 Bacteria 1881
206 Ga0075363_100243829 3300006048 Bacteria 1033
207 Ga0075364_10209762 3300006051 Bacteria 1321
208 Ga0075432_10094301 3300006058 Bacteria 1099
209 Ga0070715_10000357 3300006163 Bacteria 11390
210 Ga0070715_10012668 3300006163 Unclassified 3076
211 Ga0070715_10024931 3300006163 Bacteria 2363
212 Ga0070716_100044490 3300006173 Bacteria 2488
213 Ga0070712_100001277 3300006175 Bacteria 15195
214 Ga0070712_100008584 3300006175 Bacteria 6429
215 Ga0070712_100115819 3300006175 Bacteria 2009
216 Ga0070712_100195653 3300006175 Bacteria 1585
217 Ga0070712_100206962 3300006175 Bacteria 1545
218 Ga0070712_100207459 3300006175 Bacteria 1543
219 Ga0070712_100263486 3300006175 Bacteria 1382
220 Ga0070712_100477325 3300006175 Bacteria 1042
221 Ga0075362_10050487 3300006177 Bacteria 1860
222 Ga0075367_10039252 3300006178 Bacteria 2760
223 Ga0075367_10082303 3300006178 Bacteria 1949
224 Ga0097621_100002131 3300006237 Bacteria 13540
225 Ga0075370_10071803 3300006353 Bacteria 1981
226 Ga0068871_100008325 3300006358 Bacteria 7455
227 Ga0075428_100019702 3300006844 Bacteria 7465
228 Ga0075428_100028244 3300006844 Bacteria 6204
229 Ga0075428_100610295 3300006844 Bacteria 1165
230 Ga0075430_100014084 3300006846 Bacteria 6818
231 Ga0075430_100037162 3300006846 Bacteria 4129
232 Ga0075430_100041065 3300006846 Bacteria 3914
233 Ga0075430_100060072 3300006846 Bacteria 3195
234 Ga0075430_100077840 3300006846 Bacteria 2780
235 Ga0075431_100004314 3300006847 Bacteria 13935
236 Ga0075431_100017715 3300006847 Bacteria 7242
237 Ga0075431_100021672 3300006847 Bacteria 6571
238 Ga0075431_100246339 3300006847 Bacteria 1817
239 Ga0075433_10140634 3300006852 Bacteria 2145
240 Ga0075433_10148169 3300006852 Bacteria 2087
241 Ga0075434_100021735 3300006871 Bacteria 6239
242 Ga0075434_100034873 3300006871 Bacteria 4973
243 Ga0075434_100058688 3300006871 Bacteria 3824
244 Ga0075434_100183079 3300006871 Bacteria 2116
245 Ga0075434_100358577 3300006871 Bacteria 1479
246 Ga0075429_100155580 3300006880 Bacteria 2002
247 Ga0075429_100218808 3300006880 Bacteria 1668
248 Ga0075429_100431945 3300006880 Bacteria 1154
249 Ga0068865_100001142 3300006881 Bacteria 15394
250 Ga0068865_100036778 3300006881 Bacteria 3303
251 Ga0068865_100093528 3300006881 Bacteria 2186
252 Ga0068865_100112799 3300006881 Bacteria 2009
253 Ga0068865_100126065 3300006881 Bacteria 1911
254 Ga0075436_100093284 3300006914 Unclassified 2093
255 Ga0075436_100102002 3300006914 Bacteria 1998
256 Ga0097620_100001820 3300006931 Bacteria 21717
257 Ga0097620_100005818 3300006931 Bacteria 12522
258 Ga0097620_100063246 3300006931 Bacteria 3731
259 Ga0097620_100316806 3300006931 Bacteria 1653
260 Ga0075435_100022544 3300007076 Bacteria 4859
261 Ga0075435_100125934 3300007076 Bacteria 2141
262 Ga0099794_10036502 3300007265 Bacteria 2324
263 Ga0105250_10032989 3300009092 Bacteria 2078
264 Ga0105240_10109955 3300009093 Bacteria 3336
265 Ga0105240_10175329 3300009093 Bacteria 2535
266 Ga0111539_10006796 3300009094 Bacteria 14718
267 Ga0111539_10014173 3300009094 Bacteria 9954
268 Ga0111539_10081343 3300009094 Bacteria 3810
269 Ga0111539_10188463 3300009094 Bacteria 2407
270 Ga0111539_10479910 3300009094 Bacteria 1448
271 Ga0111539_10499868 3300009094 Bacteria 1416
272 Ga0111539_10568213 3300009094 Bacteria 1321
273 Ga0111539_10803476 3300009094 Bacteria 1095
274 Ga0105245_10000867 3300009098 Bacteria 27426
275 Ga0105245_10023386 3300009098 Bacteria 5424
276 Ga0105247_10116603 3300009101 Bacteria 1725
277 Ga0114129_10017149 3300009147 Bacteria 10313
278 Ga0114129_10041031 3300009147 Bacteria 6523
279 Ga0114129_10045872 3300009147 Bacteria 6143
280 Ga0114129_10080861 3300009147 Bacteria 4517
281 Ga0114129_10172654 3300009147 Bacteria 2946
282 Ga0114129_10233581 3300009147 Bacteria 2476
283 Ga0114129_10329811 3300009147 Bacteria 2026
284 Ga0114129_10504452 3300009147 Bacteria 1580
285 Ga0105243_10002939 3300009148 Bacteria 14095
286 Ga0105243_10018773 3300009148 Bacteria 5238
287 Ga0105243_10143444 3300009148 Bacteria 2040
288 Ga0105241_10007866 3300009174 Bacteria 7838
289 Ga0105241_10036622 3300009174 Bacteria 3693
290 Ga0105241_10172341 3300009174 Bacteria 1788
291 Ga0105242_10001899 3300009176 Bacteria 16415
292 Ga0105242_10014951 3300009176 Bacteria 6016
293 Ga0105242_10064165 3300009176 Bacteria 3026
294 Ga0105248_10003521 3300009177 Bacteria 17366
295 Ga0105248_10029630 3300009177 Bacteria 6106
296 Ga0105237_10102889 3300009545 Bacteria 2848
297 Ga0105237_10135063 3300009545 Bacteria 2461
298 Ga0105237_10139250 3300009545 Unclassified 2421
299 Ga0105238_10037311 3300009551 Bacteria 4940
300 Ga0105238_10119701 3300009551 Bacteria 2613
301 Ga0105238_10146147 3300009551 Bacteria 2341
302 Ga0105249_10002047 3300009553 Bacteria 17494
303 Ga0105249_10002541 3300009553 Bacteria 15787
304 Ga0105249_10553691 3300009553 Bacteria 1201
305 Ga0105239_10021557 3300010375 Bacteria 7104
306 Ga0105239_10037616 3300010375 Bacteria 5303
307 Ga0105246_10001875 3300011119 Bacteria 12676
308 Ga0157342_1006643 3300012507 Unclassified 1101
309 Ga0157373_10100959 3300013100 Bacteria 2030
310 Ga0157373_10248718 3300013100 Bacteria 1257
311 Ga0157374_10001408 3300013296 Bacteria 20396
312 Ga0157374_10110998 3300013296 Bacteria 2637
313 Ga0157374_10214333 3300013296 Unclassified 1889
314 Ga0157378_10004977 3300013297 Bacteria 11652
315 Ga0157378_10246279 3300013297 Unclassified 1709
316 Ga0163162_10011093 3300013306 Bacteria 8778
317 Ga0163162_10012257 3300013306 Bacteria 8366
318 Ga0163162_10130425 3300013306 Bacteria 2622
319 Ga0163162_10295032 3300013306 Bacteria 1753
320 Ga0157372_10017879 3300013307 Bacteria 7617
321 Ga0157372_10770034 3300013307 Unclassified 1119
322 Ga0157375_10001932 3300013308 Bacteria 17830
323 Ga0157375_10113004 3300013308 Bacteria 2817
324 Ga0163163_10034835 3300014325 Bacteria 4880
325 Ga0163163_10301099 3300014325 Bacteria 1656
326 Ga0163163_10352355 3300014325 Bacteria 1528
327 Ga0157380_10014641 3300014326 Bacteria 5744
328 Ga0157380_10018915 3300014326 Bacteria 5124
329 Ga0157380_10157568 3300014326 Bacteria 1969
330 Ga0157380_10202861 3300014326 Bacteria 1761
331 Ga0157377_10000486 3300014745 Bacteria 17037
332 Ga0157377_10039708 3300014745 Bacteria 2605
333 Ga0157379_10006828 3300014968 Bacteria 9862
334 Ga0157379_10057193 3300014968 Bacteria 3485
335 Ga0157379_10133136 3300014968 Unclassified 2238
336 Ga0157376_10068143 3300014969 Bacteria 3012
337 Ga0157376_10709013 3300014969 Bacteria 1012
338 Ga0213872_10028413 3300021361 Bacteria 2565
339 Ga0213876_10033035 3300021384 Bacteria 2728
340 Ga0213875_10000003 3300021388 Bacteria 719367
341 Ga0207666_1000089 3300025271 Bacteria 14639
342 Ga0207673_1002235 3300025290 Bacteria 2187
343 Ga0207697_10000993 3300025315 Bacteria 15866
344 Ga0207656_10049715 3300025321 Bacteria 1809
345 Ga0207653_10008690 3300025885 Bacteria 3167
346 Ga0207682_10000104 3300025893 Bacteria 38531
347 Ga0207692_10000076 3300025898 Bacteria 28507
348 Ga0207692_10026416 3300025898 Bacteria 2724
349 Ga0207642_10001116 3300025899 Bacteria 8305
350 Ga0207710_10088660 3300025900 Bacteria 1445
351 Ga0207688_10001265 3300025901 Bacteria 13115
352 Ga0207688_10002264 3300025901 Bacteria 10360
353 Ga0207688_10029868 3300025901 Bacteria 3004
354 Ga0207680_10006968 3300025903 Bacteria 5482
355 Ga0207680_10018072 3300025903 Bacteria 3739
356 Ga0207647_10001528 3300025904 Bacteria 17815
357 Ga0207647_10060693 3300025904 Bacteria 2311
358 Ga0207647_10258746 3300025904 Bacteria 997
359 Ga0207685_10020579 3300025905 Bacteria 2196
360 Ga0207685_10028679 3300025905 Unclassified 1963
361 Ga0207699_10008588 3300025906 Bacteria 5049
362 Ga0207699_10111324 3300025906 Bacteria 1755
363 Ga0207699_10164078 3300025906 Bacteria 1481
364 Ga0207699_10270969 3300025906 Bacteria 1176
365 Ga0207645_10002130 3300025907 Bacteria 15831
366 Ga0207645_10070174 3300025907 Bacteria 2241
367 Ga0207643_10000035 3300025908 Bacteria 90905
368 Ga0207643_10002863 3300025908 Bacteria 9308
369 Ga0207684_10152225 3300025910 Bacteria 1990
370 Ga0207654_10026417 3300025911 Bacteria 3144
371 Ga0207707_10001935 3300025912 Bacteria 18839
372 Ga0207707_10046635 3300025912 Bacteria 3775
373 Ga0207707_10092137 3300025912 Bacteria 2648
374 Ga0207695_10038532 3300025913 Bacteria 5144
375 Ga0207693_10001480 3300025915 Bacteria 20759
376 Ga0207693_10001843 3300025915 Bacteria 18573
377 Ga0207693_10004775 3300025915 Bacteria 11395
378 Ga0207693_10008913 3300025915 Bacteria 8193
379 Ga0207693_10026826 3300025915 Plasmid 4557
380 Ga0207693_10057698 3300025915 Bacteria 3042
381 Ga0207693_10184433 3300025915 Bacteria 1643
382 Ga0207693_10200058 3300025915 Bacteria 1571
383 Ga0207693_10207692 3300025915 Bacteria 1539
384 Ga0207693_10229672 3300025915 Bacteria 1457
385 Ga0207663_10008697 3300025916 Bacteria 5328
386 Ga0207663_10090454 3300025916 Bacteria 2029
387 Ga0207663_10110263 3300025916 Bacteria 1866
388 Ga0207663_10172413 3300025916 Unclassified 1538
389 Ga0207663_10254950 3300025916 Bacteria 1293
390 Ga0207660_10000451 3300025917 Bacteria 27028
391 Ga0207660_10001146 3300025917 Bacteria 17678
392 Ga0207660_10032704 3300025917 Bacteria 3592
393 Ga0207662_10002323 3300025918 Bacteria 9527
394 Ga0207662_10060397 3300025918 Bacteria 2274
395 Ga0207657_10002025 3300025919 Bacteria 21900
396 Ga0207657_10024447 3300025919 Bacteria 5591
397 Ga0207649_10000309 3300025920 Bacteria 37243
398 Ga0207649_10308122 3300025920 Unclassified 1160
399 Ga0207652_10010263 3300025921 Bacteria 7538
400 Ga0207652_10058859 3300025921 Bacteria 3311
401 Ga0207646_10304826 3300025922 Bacteria 1439
402 Ga0207681_10001488 3300025923 Bacteria 15114
403 Ga0207694_10068334 3300025924 Bacteria 2775
404 Ga0207694_10144188 3300025924 Bacteria 1916
405 Ga0207694_10227863 3300025924 Bacteria 1521
406 Ga0207650_10006726 3300025925 Bacteria 7838
407 Ga0207650_10061427 3300025925 Bacteria 2806
408 Ga0207659_10000091 3300025926 Bacteria 53079
409 Ga0207659_10116261 3300025926 Bacteria 2042
410 Ga0207687_10000161 3300025927 Bacteria 45255
411 Ga0207687_10085640 3300025927 Bacteria 2287
412 Ga0207700_10002812 3300025928 Bacteria 10019
413 Ga0207700_10009232 3300025928 Bacteria 6151
414 Ga0207700_10096860 3300025928 Bacteria 2344
415 Ga0207700_10264668 3300025928 Bacteria 1473
416 Ga0207700_10393120 3300025928 Bacteria 1214
417 Ga0207700_10400254 3300025928 Bacteria 1203
418 Ga0207700_10527315 3300025928 Bacteria 1047
419 Ga0207664_10006249 3300025929 Bacteria 8182
420 Ga0207664_10011444 3300025929 Bacteria 6308
421 Ga0207664_10210631 3300025929 Bacteria 1681
422 Ga0207664_10236410 3300025929 Bacteria 1590
423 Ga0207644_10000245 3300025931 Bacteria 37122
424 Ga0207644_10052208 3300025931 Bacteria 2937
425 Ga0207644_10074056 3300025931 Bacteria 2498
426 Ga0207644_10105600 3300025931 Bacteria 2122
427 Ga0207690_10000771 3300025932 Bacteria 20713
428 Ga0207690_10088403 3300025932 Bacteria 2182
429 Ga0207706_10005499 3300025933 Bacteria 11813
430 Ga0207706_10012450 3300025933 Bacteria 7751
431 Ga0207706_10110642 3300025933 Bacteria 2416
432 Ga0207686_10001194 3300025934 Bacteria 15062
433 Ga0207686_10008989 3300025934 Bacteria 5408
434 Ga0207686_10040051 3300025934 Bacteria 2847
435 Ga0207709_10001001 3300025935 Bacteria 20987
436 Ga0207709_10075536 3300025935 Bacteria 2154
437 Ga0207709_10084032 3300025935 Bacteria 2060
438 Ga0207670_10000526 3300025936 Bacteria 21144
439 Ga0207670_10018175 3300025936 Bacteria 4267
440 Ga0207670_10090762 3300025936 Bacteria 2159
441 Ga0207670_10262025 3300025936 Bacteria 1340
442 Ga0207669_10011592 3300025937 Bacteria 4297
443 Ga0207704_10031210 3300025938 Bacteria 2999
444 Ga0207704_10092693 3300025938 Bacteria 1989
445 Ga0207665_10001028 3300025939 Bacteria 18828
446 Ga0207665_10007368 3300025939 Bacteria 7271
447 Ga0207665_10025516 3300025939 Bacteria 3900
448 Ga0207665_10127780 3300025939 Bacteria 1801
449 Ga0207665_10185695 3300025939 Bacteria 1508
450 Ga0207691_10000336 3300025940 Bacteria 47166
451 Ga0207691_10015407 3300025940 Bacteria 7273
452 Ga0207711_10035966 3300025941 Bacteria 4200
453 Ga0207711_10061529 3300025941 Bacteria 3237
454 Ga0207711_10295596 3300025941 Bacteria 1493
455 Ga0207689_10000168 3300025942 Bacteria 57089
456 Ga0207689_10028925 3300025942 Bacteria 4633
457 Ga0207689_10098550 3300025942 Bacteria 2401
458 Ga0207689_10145944 3300025942 Bacteria 1949
459 Ga0207661_10000575 3300025944 Bacteria 23433
460 Ga0207661_10258176 3300025944 Bacteria 1551
461 Ga0207679_10000035 3300025945 Bacteria 144173
462 Ga0207679_10019432 3300025945 Bacteria 4563
463 Ga0207679_10205302 3300025945 Bacteria 1649
464 Ga0207667_10098793 3300025949 Bacteria 3012
465 Ga0207651_10000233 3300025960 Bacteria 24032
466 Ga0207651_10075434 3300025960 Bacteria 2406
467 Ga0207712_10000768 3300025961 Bacteria 24025
468 Ga0207712_10009092 3300025961 Bacteria 6285
469 Ga0207668_10001470 3300025972 Bacteria 13811
470 Ga0207668_10159635 3300025972 Bacteria 1755
471 Ga0207668_10270678 3300025972 Bacteria 1388
472 Ga0207640_10001231 3300025981 Bacteria 13954
473 Ga0207658_10073032 3300025986 Bacteria 2603
474 Ga0207677_10000997 3300026023 Bacteria 15626
475 Ga0207677_10061228 3300026023 Bacteria 2605
476 Ga0207703_10001880 3300026035 Bacteria 18666
477 Ga0207703_10091454 3300026035 Bacteria 2559
478 Ga0207639_10000421 3300026041 Bacteria 29387
479 Ga0207678_10001561 3300026067 Bacteria 21040
480 Ga0207678_10016361 3300026067 Bacteria 6513
481 Ga0207678_10186746 3300026067 Bacteria 1771
482 Ga0207708_10001793 3300026075 Bacteria 15836
483 Ga0207708_10004956 3300026075 Bacteria 9812
484 Ga0207708_10013704 3300026075 Bacteria 6058
485 Ga0207702_10045251 3300026078 Bacteria 3703
486 Ga0207641_10003563 3300026088 Bacteria 13757
487 Ga0207641_10484983 3300026088 Bacteria 1198
488 Ga0207648_10004259 3300026089 Bacteria 14771
489 Ga0207648_10060537 3300026089 Bacteria 3302
490 Ga0207648_10205886 3300026089 Bacteria 1746
491 Ga0207674_10000535 3300026116 Bacteria 49820
492 Ga0207674_10002113 3300026116 Bacteria 25122
493 Ga0207674_10112624 3300026116 Bacteria 2694
494 Ga0207675_100000365 3300026118 Bacteria 43342
495 Ga0207683_10000667 3300026121 Bacteria 31542
496 Ga0207683_10010556 3300026121 Bacteria 7880
497 Ga0207698_10006961 3300026142 Bacteria 7075
498 Ga0207698_10026318 3300026142 Bacteria 4114
499 Ga0207698_10326536 3300026142 Unclassified 1439
500 Ga0210002_1000583 3300027617 Bacteria 4951
501 Ga0209983_1008797 3300027665 Bacteria 2060
502 Ga0209998_10001636 3300027717 Bacteria 5367
503 Ga0209974_10006220 3300027876 Bacteria 4179
504 Ga0207428_10000636 3300027907 Bacteria 41316
505 Ga0207428_10001024 3300027907 Bacteria 30931
506 Ga0268266_10005119 3300028379 Bacteria 12356
507 Ga0268265_10003727 3300028380 Bacteria 10834
508 Ga0268265_10007391 3300028380 Bacteria 7418
509 Ga0268264_10001508 3300028381 Bacteria 21696
510 Ga0268264_10002415 3300028381 Bacteria 16442
511 Ga0268264_10101929 3300028381 Bacteria 2497
512 Ga0265338_10004828 3300028800 Bacteria 18005
513 Ga0265338_10031592 3300028800 Bacteria 5188
514 Ga0265330_10098784 3300031235 Bacteria 1250
515 Ga0265332_10000319 3300031238 Bacteria 36874
516 Ga0265325_10000019 3300031241 Bacteria 125265
517 Ga0265325_10003344 3300031241 Bacteria 10523
518 Ga0265325_10003410 3300031241 Bacteria 10388
519 Ga0265325_10115243 3300031241 Bacteria 1301
520 Ga0265329_10094961 3300031242 Bacteria 947
521 Ga0265340_10058370 3300031247 Bacteria 1853
522 Ga0265339_10000269 3300031249 Bacteria 41988
523 Ga0265339_10019476 3300031249 Bacteria 3984
524 Ga0265331_10013951 3300031250 Bacteria 4297
525 Ga0265316_10064110 3300031344 Bacteria 2847
526 Ga0265313_10001274 3300031595 Bacteria 23880
527 Ga0265313_10001604 3300031595 Bacteria 21002
528 Ga0265314_10000577 3300031711 Bacteria 46408
529 Ga0265314_10093502 3300031711 Bacteria 1952
530 Ga0265342_10000050 3300031712 Bacteria 124639
531 Ga0265342_10000085 3300031712 Bacteria 100652
532 Ga0373930_0000585 3300034816 Bacteria 5052
533 Ga0373948_0000258 3300034817 Bacteria 6385
534 Ga0373950_0003921 3300034818 Bacteria 2159
535 Ga0373958_0000124 3300034819 Bacteria 8521
536 Ga0373958_0005327 3300034819 Bacteria 1949
537 Ga0373938_0000585 3300034957 Bacteria 5882
538 Ga0373926_0006655 3300035083 Bacteria 3837
539 Ga0373928_0000615 3300035084 Bacteria 6991
540 Ga0373929_0000271 3300035085 Bacteria 9580
541 Ga0373929_0003779 3300035085 Bacteria 2713
542 Ga0373934_0006337 3300035086 Bacteria 4387
543 Ga0373934_0111791 3300035086 Unclassified 1108
544 Ga0373940_0003638 3300035088 Bacteria 3168
545 Ga0373940_0025596 3300035088 Bacteria 1538
546 Ga0373944_0038946 3300035089 Bacteria 1461
547 Ga0373949_0002356 3300035090 Bacteria 4898
548 Ga0373949_0002759 3300035090 Bacteria 4384
549 Ga0373951_0003109 3300035091 Bacteria 4095
550 Ga0373951_0004829 3300035091 Bacteria 3173
551 Ga0373952_0016434 3300035092 Bacteria 1505
552 Ga0373923_0024434 3300035111 Bacteria 2385
553 Ga0373932_0004854 3300035112 Bacteria 3169
554 Ga0373932_0010920 3300035112 Bacteria 2208
555 Ga0373932_0019069 3300035112 Bacteria 1783
556 Ga0373939_0001233 3300035114 Bacteria 6258
557 Ga0373941_0021850 3300035115 Unclassified 1810
558 Ga0373941_0109674 3300035115 Bacteria 971
559 Ga0373945_0076492 3300035116 Bacteria 1276
560 Ga0373953_0003874 3300035117 Bacteria 4712
561 Ga0373953_0005397 3300035117 Bacteria 4147
562 Ga0373953_0016741 3300035117 Bacteria 2682
563 Ga0373953_0025943 3300035117 Bacteria 2243
564 Ga0373954_0001845 3300035118 Bacteria 8744
565 Ga0373954_0026156 3300035118 Bacteria 2673
566 Ga0373957_0001073 3300035120 Bacteria 7213
567 Ga0373960_0000880 3300035121 Bacteria 6379
568 Ga0373960_0003195 3300035121 Bacteria 3706
569 Ga0373943_0016099 3300035170 Bacteria 3406
570 Ga0373943_0016942 3300035170 Bacteria 3331
571 Ga0373943_0025782 3300035170 Bacteria 2749
572 Ga0373955_0000732 3300035172 Bacteria 14065
573 Ga0373955_0001003 3300035172 Bacteria 11993
574 Ga0373955_0003829 3300035172 Bacteria 6631
575 Ga0373955_0005598 3300035172 Bacteria 5649
576 Ga0373942_0008727 3300035207 Bacteria 2368
577 Ga0373961_0001257 3300035241 Bacteria 7751
578 Ga0373962_0016674 3300035242 Bacteria 1897
579 Ga0373924_0016437 3300035410 Bacteria 2824
580 Ga0373931_0002231 3300035691 Bacteria 8563
581 Ga0373931_0008138 3300035691 Bacteria 4968
582 Ga0373935_0008410 3300035692 Bacteria 6176
583 Ga0373933_0000562 3300035724 Bacteria 23168
584 Ga0373933_0001283 3300035724 Bacteria 14787
585 Ga0373933_0003500 3300035724 Bacteria 8743
586 Ga0373947_0017002 3300035725 Bacteria 4180
587 Ga0373947_0047748 3300035725 Bacteria 2566
588 Ga0373937_0000935 3300036401 Bacteria 24779
589 Ga0373937_0001648 3300036401 Bacteria 18759
590 Ga0373937_0003782 3300036401 Bacteria 12800
591 Ga0373937_0004562 3300036401 Bacteria 11760
592 Ga0373925_0070415 3300037068 Bacteria 2644
593 Ga0373925_0072197 3300037068 Bacteria 2611
594 Ga0373925_0143037 3300037068 Bacteria 1873
595 Ga0373925_0144080 3300037068 Bacteria 1866
596 Ga0395899_0303483 3300037312 Bacteria 1080
597 Ga0395898_0315859 3300037466 Bacteria 1491
598 Ga0395898_0382342 3300037466 Bacteria 1343
599 Ga0436365_0069514 3300039437 Bacteria 5139
600 Ga0436365_0518063 3300039437 Bacteria 2880
601 Ga0436365_1724574 3300039437 Bacteria 4597
602 Ga0436361_0174868 3300039447 Bacteria 1230
603 Ga0436361_0667785 3300039447 Bacteria 5283
604 Ga0451800_0612411 3300041459 Bacteria 1106
605 Ga0439463_038340 3300042016 Bacteria 1216
606 Ga0450923_036232 3300042125 Bacteria 1023
607 Ga0466966_0001275 3300044684 Bacteria 16132
608 Ga0466961_0002805 3300044693 Bacteria 10838
609 Ga0466963_0056152 3300044694 Bacteria 2619
610 Ga0466957_0015701 3300044842 Bacteria 4424
611 Ga0466957_0401730 3300044842 Bacteria 937
612 Ga0466959_0010634 3300045049 Bacteria 6589
613 Ga0466958_0011534 3300045836 Bacteria 4978
614 Ga0495592_0000755 3300046454 Bacteria 22515
615 Ga0495592_0008302 3300046454 Bacteria 7792
616 Ga0495592_0024816 3300046454 Bacteria 4556
617 Ga0495603_0018845 3300046455 Bacteria 4177
618 Ga0495629_0107571 3300046459 Bacteria 1945
619 Ga0495638_0009619 3300046460 Bacteria 6764
620 Ga0495638_0028565 3300046460 Bacteria 3600
621 Ga0495638_0111672 3300046460 Bacteria 1623
622 Ga0495651_0008054 3300046462 Bacteria 8080
623 Ga0495651_0039432 3300046462 Bacteria 3677
624 Ga0495653_0003235 3300046463 Bacteria 13062
625 Ga0495653_0020057 3300046463 Bacteria 5418
626 Ga0495653_0033321 3300046463 Bacteria 4083
627 Ga0495653_0309200 3300046463 Bacteria 1028
628 Ga0495580_0217640 3300046472 Bacteria 1313
629 Ga0495580_0314163 3300046472 Unclassified 1065
630 Ga0495582_0074166 3300046473 Bacteria 1883
631 Ga0495639_0119113 3300046475 Unclassified 1258
632 Ga0495662_0036623 3300046476 Bacteria 2367
633 Ga0495664_0004237 3300046477 Bacteria 7831
634 Ga0495664_0207902 3300046477 Bacteria 1185
635 Ga0495664_0216571 3300046477 Unclassified 1159
636 Ga0495594_0049367 3300046499 Bacteria 2313
637 Ga0495594_0111271 3300046499 Bacteria 1544
638 Ga0495607_0178115 3300046501 Bacteria 1068
639 Ga0495608_0000413 3300046511 Bacteria 29892
640 Ga0495608_0000909 3300046511 Bacteria 20756
641 Ga0495608_0037441 3300046511 Bacteria 3262
642 Ga0495618_0000259 3300046514 Bacteria 38359
643 Ga0495618_0003490 3300046514 Bacteria 9760
644 Ga0495628_0005724 3300046516 Bacteria 10887
645 Ga0495628_0026118 3300046516 Bacteria 4767
646 Ga0495628_0352550 3300046516 Bacteria 1081
647 Ga0495630_0037619 3300046517 Bacteria 3618
648 Ga0495630_0091143 3300046517 Bacteria 2303
649 Ga0495630_0139869 3300046517 Bacteria 1840
650 Ga0495631_0069164 3300046518 Bacteria 1527
651 Ga0495637_0111348 3300046520 Bacteria 1061
652 Ga0495644_0008358 3300046523 Bacteria 3988
653 Ga0495666_0103014 3300046526 Bacteria 1344
654 Ga0495666_0142013 3300046526 Bacteria 1119
655 Ga0495642_0032781 3300046528 Bacteria 2086
656 Ga0495652_0003415 3300046529 Bacteria 15698
657 Ga0495652_0004853 3300046529 Bacteria 12771
658 Ga0495652_0007759 3300046529 Bacteria 9866
659 Ga0495665_0020138 3300046531 Bacteria 3585
660 Ga0495665_0106929 3300046531 Bacteria 1468
661 Ga0495640_0001238 3300046533 Bacteria 20002
662 Ga0495640_0002101 3300046533 Bacteria 15880
663 Ga0495640_0052041 3300046533 Bacteria 2813
664 Ga0495640_0072503 3300046533 Bacteria 2307
665 Ga0495587_0000335 3300046536 Bacteria 33563
666 Ga0495587_0004881 3300046536 Bacteria 8798
667 Ga0495587_0049250 3300046536 Bacteria 2494
668 Ga0495645_0006430 3300046543 Bacteria 8152
669 Ga0495645_0020316 3300046543 Bacteria 4789
670 Ga0495633_0014285 3300046558 Bacteria 4158
671 Ga0495667_0000333 3300046559 Bacteria 29860
672 Ga0495667_0000565 3300046559 Bacteria 23582
673 Ga0495667_0001149 3300046559 Bacteria 17261
674 Ga0495667_0049025 3300046559 Plasmid 2788
675 Ga0495656_0006175 3300046615 Bacteria 4190
676 Ga0495656_0047306 3300046615 Bacteria 1824
677 Ga0495668_0099572 3300046616 Bacteria 1590
678 Ga0495634_0031880 3300046642 Bacteria 3628
679 Ga0495625_0120176 3300046660 Bacteria 1789
680 Ga0495635_0003525 3300046663 Bacteria 10825
681 Ga0495635_0008973 3300046663 Bacteria 6980
682 Ga0495635_0015934 3300046663 Bacteria 5251
683 Ga0495588_0031463 3300046674 Bacteria 2671
684 Ga0495657_0006050 3300046675 Bacteria 9502
685 Ga0495657_0008927 3300046675 Bacteria 7629
686 Ga0495657_0030475 3300046675 Bacteria 3778
687 Ga0495599_0002084 3300046678 Bacteria 11593
688 Ga0495599_0002227 3300046678 Bacteria 11288
689 Ga0495623_0006023 3300046679 Bacteria 7888
690 Ga0495623_0071727 3300046679 Bacteria 2154
691 Ga0495646_0000174 3300046680 Bacteria 32272
692 Ga0495646_0001804 3300046680 Bacteria 12852
693 Ga0495646_0113783 3300046680 Bacteria 1538
694 Ga0495647_0005601 3300046681 Bacteria 4123
695 Ga0495658_0009010 3300046683 Bacteria 4960
696 Ga0495658_0038554 3300046683 Plasmid 2647
697 Ga0495658_0122096 3300046683 Unclassified 1576
698 Ga0495669_0046308 3300046684 Bacteria 1941
699 Ga0495669_0120306 3300046684 Bacteria 1230
700 Ga0495613_0026270 3300046689 Bacteria 4339
701 Ga0495624_0054432 3300046690 Bacteria 2523
702 Ga0495624_0129236 3300046690 Bacteria 1549
703 Ga0495670_0059889 3300046691 Bacteria 1912
704 Ga0495671_0125412 3300046692 Bacteria 1252
705 Ga0495649_0111603 3300046694 Bacteria 1450
706 Ga0495600_0009519 3300046809 Bacteria 6005
707 Ga0495600_0010622 3300046809 Bacteria 5720
708 Ga0495600_0027331 3300046809 Bacteria 3686
709 Ga0495581_0075122 3300047315 Bacteria 1956
710 Ga0495604_0000394 3300047317 Bacteria 39525
711 Ga0495604_0002160 3300047317 Bacteria 15794
712 Ga0495604_0014145 3300047317 Bacteria 6364
713 Ga0495604_0020405 3300047317 Bacteria 5292
714 Ga0495674_0003197 3300047319 Bacteria 15909
715 Ga0495674_0007775 3300047319 Bacteria 10233
716 Ga0495674_0019628 3300047319 Bacteria 6272
717 Ga0495674_0066618 3300047319 Bacteria 3123
718 Ga0495676_0097596 3300047321 Bacteria 2182
719 Ga0495680_0000539 3300047322 Bacteria 42513
720 Ga0495680_0011470 3300047322 Bacteria 7843
721 Ga0495680_0024811 3300047322 Bacteria 4967
722 Ga0495675_0000139 3300047444 Bacteria 50643
723 Ga0495675_0020530 3300047444 Bacteria 4203
724 Ga0495675_0032480 3300047444 Bacteria 3331
725 Ga0495675_0053415 3300047444 Bacteria 2565
726 Ga0495684_0019982 3300047471 Bacteria 5161
727 Ga0495684_0023374 3300047471 Bacteria 4751
728 Ga0495684_0046187 3300047471 Bacteria 3332
729 Ga0495684_0133792 3300047471 Bacteria 1861
730 Ga0495593_0025441 3300047673 Bacteria 3276
731 Ga0495593_0164274 3300047673 Bacteria 1120
732 Ga0495602_0000310 3300048088 Bacteria 45025
733 Ga0495602_0003234 3300048088 Bacteria 16819
734 Ga0495602_0035932 3300048088 Bacteria 4616
735 Ga0495614_0034702 3300048089 Bacteria 2168
736 Ga0496100_0006174 3300048903 Bacteria 6515
737 Ga0496100_0020290 3300048903 Plasmid 3981
738 Ga0496100_0040028 3300048903 Bacteria 2979
739 Ga0496100_0106691 3300048903 Bacteria 1939
740 Ga0496101_0000924 3300048904 Bacteria 17321
741 Ga0496101_0012035 3300048904 Bacteria 5763
742 Ga0496101_0079274 3300048904 Bacteria 2424
743 Ga0496101_0104882 3300048904 Bacteria 2120
744 Ga0496101_0176283 3300048904 Bacteria 1644
745 Ga0496101_0178918 3300048904 Bacteria 1632
746 Ga0496101_0385529 3300048904 Bacteria 1103
747 Ga0496102_0021645 3300048905 Bacteria 5688
748 Ga0496102_0025763 3300048905 Bacteria 5237
749 Ga0496102_0029868 3300048905 Bacteria 4877
750 Ga0496102_0224379 3300048905 Bacteria 1771
751 Ga0496102_0511989 3300048905 Unclassified 1122
752 Ga0496103_0005671 3300048906 Bacteria 7459
753 Ga0496103_0037828 3300048906 Bacteria 2958
754 Ga0496104_0000217 3300048907 Bacteria 50667
755 Ga0496104_0000764 3300048907 Bacteria 27548
756 Ga0496104_0034046 3300048907 Bacteria 4748
757 Ga0496104_0037139 3300048907 Bacteria 4555
758 Ga0496104_0047679 3300048907 Bacteria 4038
759 Ga0496104_0100794 3300048907 Bacteria 2764
760 Ga0496104_0114561 3300048907 Bacteria 2586
761 Ga0496104_0126748 3300048907 Bacteria 2451
762 Ga0496104_0142607 3300048907 Bacteria 2301
763 Ga0496104_0216602 3300048907 Bacteria 1826
764 Ga0496105_0012626 3300048908 Bacteria 6689
765 Ga0496105_0058838 3300048908 Bacteria 3171
766 Ga0496105_0191786 3300048908 Bacteria 1670
767 Ga0496105_0212726 3300048908 Bacteria 1575
768 Ga0496105_0268758 3300048908 Bacteria 1377
769 Ga0496106_0000894 3300048909 Bacteria 21797
770 Ga0496106_0003651 3300048909 Bacteria 11476
771 Ga0496106_0005971 3300048909 Bacteria 8997
772 Ga0496106_0069234 3300048909 Bacteria 2693
773 Ga0496106_0096396 3300048909 Bacteria 2289
774 Ga0496106_0280695 3300048909 Bacteria 1334
775 Ga0496107_0005058 3300048910 Bacteria 8989
776 Ga0496107_0053858 3300048910 Bacteria 2902
777 Ga0496107_0101421 3300048910 Bacteria 2110
778 Ga0496107_0118485 3300048910 Bacteria 1949
779 Ga0496108_0000868 3300048911 Bacteria 23566
780 Ga0496108_0043186 3300048911 Bacteria 3765
781 Ga0496108_0087135 3300048911 Bacteria 2652
782 Ga0496108_0239741 3300048911 Bacteria 1577
783 Ga0496109_0000506 3300048912 Bacteria 33302
784 Ga0496109_0039228 3300048912 Bacteria 4286
785 Ga0496109_0053061 3300048912 Bacteria 3696
786 Ga0496109_0059559 3300048912 Bacteria 3488
787 Ga0496109_0120218 3300048912 Bacteria 2447
788 Ga0496109_0173069 3300048912 Bacteria 2026
789 Ga0496110_0063024 3300048913 Bacteria 3276
790 Ga0496110_0098004 3300048913 Bacteria 2627
791 Ga0496110_0111637 3300048913 Bacteria 2458
792 Ga0496110_0124238 3300048913 Bacteria 2327
793 Ga0496110_0220688 3300048913 Bacteria 1724
794 Ga0496110_0281415 3300048913 Bacteria 1514
795 Ga0496111_0072512 3300048914 Bacteria 2507
796 Ga0496111_0142936 3300048914 Bacteria 1773
797 Ga0496111_0306300 3300048914 Bacteria 1177
798 Ga0496112_0049492 3300048915 Bacteria 4120
799 Ga0496112_0294019 3300048915 Bacteria 1570
800 Ga0496112_0412965 3300048915 Bacteria 1289
801 Ga0496113_0046247 3300048916 Bacteria 3231
802 Ga0496113_0171844 3300048916 Bacteria 1716
803 Ga0496114_0013618 3300048917 Bacteria 6520
804 Ga0496114_0019154 3300048917 Bacteria 5546
805 Ga0496114_0042614 3300048917 Bacteria 3762
806 Ga0496114_0043119 3300048917 Bacteria 3741
807 Ga0496115_0004158 3300048918 Bacteria 10449
808 Ga0496115_0018366 3300048918 Bacteria 5367
809 Ga0496115_0033213 3300048918 Bacteria 4072
810 Ga0496115_0111789 3300048918 Bacteria 2244
811 Ga0496115_0121924 3300048918 Bacteria 2145
812 Ga0496115_0175374 3300048918 Unclassified 1773
813 Ga0501031_0002931 3300049568 Bacteria 10914
814 Ga0501031_0006819 3300049568 Bacteria 7454
815 Ga0501032_0030089 3300049569 Bacteria 3724
816 Ga0501032_0065765 3300049569 Bacteria 2424
817 Ga0501033_0011756 3300049570 Bacteria 6692
818 Ga0501033_0012886 3300049570 Bacteria 6377
819 Ga0501034_0018046 3300049571 Bacteria 7239
820 Ga0501034_0095115 3300049571 Bacteria 2976
821 Ga0501034_0169098 3300049571 Bacteria 2154
822 Ga0501036_0004687 3300049572 Bacteria 11040
823 Ga0501036_0011648 3300049572 Bacteria 7289
824 Ga0501037_0005982 3300049573 Bacteria 8887
825 Ga0501037_0019553 3300049573 Bacteria 4996
826 Ga0501038_0030646 3300049574 Bacteria 4756
827 Ga0501039_0001438 3300049575 Bacteria 17522
828 Ga0501041_0104610 3300049577 Bacteria 1754
829 Ga0501043_0017921 3300049579 Bacteria 5553
830 Ga0501043_0203226 3300049579 Bacteria 1537
831 Ga0501046_0010334 3300049580 Bacteria 8025
832 Ga0501047_0010921 3300049581 Bacteria 8590
833 Ga0501047_0010998 3300049581 Bacteria 8564
834 Ga0501047_0031535 3300049581 Bacteria 5111
835 Ga0501048_0004490 3300049582 Bacteria 10621
836 Ga0501048_0413198 3300049582 Bacteria 965
837 Ga0501067_0005740 3300049583 Bacteria 6886
838 Ga0501068_0011311 3300049584 Bacteria 5035
839 Ga0501069_0006487 3300049585 Bacteria 6116
840 Ga0501070_0014059 3300049586 Bacteria 6738
841 Ga0501070_0025502 3300049586 Bacteria 4958
842 Ga0501070_0159730 3300049586 Bacteria 1858
843 Ga0501070_0188395 3300049586 Bacteria 1696
844 Ga0501071_0077893 3300049587 Bacteria 2422
845 Ga0501072_0413864 3300049588 Bacteria 1069
846 Ga0501073_0006774 3300049589 Bacteria 8529
847 Ga0501074_0012936 3300049590 Bacteria 6067
848 Ga0501076_0408016 3300049592 Bacteria 1117
849 Ga0501077_0166512 3300049593 Bacteria 1400
850 Ga0501079_0026795 3300049741 Bacteria 4419
851 Ga0501080_0028534 3300049742 Bacteria 5193
852 Ga0501081_0071525 3300049743 Bacteria 2418
853 Ga0501083_0015045 3300049744 Bacteria 5415
854 Ga0501035_0014526 3300049822 Bacteria 7268
855 Ga0501035_0018612 3300049822 Bacteria 6396
856 Ga0501044_0000193 3300049823 Bacteria 76794
857 Ga0501044_0026928 3300049823 Bacteria 6083
858 Ga0501044_0050174 3300049823 Bacteria 4307
859 Ga0501044_0276295 3300049823 Bacteria 1615
860 nmdc:mga03683_126932_c1 3300050489 Bacteria 1139
861 nmdc:mga03683_59371_c1 3300050489 Bacteria 1613
862 nmdc:mga0yw44_1168_c1 3300050492 Bacteria 10216
863 nmdc:mga0yw44_393333_c1 3300050492 Bacteria 937
864 nmdc:mga0yw44_86374_c1 3300050492 Bacteria 1976
865 nmdc:mga0yw44_92657_c1 3300050492 Bacteria 1912
866 nmdc:mga0k408_24007_c1 3300050493 Bacteria 3443
867 nmdc:mga0k408_79482_c1 3300050493 Bacteria 1919
868 nmdc:mga0k408_99043_c1 3300050493 Bacteria 1718
869 nmdc:mga06z11_12529_c1 3300050494 Bacteria 3690
870 nmdc:mga06z11_49678_c1 3300050494 Bacteria 2141
871 nmdc:mga06z11_65020_c1 3300050494 Bacteria 1913
872 nmdc:mga07m45_69470_c1 3300050496 Bacteria 2002
873 nmdc:mga05p37_129066_c1 3300050507 Bacteria 3103
874 nmdc:mga05p37_200042_c1 3300050507 Bacteria 2421
875 nmdc:mga05p37_265489_c1 3300050507 Unclassified 2053
876 nmdc:mga05p37_35469_c1 3300050507 Bacteria 6116
877 nmdc:mga05p37_373263_c1 3300050507 Bacteria 1673
878 nmdc:mga05p37_391044_c1 3300050507 Bacteria 1626
879 nmdc:mga05p37_43990_c1 3300050507 Bacteria 5494
880 nmdc:mga05p37_5345_c1 3300050507 Bacteria 15087
881 nmdc:mga09592_148468_c1 3300050508 Bacteria 2022
882 nmdc:mga09592_155548_c1 3300050508 Bacteria 1973
883 nmdc:mga09592_183790_c1 3300050508 Unclassified 1809
884 nmdc:mga0qj67_157449_c1 3300050509 Bacteria 1844
885 nmdc:mga0qj67_61098_c1 3300050509 Bacteria 2991
886 nmdc:mga0qj67_70762_c1 3300050509 Unclassified 2783
887 nmdc:mga0qj67_86566_c1 3300050509 Bacteria 2514
888 nmdc:mga06r32_128479_c1 3300050510 Bacteria 2504
889 nmdc:mga06r32_92744_c1 3300050510 Bacteria 2953
890 nmdc:mga08y16_105572_c1 3300050511 Bacteria 2932
891 nmdc:mga08y16_2968_c1 3300050511 Bacteria 17488
892 nmdc:mga08y16_391273_c1 3300050511 Bacteria 1424
893 nmdc:mga08y16_8363_c1 3300050511 Bacteria 10827
894 nmdc:mga0n895_101152_c1 3300050512 Bacteria 2892
895 nmdc:mga0n895_12603_c1 3300050512 Bacteria 7589
896 nmdc:mga0n895_142142_c1 3300050512 Bacteria 2429
897 nmdc:mga0n895_602258_c1 3300050512 Bacteria 1101
898 nmdc:mga0n895_91583_c1 3300050512 Bacteria 3043
899 nmdc:mga0rr50_175655_c1 3300050513 Bacteria 1748
900 nmdc:mga0rr50_402115_c1 3300050513 Bacteria 1157
901 nmdc:mga08x19_217847_c1 3300050514 Bacteria 1311
902 nmdc:mga0a205_152828_c1 3300050515 Bacteria 2207
903 nmdc:mga0a205_40346_c1 3300050515 Bacteria 4493
904 nmdc:mga0a205_75013_c1 3300050515 Bacteria 3268
905 Ga0495601_0003097 3300053077 Bacteria 9495
906 Ga0495601_0004245 3300053077 Bacteria 8274
907 Ga0495601_0004639 3300053077 Bacteria 7956
908 Ga0495601_0005848 3300053077 Bacteria 7172
909 Ga0495601_0102456 3300053077 Bacteria 1850
910 Ga0495612_0000183 3300053078 Bacteria 26502
911 Ga0495612_0000857 3300053078 Bacteria 12364
912 Ga0495612_0001353 3300053078 Bacteria 10099
913 Ga0495612_0007748 3300053078 Bacteria 4382
914 Ga0495612_0025192 3300053078 Bacteria 2389
915 Ga0495595_0000207 3300053084 Bacteria 23763
916 Ga0495595_0001895 3300053084 Bacteria 8123
917 Ga0495595_0002395 3300053084 Bacteria 7321
918 Ga0495595_0015608 3300053084 Bacteria 3239
919 Ga0495619_0000108 3300053085 Bacteria 62197
920 Ga0495619_0000225 3300053085 Bacteria 40938
921 Ga0495619_0000650 3300053085 Bacteria 22811
922 Ga0495619_0001982 3300053085 Bacteria 13624
923 Ga0495619_0002633 3300053085 Bacteria 11726
924 Ga0495619_0008701 3300053085 Bacteria 6419
925 Ga0495619_0035311 3300053085 Bacteria 3251
926 Ga0500644_0000428 3300053088 Bacteria 19683
927 Ga0500651_0070006 3300053093 Bacteria 2184
928 Ga0500641_0025612 3300053096 Bacteria 2283
929 Ga0500641_0060086 3300053096 Bacteria 1581
930 Ga0500650_0071339 3300053098 Bacteria 1623
931 Ga0500616_0000006 3300053153 Bacteria 944738
932 Ga0500616_0011892 3300053153 Bacteria 5116
933 Ga0500645_000033 3300053730 Bacteria 119279
934 Ga0501084_0019048 3300054114 Bacteria 5716
935 Ga0501084_0230516 3300054114 Bacteria 1563
936 Ga0501082_0006937 3300060353 Bacteria 9790
937 Ga0501082_0215839 3300060353 Bacteria 1669
938 Ga0530510_0058419 3300061734 Bacteria 2789
939 2511131504 2510917022 Bacteria 6504556
940 Ga0495629_0045152
941 2214745235
942 ARSoilYngRDRAFT_c00289
943 ARcpr5yngRDRAFT_c000271
944 ARSoilOldRDRAFT_c000295
945 ARCol0yngRDRAFT_1000053
946 JGI24740J21852_10014159
947 JGI24737J22298_10002175
948 JGI24750J21931_1000807
949 JGI24750J21931_1002444
950 JGI24748J21848_1001444
951 JGI24738J21930_10003423
952 JGI24749J21850_1005224
953 JGI24744J21845_10001325
954 JGI24033J26618_1002454
955 JGI24034J26672_10000436
956 JGI24742J22300_10000131
957 JGI24742J22300_10007537
958 JGI25406J46586_10010069
959 JGI25405J52794_10017289
960 Ga0065716_1002255
961 Ga0065704_10101333
962 Ga0065712_10006389
963 Ga0065712_10020432
964 Ga0065715_10000953
965 Ga0065715_10006553
966 Ga0065707_10113298
967 Ga0070676_10008398
968 Ga0070676_10027396
969 Ga0070683_100001740
970 Ga0070690_100005830
971 Ga0070690_100071996
972 Ga0070670_100023972
973 Ga0070670_100026485
974 Ga0070677_10000553
975 Ga0068869_100004139
976 Ga0068869_100028847
977 Ga0068869_100059369
978 Ga0068869_100224315
979 Ga0070666_10021676
980 Ga0070666_10073203
981 Ga0070680_100002899
982 Ga0070680_100013552
983 Ga0070682_100044407
984 Ga0070682_100196384
985 Ga0068868_100005781
986 Ga0068868_100073271
987 Ga0070660_100001515
988 Ga0070660_100198358
989 Ga0070689_100001241
990 Ga0070691_10064595
991 Ga0070687_100002230
992 Ga0070687_100093250
993 Ga0070661_100012739
994 Ga0070661_100056802
995 Ga0070692_10006992
996 Ga0070692_10008859
997 Ga0070692_10156883
998 Ga0070668_100002506
999 Ga0070668_100066945
1000 Ga0070668_100344455
1001 Ga0070668_100352522
1002 Ga0070669_100000743
1003 Ga0070675_100001086
1004 Ga0070675_100162845
1005 Ga0070675_100196384
1006 Ga0070671_100004095
1007 Ga0070671_100006476
1008 Ga0070671_100052468
1009 Ga0070671_100176242
1010 Ga0070674_100063066
1011 Ga0070674_100541386
1012 Ga0070673_100000419
1013 Ga0070688_100003465
1014 Ga0070659_100007008
1015 Ga0070659_100022088
1016 Ga0070659_100055244
1017 Ga0070667_100279960
1018 Ga0070703_10001244
1019 Ga0070703_10004556
1020 Ga0070709_10011868
1021 Ga0070709_10021857
1022 Ga0070709_10042462
1023 Ga0070709_10073099
1024 Ga0070714_100004331
1025 Ga0070714_100087894
1026 Ga0070714_100203326
1027 Ga0070713_100005705
1028 Ga0070713_100016797
1029 Ga0070713_100023528
1030 Ga0070713_100031744
1031 Ga0070713_100121641
1032 Ga0070713_100167706
1033 Ga0070713_100364987
1034 Ga0070710_10000528
1035 Ga0070710_10004305
1036 Ga0070710_10008141
1037 Ga0070710_10068466
1038 Ga0070710_10075948
1039 Ga0070701_10000365
1040 Ga0070701_10007962
1041 Ga0070701_10059982
1042 Ga0070711_100003401
1043 Ga0070711_100021147
1044 Ga0070711_100039114
1045 Ga0070711_100073866
1046 Ga0070711_100363821
1047 Ga0070705_100001329
1048 Ga0070705_100001964
1049 Ga0070700_100008089
1050 Ga0070700_100008776
1051 Ga0070700_100065982
1052 Ga0070694_100002737
1053 Ga0070694_100021203
1054 Ga0070694_100180133
1055 Ga0070708_100041374
1056 Ga0070663_100019174
1057 Ga0070663_100217857
1058 Ga0070678_100005723
1059 Ga0070678_100083622
1060 Ga0070678_100202717
1061 Ga0070662_100025249
1062 Ga0070662_100180533
1063 Ga0070681_10010311
1064 Ga0070681_10019665
1065 Ga0070681_10189278
1066 Ga0068867_100000980
1067 Ga0070685_10014838
1068 Ga0070685_10015980
1069 Ga0070706_100361152
1070 Ga0070706_100563484
1071 Ga0070699_100000444
1072 Ga0070699_100001276
1073 Ga0070679_100004363
1074 Ga0070684_100013266
1075 Ga0070684_100053185
1076 Ga0070684_100233276
1077 Ga0070697_100017942
1078 Ga0070697_100066086
1079 Ga0070697_100273340
1080 Ga0068853_100006929
1081 Ga0070672_100002302
1082 Ga0070672_100055215
1083 Ga0070686_100012378
1084 Ga0070686_100014304
1085 Ga0070686_100017776
1086 Ga0070695_100000918
1087 Ga0070695_100012338
1088 Ga0070696_100000123
1089 Ga0070696_100002724
1090 Ga0070696_100221935
1091 Ga0070693_100001476
1092 Ga0070704_100000095
1093 Ga0070704_100037262
1094 Ga0068855_100066013
1095 Ga0068855_100279563
1096 Ga0070664_100105237
1097 Ga0070664_100353332
1098 Ga0068857_100002177
1099 Ga0068857_100011660
1100 Ga0068857_100087240
1101 Ga0068856_100003552
1102 Ga0068856_100058287
1103 Ga0068856_100227952
1104 Ga0070702_100016382
1105 Ga0070702_100018984
1106 Ga0070702_100087978
1107 Ga0068852_100051926
1108 Ga0068859_100001820
1109 Ga0068859_100005818
1110 Ga0068859_100063245
1111 Ga0068864_100000140
1112 Ga0068864_100230813
1113 Ga0068866_10001684
1114 Ga0068866_10204219
1115 Ga0068861_100013494
1116 Ga0068861_100095034
1117 Ga0068851_10033291
1118 Ga0068870_10000654
1119 Ga0068863_100000425
1120 Ga0068863_100027701
1121 Ga0068858_100095071
1122 Ga0068858_100167557
1123 Ga0068860_100002696
1124 Ga0068860_100064786
1125 Ga0068862_100020271
1126 Ga0068862_100089132
1127 Ga0081455_10001118
1128 Ga0081455_10011426
1129 Ga0081455_10088394
1130 Ga0081538_10002263
1131 Ga0081538_10060249
1132 Ga0081540_1000192
1133 Ga0081540_1006947
1134 Ga0081540_1024775
1135 Ga0081540_1039437
1136 Ga0081540_1058554
1137 Ga0081539_10001465
1138 Ga0070717_10001340
1139 Ga0070717_10011028
1140 Ga0070717_10044248
1141 Ga0075365_10025752
1142 Ga0075365_10032144
1143 Ga0075365_10261035
1144 Ga0075363_100071859
1145 Ga0075363_100243829
1146 Ga0075364_10209762
1147 Ga0075432_10094301
1148 Ga0070715_10000357
1149 Ga0070715_10012668
1150 Ga0070715_10024931
1151 Ga0070716_100044490
1152 Ga0070712_100001277
1153 Ga0070712_100008584
1154 Ga0070712_100115819
1155 Ga0070712_100195653
1156 Ga0070712_100206962
1157 Ga0070712_100207459
1158 Ga0070712_100263486
1159 Ga0070712_100477325
1160 Ga0075362_10050487
1161 Ga0075367_10039252
1162 Ga0075367_10082303
1163 Ga0097621_100002131
1164 Ga0075370_10071803
1165 Ga0068871_100008325
1166 Ga0075428_100019702
1167 Ga0075428_100028244
1168 Ga0075428_100610295
1169 Ga0075430_100014084
1170 Ga0075430_100037162
1171 Ga0075430_100041065
1172 Ga0075430_100060072
1173 Ga0075430_100077840
1174 Ga0075431_100004314
1175 Ga0075431_100017715
1176 Ga0075431_100021672
1177 Ga0075431_100246339
1178 Ga0075433_10140634
1179 Ga0075433_10148169
1180 Ga0075434_100021735
1181 Ga0075434_100034873
1182 Ga0075434_100058688
1183 Ga0075434_100183079
1184 Ga0075434_100358577
1185 Ga0075429_100155580
1186 Ga0075429_100218808
1187 Ga0075429_100431945
1188 Ga0068865_100001142
1189 Ga0068865_100036778
1190 Ga0068865_100093528
1191 Ga0068865_100112799
1192 Ga0068865_100126065
1193 Ga0075436_100093284
1194 Ga0075436_100102002
1195 Ga0097620_100001820
1196 Ga0097620_100005818
1197 Ga0097620_100063246
1198 Ga0097620_100316806
1199 Ga0075435_100022544
1200 Ga0075435_100125934
1201 Ga0099794_10036502
1202 Ga0105250_10032989
1203 Ga0105240_10109955
1204 Ga0105240_10175329
1205 Ga0111539_10006796
1206 Ga0111539_10014173
1207 Ga0111539_10081343
1208 Ga0111539_10188463
1209 Ga0111539_10479910
1210 Ga0111539_10499868
1211 Ga0111539_10568213
1212 Ga0111539_10803476
1213 Ga0105245_10000867
1214 Ga0105245_10023386
1215 Ga0105247_10116603
1216 Ga0114129_10017149
1217 Ga0114129_10041031
1218 Ga0114129_10045872
1219 Ga0114129_10080861
1220 Ga0114129_10172654
1221 Ga0114129_10233581
1222 Ga0114129_10329811
1223 Ga0114129_10504452
1224 Ga0105243_10002939
1225 Ga0105243_10018773
1226 Ga0105243_10143444
1227 Ga0105241_10007866
1228 Ga0105241_10036622
1229 Ga0105241_10172341
1230 Ga0105242_10001899
1231 Ga0105242_10014951
1232 Ga0105242_10064165
1233 Ga0105248_10003521
1234 Ga0105248_10029630
1235 Ga0105237_10102889
1236 Ga0105237_10135063
1237 Ga0105237_10139250
1238 Ga0105238_10037311
1239 Ga0105238_10119701
1240 Ga0105238_10146147
1241 Ga0105249_10002047
1242 Ga0105249_10002541
1243 Ga0105249_10553691
1244 Ga0105239_10021557
1245 Ga0105239_10037616
1246 Ga0105246_10001875
1247 Ga0157342_1006643
1248 Ga0157373_10100959
1249 Ga0157373_10248718
1250 Ga0157374_10001408
1251 Ga0157374_10110998
1252 Ga0157374_10214333
1253 Ga0157378_10004977
1254 Ga0157378_10246279
1255 Ga0163162_10011093
1256 Ga0163162_10012257
1257 Ga0163162_10130425
1258 Ga0163162_10295032
1259 Ga0157372_10017879
1260 Ga0157372_10770034
1261 Ga0157375_10001932
1262 Ga0157375_10113004
1263 Ga0163163_10034835
1264 Ga0163163_10301099
1265 Ga0163163_10352355
1266 Ga0157380_10014641
1267 Ga0157380_10018915
1268 Ga0157380_10157568
1269 Ga0157380_10202861
1270 Ga0157377_10000486
1271 Ga0157377_10039708
1272 Ga0157379_10006828
1273 Ga0157379_10057193
1274 Ga0157379_10133136
1275 Ga0157376_10068143
1276 Ga0157376_10709013
1277 Ga0213872_10028413
1278 Ga0213876_10033035
1279 Ga0213875_10000003
1280 Ga0207666_1000089
1281 Ga0207673_1002235
1282 Ga0207697_10000993
1283 Ga0207656_10049715
1284 Ga0207653_10008690
1285 Ga0207682_10000104
1286 Ga0207692_10000076
1287 Ga0207692_10026416
1288 Ga0207642_10001116
1289 Ga0207710_10088660
1290 Ga0207688_10001265
1291 Ga0207688_10002264
1292 Ga0207688_10029868
1293 Ga0207680_10006968
1294 Ga0207680_10018072
1295 Ga0207647_10001528
1296 Ga0207647_10060693
1297 Ga0207647_10258746
1298 Ga0207685_10020579
1299 Ga0207685_10028679
1300 Ga0207699_10008588
1301 Ga0207699_10111324
1302 Ga0207699_10164078
1303 Ga0207699_10270969
1304 Ga0207645_10002130
1305 Ga0207645_10070174
1306 Ga0207643_10000035
1307 Ga0207643_10002863
1308 Ga0207684_10152225
1309 Ga0207654_10026417
1310 Ga0207707_10001935
1311 Ga0207707_10046635
1312 Ga0207707_10092137
1313 Ga0207695_10038532
1314 Ga0207693_10001480
1315 Ga0207693_10001843
1316 Ga0207693_10004775
1317 Ga0207693_10008913
1318 Ga0207693_10026826
1319 Ga0207693_10057698
1320 Ga0207693_10184433
1321 Ga0207693_10200058
1322 Ga0207693_10207692
1323 Ga0207693_10229672
1324 Ga0207663_10008697
1325 Ga0207663_10090454
1326 Ga0207663_10110263
1327 Ga0207663_10172413
1328 Ga0207663_10254950
1329 Ga0207660_10000451
1330 Ga0207660_10001146
1331 Ga0207660_10032704
1332 Ga0207662_10002323
1333 Ga0207662_10060397
1334 Ga0207657_10002025
1335 Ga0207657_10024447
1336 Ga0207649_10000309
1337 Ga0207649_10308122
1338 Ga0207652_10010263
1339 Ga0207652_10058859
1340 Ga0207646_10304826
1341 Ga0207681_10001488
1342 Ga0207694_10068334
1343 Ga0207694_10144188
1344 Ga0207694_10227863
1345 Ga0207650_10006726
1346 Ga0207650_10061427
1347 Ga0207659_10000091
1348 Ga0207659_10116261
1349 Ga0207687_10000161
1350 Ga0207687_10085640
1351 Ga0207700_10002812
1352 Ga0207700_10009232
1353 Ga0207700_10096860
1354 Ga0207700_10264668
1355 Ga0207700_10393120
1356 Ga0207700_10400254
1357 Ga0207700_10527315
1358 Ga0207664_10006249
1359 Ga0207664_10011444
1360 Ga0207664_10210631
1361 Ga0207664_10236410
1362 Ga0207644_10000245
1363 Ga0207644_10052208
1364 Ga0207644_10074056
1365 Ga0207644_10105600
1366 Ga0207690_10000771
1367 Ga0207690_10088403
1368 Ga0207706_10005499
1369 Ga0207706_10012450
1370 Ga0207706_10110642
1371 Ga0207686_10001194
1372 Ga0207686_10008989
1373 Ga0207686_10040051
1374 Ga0207709_10001001
1375 Ga0207709_10075536
1376 Ga0207709_10084032
1377 Ga0207670_10000526
1378 Ga0207670_10018175
1379 Ga0207670_10090762
1380 Ga0207670_10262025
1381 Ga0207669_10011592
1382 Ga0207704_10031210
1383 Ga0207704_10092693
1384 Ga0207665_10001028
1385 Ga0207665_10007368
1386 Ga0207665_10025516
1387 Ga0207665_10127780
1388 Ga0207665_10185695
1389 Ga0207691_10000336
1390 Ga0207691_10015407
1391 Ga0207711_10035966
1392 Ga0207711_10061529
1393 Ga0207711_10295596
1394 Ga0207689_10000168
1395 Ga0207689_10028925
1396 Ga0207689_10098550
1397 Ga0207689_10145944
1398 Ga0207661_10000575
1399 Ga0207661_10258176
1400 Ga0207679_10000035
1401 Ga0207679_10019432
1402 Ga0207679_10205302
1403 Ga0207667_10098793
1404 Ga0207651_10000233
1405 Ga0207651_10075434
1406 Ga0207712_10000768
1407 Ga0207712_10009092
1408 Ga0207668_10001470
1409 Ga0207668_10159635
1410 Ga0207668_10270678
1411 Ga0207640_10001231
1412 Ga0207658_10073032
1413 Ga0207677_10000997
1414 Ga0207677_10061228
1415 Ga0207703_10001880
1416 Ga0207703_10091454
1417 Ga0207639_10000421
1418 Ga0207678_10001561
1419 Ga0207678_10016361
1420 Ga0207678_10186746
1421 Ga0207708_10001793
1422 Ga0207708_10004956
1423 Ga0207708_10013704
1424 Ga0207702_10045251
1425 Ga0207641_10003563
1426 Ga0207641_10484983
1427 Ga0207648_10004259
1428 Ga0207648_10060537
1429 Ga0207648_10205886
1430 Ga0207674_10000535
1431 Ga0207674_10002113
1432 Ga0207674_10112624
1433 Ga0207675_100000365
1434 Ga0207683_10000667
1435 Ga0207683_10010556
1436 Ga0207698_10006961
1437 Ga0207698_10026318
1438 Ga0207698_10326536
1439 Ga0210002_1000583
1440 Ga0209983_1008797
1441 Ga0209998_10001636
1442 Ga0209974_10006220
1443 Ga0207428_10000636
1444 Ga0207428_10001024
1445 Ga0268266_10005119
1446 Ga0268265_10003727
1447 Ga0268265_10007391
1448 Ga0268264_10001508
1449 Ga0268264_10002415
1450 Ga0268264_10101929
1451 Ga0265338_10004828
1452 Ga0265338_10031592
1453 Ga0265330_10098784
1454 Ga0265332_10000319
1455 Ga0265325_10000019
1456 Ga0265325_10003344
1457 Ga0265325_10003410
1458 Ga0265325_10115243
1459 Ga0265329_10094961
1460 Ga0265340_10058370
1461 Ga0265339_10000269
1462 Ga0265339_10019476
1463 Ga0265331_10013951
1464 Ga0265316_10064110
1465 Ga0265313_10001274
1466 Ga0265313_10001604
1467 Ga0265314_10000577
1468 Ga0265314_10093502
1469 Ga0265342_10000050
1470 Ga0265342_10000085
1471 Ga0373930_0000585
1472 Ga0373948_0000258
1473 Ga0373950_0003921
1474 Ga0373958_0000124
1475 Ga0373958_0005327
1476 Ga0373938_0000585
1477 Ga0373926_0006655
1478 Ga0373928_0000615
1479 Ga0373929_0000271
1480 Ga0373929_0003779
1481 Ga0373934_0006337
1482 Ga0373934_0111791
1483 Ga0373940_0003638
1484 Ga0373940_0025596
1485 Ga0373944_0038946
1486 Ga0373949_0002356
1487 Ga0373949_0002759
1488 Ga0373951_0003109
1489 Ga0373951_0004829
1490 Ga0373952_0016434
1491 Ga0373923_0024434
1492 Ga0373932_0004854
1493 Ga0373932_0010920
1494 Ga0373932_0019069
1495 Ga0373939_0001233
1496 Ga0373941_0021850
1497 Ga0373941_0109674
1498 Ga0373945_0076492
1499 Ga0373953_0003874
1500 Ga0373953_0005397
1501 Ga0373953_0016741
1502 Ga0373953_0025943
1503 Ga0373954_0001845
1504 Ga0373954_0026156
1505 Ga0373957_0001073
1506 Ga0373960_0000880
1507 Ga0373960_0003195
1508 Ga0373943_0016099
1509 Ga0373943_0016942
1510 Ga0373943_0025782
1511 Ga0373955_0000732
1512 Ga0373955_0001003
1513 Ga0373955_0003829
1514 Ga0373955_0005598
1515 Ga0373942_0008727
1516 Ga0373961_0001257
1517 Ga0373962_0016674
1518 Ga0373924_0016437
1519 Ga0373931_0002231
1520 Ga0373931_0008138
1521 Ga0373935_0008410
1522 Ga0373933_0000562
1523 Ga0373933_0001283
1524 Ga0373933_0003500
1525 Ga0373947_0017002
1526 Ga0373947_0047748
1527 Ga0373937_0000935
1528 Ga0373937_0001648
1529 Ga0373937_0003782
1530 Ga0373937_0004562
1531 Ga0373925_0070415
1532 Ga0373925_0072197
1533 Ga0373925_0143037
1534 Ga0373925_0144080
1535 Ga0395899_0303483
1536 Ga0395898_0315859
1537 Ga0395898_0382342
1538 Ga0436365_0069514
1539 Ga0436365_0518063
1540 Ga0436365_1724574
1541 Ga0436361_0174868
1542 Ga0436361_0667785
1543 Ga0451800_0612411
1544 Ga0439463_038340
1545 Ga0450923_036232
1546 Ga0466966_0001275
1547 Ga0466961_0002805
1548 Ga0466963_0056152
1549 Ga0466957_0015701
1550 Ga0466957_0401730
1551 Ga0466959_0010634
1552 Ga0466958_0011534
1553 Ga0495592_0000755
1554 Ga0495592_0008302
1555 Ga0495592_0024816
1556 Ga0495603_0018845
1557 Ga0495629_0107571
1558 Ga0495638_0009619
1559 Ga0495638_0028565
1560 Ga0495638_0111672
1561 Ga0495651_0008054
1562 Ga0495651_0039432
1563 Ga0495653_0003235
1564 Ga0495653_0020057
1565 Ga0495653_0033321
1566 Ga0495653_0309200
1567 Ga0495580_0217640
1568 Ga0495580_0314163
1569 Ga0495582_0074166
1570 Ga0495639_0119113
1571 Ga0495662_0036623
1572 Ga0495664_0004237
1573 Ga0495664_0207902
1574 Ga0495664_0216571
1575 Ga0495594_0049367
1576 Ga0495594_0111271
1577 Ga0495607_0178115
1578 Ga0495608_0000413
1579 Ga0495608_0000909
1580 Ga0495608_0037441
1581 Ga0495618_0000259
1582 Ga0495618_0003490
1583 Ga0495628_0005724
1584 Ga0495628_0026118
1585 Ga0495628_0352550
1586 Ga0495630_0037619
1587 Ga0495630_0091143
1588 Ga0495630_0139869
1589 Ga0495631_0069164
1590 Ga0495637_0111348
1591 Ga0495644_0008358
1592 Ga0495666_0103014
1593 Ga0495666_0142013
1594 Ga0495642_0032781
1595 Ga0495652_0003415
1596 Ga0495652_0004853
1597 Ga0495652_0007759
1598 Ga0495665_0020138
1599 Ga0495665_0106929
1600 Ga0495640_0001238
1601 Ga0495640_0002101
1602 Ga0495640_0052041
1603 Ga0495640_0072503
1604 Ga0495587_0000335
1605 Ga0495587_0004881
1606 Ga0495587_0049250
1607 Ga0495645_0006430
1608 Ga0495645_0020316
1609 Ga0495633_0014285
1610 Ga0495667_0000333
1611 Ga0495667_0000565
1612 Ga0495667_0001149
1613 Ga0495667_0049025
1614 Ga0495656_0006175
1615 Ga0495656_0047306
1616 Ga0495668_0099572
1617 Ga0495634_0031880
1618 Ga0495625_0120176
1619 Ga0495635_0003525
1620 Ga0495635_0008973
1621 Ga0495635_0015934
1622 Ga0495588_0031463
1623 Ga0495657_0006050
1624 Ga0495657_0008927
1625 Ga0495657_0030475
1626 Ga0495599_0002084
1627 Ga0495599_0002227
1628 Ga0495623_0006023
1629 Ga0495623_0071727
1630 Ga0495646_0000174
1631 Ga0495646_0001804
1632 Ga0495646_0113783
1633 Ga0495647_0005601
1634 Ga0495658_0009010
1635 Ga0495658_0038554
1636 Ga0495658_0122096
1637 Ga0495669_0046308
1638 Ga0495669_0120306
1639 Ga0495613_0026270
1640 Ga0495624_0054432
1641 Ga0495624_0129236
1642 Ga0495670_0059889
1643 Ga0495671_0125412
1644 Ga0495649_0111603
1645 Ga0495600_0009519
1646 Ga0495600_0010622
1647 Ga0495600_0027331
1648 Ga0495581_0075122
1649 Ga0495604_0000394
1650 Ga0495604_0002160
1651 Ga0495604_0014145
1652 Ga0495604_0020405
1653 Ga0495674_0003197
1654 Ga0495674_0007775
1655 Ga0495674_0019628
1656 Ga0495674_0066618
1657 Ga0495676_0097596
1658 Ga0495680_0000539
1659 Ga0495680_0011470
1660 Ga0495680_0024811
1661 Ga0495675_0000139
1662 Ga0495675_0020530
1663 Ga0495675_0032480
1664 Ga0495675_0053415
1665 Ga0495684_0019982
1666 Ga0495684_0023374
1667 Ga0495684_0046187
1668 Ga0495684_0133792
1669 Ga0495593_0025441
1670 Ga0495593_0164274
1671 Ga0495602_0000310
1672 Ga0495602_0003234
1673 Ga0495602_0035932
1674 Ga0495614_0034702
1675 Ga0496100_0006174
1676 Ga0496100_0020290
1677 Ga0496100_0040028
1678 Ga0496100_0106691
1679 Ga0496101_0000924
1680 Ga0496101_0012035
1681 Ga0496101_0079274
1682 Ga0496101_0104882
1683 Ga0496101_0176283
1684 Ga0496101_0178918
1685 Ga0496101_0385529
1686 Ga0496102_0021645
1687 Ga0496102_0025763
1688 Ga0496102_0029868
1689 Ga0496102_0224379
1690 Ga0496102_0511989
1691 Ga0496103_0005671
1692 Ga0496103_0037828
1693 Ga0496104_0000217
1694 Ga0496104_0000764
1695 Ga0496104_0034046
1696 Ga0496104_0037139
1697 Ga0496104_0047679
1698 Ga0496104_0100794
1699 Ga0496104_0114561
1700 Ga0496104_0126748
1701 Ga0496104_0142607
1702 Ga0496104_0216602
1703 Ga0496105_0012626
1704 Ga0496105_0058838
1705 Ga0496105_0191786
1706 Ga0496105_0212726
1707 Ga0496105_0268758
1708 Ga0496106_0000894
1709 Ga0496106_0003651
1710 Ga0496106_0005971
1711 Ga0496106_0069234
1712 Ga0496106_0096396
1713 Ga0496106_0280695
1714 Ga0496107_0005058
1715 Ga0496107_0053858
1716 Ga0496107_0101421
1717 Ga0496107_0118485
1718 Ga0496108_0000868
1719 Ga0496108_0043186
1720 Ga0496108_0087135
1721 Ga0496108_0239741
1722 Ga0496109_0000506
1723 Ga0496109_0039228
1724 Ga0496109_0053061
1725 Ga0496109_0059559
1726 Ga0496109_0120218
1727 Ga0496109_0173069
1728 Ga0496110_0063024
1729 Ga0496110_0098004
1730 Ga0496110_0111637
1731 Ga0496110_0124238
1732 Ga0496110_0220688
1733 Ga0496110_0281415
1734 Ga0496111_0072512
1735 Ga0496111_0142936
1736 Ga0496111_0306300
1737 Ga0496112_0049492
1738 Ga0496112_0294019
1739 Ga0496112_0412965
1740 Ga0496113_0046247
1741 Ga0496113_0171844
1742 Ga0496114_0013618
1743 Ga0496114_0019154
1744 Ga0496114_0042614
1745 Ga0496114_0043119
1746 Ga0496115_0004158
1747 Ga0496115_0018366
1748 Ga0496115_0033213
1749 Ga0496115_0111789
1750 Ga0496115_0121924
1751 Ga0496115_0175374
1752 Ga0501031_0002931
1753 Ga0501031_0006819
1754 Ga0501032_0030089
1755 Ga0501032_0065765
1756 Ga0501033_0011756
1757 Ga0501033_0012886
1758 Ga0501034_0018046
1759 Ga0501034_0095115
1760 Ga0501034_0169098
1761 Ga0501036_0004687
1762 Ga0501036_0011648
1763 Ga0501037_0005982
1764 Ga0501037_0019553
1765 Ga0501038_0030646
1766 Ga0501039_0001438
1767 Ga0501041_0104610
1768 Ga0501043_0017921
1769 Ga0501043_0203226
1770 Ga0501046_0010334
1771 Ga0501047_0010921
1772 Ga0501047_0010998
1773 Ga0501047_0031535
1774 Ga0501048_0004490
1775 Ga0501048_0413198
1776 Ga0501067_0005740
1777 Ga0501068_0011311
1778 Ga0501069_0006487
1779 Ga0501070_0014059
1780 Ga0501070_0025502
1781 Ga0501070_0159730
1782 Ga0501070_0188395
1783 Ga0501071_0077893
1784 Ga0501072_0413864
1785 Ga0501073_0006774
1786 Ga0501074_0012936
1787 Ga0501076_0408016
1788 Ga0501077_0166512
1789 Ga0501079_0026795
1790 Ga0501080_0028534
1791 Ga0501081_0071525
1792 Ga0501083_0015045
1793 Ga0501035_0014526
1794 Ga0501035_0018612
1795 Ga0501044_0000193
1796 Ga0501044_0026928
1797 Ga0501044_0050174
1798 Ga0501044_0276295
1799 nmdc:mga03683_126932_c1
1800 nmdc:mga03683_59371_c1
1801 nmdc:mga0yw44_1168_c1
1802 nmdc:mga0yw44_393333_c1
1803 nmdc:mga0yw44_86374_c1
1804 nmdc:mga0yw44_92657_c1
1805 nmdc:mga0k408_24007_c1
1806 nmdc:mga0k408_79482_c1
1807 nmdc:mga0k408_99043_c1
1808 nmdc:mga06z11_12529_c1
1809 nmdc:mga06z11_49678_c1
1810 nmdc:mga06z11_65020_c1
1811 nmdc:mga07m45_69470_c1
1812 nmdc:mga05p37_129066_c1
1813 nmdc:mga05p37_200042_c1
1814 nmdc:mga05p37_265489_c1
1815 nmdc:mga05p37_35469_c1
1816 nmdc:mga05p37_373263_c1
1817 nmdc:mga05p37_391044_c1
1818 nmdc:mga05p37_43990_c1
1819 nmdc:mga05p37_5345_c1
1820 nmdc:mga09592_148468_c1
1821 nmdc:mga09592_155548_c1
1822 nmdc:mga09592_183790_c1
1823 nmdc:mga0qj67_157449_c1
1824 nmdc:mga0qj67_61098_c1
1825 nmdc:mga0qj67_70762_c1
1826 nmdc:mga0qj67_86566_c1
1827 nmdc:mga06r32_128479_c1
1828 nmdc:mga06r32_92744_c1
1829 nmdc:mga08y16_105572_c1
1830 nmdc:mga08y16_2968_c1
1831 nmdc:mga08y16_391273_c1
1832 nmdc:mga08y16_8363_c1
1833 nmdc:mga0n895_101152_c1
1834 nmdc:mga0n895_12603_c1
1835 nmdc:mga0n895_142142_c1
1836 nmdc:mga0n895_602258_c1
1837 nmdc:mga0n895_91583_c1
1838 nmdc:mga0rr50_175655_c1
1839 nmdc:mga0rr50_402115_c1
1840 nmdc:mga08x19_217847_c1
1841 nmdc:mga0a205_152828_c1
1842 nmdc:mga0a205_40346_c1
1843 nmdc:mga0a205_75013_c1
1844 Ga0495601_0003097
1845 Ga0495601_0004245
1846 Ga0495601_0004639
1847 Ga0495601_0005848
1848 Ga0495601_0102456
1849 Ga0495612_0000183
1850 Ga0495612_0000857
1851 Ga0495612_0001353
1852 Ga0495612_0007748
1853 Ga0495612_0025192
1854 Ga0495595_0000207
1855 Ga0495595_0001895
1856 Ga0495595_0002395
1857 Ga0495595_0015608
1858 Ga0495619_0000108
1859 Ga0495619_0000225
1860 Ga0495619_0000650
1861 Ga0495619_0001982
1862 Ga0495619_0002633
1863 Ga0495619_0008701
1864 Ga0495619_0035311
1865 Ga0500644_0000428
1866 Ga0500651_0070006
1867 Ga0500641_0025612
1868 Ga0500641_0060086
1869 Ga0500650_0071339
1870 Ga0500616_0000006
1871 Ga0500616_0011892
1872 Ga0500645_000033
1873 Ga0501084_0019048
1874 Ga0501084_0230516
1875 Ga0501082_0006937
1876 Ga0501082_0215839
1877 Ga0530510_0058419
1878 2511131504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

131

276

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

113

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zsz-assembly1.cif.gz_A catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 0.9227 2 248
1mpy-assembly1.cif.gz_D structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 0.9215 3 246
5znh-assembly1.cif.gz_A catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 0.9173 2 248
3lm4-assembly1.cif.gz_B crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (strain rha1) 0.9173 2 247
7q2a-assembly1.cif.gz_A crystal structure of aphc in complex with 4-ethylcatechol 0.9171 2 247
ID Description Score Start End Superfamily
3b59F02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9331 135 248 3.10.180.10
5zszA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9283 135 248 3.10.180.10
5znhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9281 135 248 3.10.180.10
1mpyA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9273 134 247 3.10.180.10
1eilA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8916 4 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D2LIL4-F1-model_v4 deleted 0.9599 130 247
AF-A0A5J6XS81-F1-model_v4 VOC domain-containing protein 0.9488 1 164
AF-A0A345PE51-F1-model_v4 VOC domain-containing protein 0.9445 1 247
AF-A0A212Q6K0-F1-model_v4 deleted 0.9427 1 220
AF-A0A654CTN7-F1-model_v4 Catechol-2,3-dioxygenase 0.9407 132 247 GO:0051213

Map