F486304

General Info

Members Datasets Scaffolds Average Seq Length
940 419 1880 287

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100091044|Ga0070683_1000910441
Length 278
Sequence MIRGFGLGLRPEHYRDFAQGAAAVDWLEILTENYLVPGGKPLDYLDRIRARYPVAMHGVSLSIAGESLDPEYLKQLEALARRVQPAWISDHLCWTGVGGRNLHDLLPIPFTAEALRHVAGRVGRVQDRLRRPLVLENVSSYVRMAEDEMTEWEFLRELVRRSGCELLLDVNNVYVNAVNHRFDARAFIDALPPQAIRQIHLAGHTDNGDHLVDTHDSPVCEAVWELYEHAVARFGPVPTMIERDDAIPPLAELVSELDIARRRAERALRSRTADALAA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
117 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
208 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
214 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
227 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
395 2511231031 Pseudomonas sp. GM16 Isolate Nodule
396 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
397 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
398 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
399 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
400 2791355199
401 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
402 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
403 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
404 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
405 2904699407
406 2906610324
407 2909042592 Labrys sp. LIt4 Isolate Nodule
408 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
409 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
410 2922425934
411 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
412 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
413 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
414 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
415 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
416 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
417 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
418 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
419 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 1.6
Rhizoplane 5.74
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100091044 3300005329 Bacteria 2864
2 MBSR1b_contig_4107868 2162886012 Bacteria 1120
3 JGI24737J22298_10066822 3300001990 Bacteria 1076
4 JGI24748J21848_1003601 3300002074 Bacteria 1771
5 JGI24751J29686_10011764 3300002459 Bacteria 1805
6 JGI25406J46586_10000168 3300003203 Bacteria 29130
7 JGI25406J46586_10015153 3300003203 Bacteria 3258
8 JGI25153J46596_10005034 3300003215 Bacteria 6990
9 rootH1_10148202 3300003323 Bacteria 3457
10 JGI25404J52841_10003367 3300003659 Bacteria 3152
11 Ga0065165_1005839 3300005262 Bacteria 6705
12 Ga0065715_10149744 3300005293 Bacteria 1743
13 Ga0070658_10007026 3300005327 Bacteria 9088
14 Ga0070658_10074612 3300005327 Bacteria 2782
15 Ga0070676_10000177 3300005328 Bacteria 26323
16 Ga0070676_10006855 3300005328 Bacteria 6100
17 Ga0070676_10183365 3300005328 Bacteria 1362
18 Ga0070683_100003236 3300005329 Bacteria 13150
19 Ga0070683_100098872 3300005329 Bacteria 2746
20 Ga0070690_100000161 3300005330 Bacteria 34386
21 Ga0070690_100020167 3300005330 Bacteria 4058
22 Ga0070690_100251059 3300005330 Unclassified 1251
23 Ga0070690_100259359 3300005330 Bacteria 1232
24 Ga0070670_100017668 3300005331 Bacteria 6120
25 Ga0070670_100034365 3300005331 Bacteria 4362
26 Ga0070677_10011383 3300005333 Bacteria 3067
27 Ga0070677_10047505 3300005333 Bacteria 1721
28 Ga0068869_100001688 3300005334 Bacteria 13183
29 Ga0068869_100004961 3300005334 Bacteria 8328
30 Ga0068869_100075691 3300005334 Bacteria 2501
31 Ga0068869_100239963 3300005334 Bacteria 1444
32 Ga0068869_100387811 3300005334 Bacteria 1146
33 Ga0070666_10000673 3300005335 Bacteria 20665
34 Ga0070666_10028516 3300005335 Bacteria 3664
35 Ga0070666_10035673 3300005335 Bacteria 3298
36 Ga0070680_100071083 3300005336 Bacteria 2859
37 Ga0070680_100078816 3300005336 Bacteria 2714
38 Ga0070680_100171282 3300005336 Bacteria 1827
39 Ga0070682_100065884 3300005337 Bacteria 2303
40 Ga0068868_100005707 3300005338 Bacteria 8760
41 Ga0068868_100017937 3300005338 Bacteria 5281
42 Ga0068868_100098697 3300005338 Bacteria 2362
43 Ga0068868_100153156 3300005338 Bacteria 1900
44 Ga0070660_100000841 3300005339 Bacteria 20418
45 Ga0070660_100483122 3300005339 Bacteria 1029
46 Ga0070660_100512165 3300005339 Bacteria 999
47 Ga0070689_100000709 3300005340 Bacteria 20276
48 Ga0070689_100016859 3300005340 Bacteria 5354
49 Ga0070689_100269226 3300005340 Bacteria 1410
50 Ga0070691_10146074 3300005341 Bacteria 1209
51 Ga0070687_100000011 3300005343 Bacteria 57981
52 Ga0070687_100034677 3300005343 Bacteria 2500
53 Ga0070687_100039822 3300005343 Bacteria 2364
54 Ga0070661_100001135 3300005344 Bacteria 18731
55 Ga0070661_100006263 3300005344 Bacteria 8212
56 Ga0070661_100077201 3300005344 Bacteria 2455
57 Ga0070661_100105908 3300005344 Bacteria 2097
58 Ga0070692_10132575 3300005345 Bacteria 1402
59 Ga0070668_100005064 3300005347 Bacteria 9755
60 Ga0070668_100293763 3300005347 Unclassified 1361
61 Ga0070668_100551171 3300005347 Bacteria 1003
62 Ga0070669_100006355 3300005353 Bacteria 8515
63 Ga0070669_100014101 3300005353 Bacteria 5685
64 Ga0070675_100000821 3300005354 Bacteria 21914
65 Ga0070675_100002151 3300005354 Bacteria 14581
66 Ga0070675_100170775 3300005354 Bacteria 1875
67 Ga0070675_100314828 3300005354 Bacteria 1381
68 Ga0070671_100001021 3300005355 Bacteria 20588
69 Ga0070674_100002542 3300005356 Bacteria 10102
70 Ga0070674_100003166 3300005356 Bacteria 9171
71 Ga0070674_100182181 3300005356 Bacteria 1610
72 Ga0070674_100302054 3300005356 Bacteria 1276
73 Ga0070673_100003576 3300005364 Bacteria 9706
74 Ga0070673_100005261 3300005364 Bacteria 8263
75 Ga0070688_100001830 3300005365 Bacteria 10681
76 Ga0070688_100332909 3300005365 Unclassified 1106
77 Ga0070659_100000150 3300005366 Bacteria 53214
78 Ga0070659_100378629 3300005366 Bacteria 1192
79 Ga0070667_100005396 3300005367 Bacteria 10681
80 Ga0070667_100115137 3300005367 Bacteria 2335
81 Ga0070709_10071872 3300005434 Bacteria 2235
82 Ga0070714_100435311 3300005435 Bacteria 1244
83 Ga0070713_100217617 3300005436 Bacteria 1732
84 Ga0070701_10002949 3300005438 Bacteria 6643
85 Ga0070701_10035114 3300005438 Bacteria 2517
86 Ga0070711_100062091 3300005439 Bacteria 2603
87 Ga0070705_100000387 3300005440 Bacteria 25625
88 Ga0070694_100182487 3300005444 Bacteria 1553
89 Ga0070694_100345984 3300005444 Bacteria 1151
90 Ga0070663_100000694 3300005455 Bacteria 18126
91 Ga0070663_100013602 3300005455 Bacteria 5194
92 Ga0070663_100056093 3300005455 Bacteria 2821
93 Ga0070663_100065062 3300005455 Bacteria 2637
94 Ga0070663_100097899 3300005455 Bacteria 2184
95 Ga0070663_100159847 3300005455 Bacteria 1733
96 Ga0070663_100161774 3300005455 Bacteria 1723
97 Ga0070663_100222666 3300005455 Bacteria 1482
98 Ga0070678_100022351 3300005456 Bacteria 4190
99 Ga0070678_100024393 3300005456 Unclassified 4048
100 Ga0070678_100042538 3300005456 Bacteria 3230
101 Ga0070678_100153543 3300005456 Bacteria 1857
102 Ga0070678_100485616 3300005456 Bacteria 1088
103 Ga0070678_100585302 3300005456 Bacteria 994
104 Ga0070662_100000201 3300005457 Bacteria 35043
105 Ga0070662_100015950 3300005457 Bacteria 5039
106 Ga0070662_100022033 3300005457 Bacteria 4357
107 Ga0070681_10030752 3300005458 Bacteria 5388
108 Ga0070681_10237815 3300005458 Bacteria 1735
109 Ga0068867_100000832 3300005459 Bacteria 20752
110 Ga0068867_100156807 3300005459 Bacteria 1792
111 Ga0070685_10003362 3300005466 Bacteria 8138
112 Ga0070685_10044247 3300005466 Bacteria 2548
113 Ga0070706_100256463 3300005467 Bacteria 1633
114 Ga0070707_100423860 3300005468 Bacteria 1291
115 Ga0070699_100036589 3300005518 Bacteria 4247
116 Ga0070699_100079053 3300005518 Bacteria 2864
117 Ga0070699_100192435 3300005518 Bacteria 1812
118 Ga0070679_100022047 3300005530 Bacteria 6222
119 Ga0070679_100068280 3300005530 Bacteria 3546
120 Ga0070684_100036825 3300005535 Bacteria 4194
121 Ga0068853_100005121 3300005539 Bacteria 10244
122 Ga0068853_100358276 3300005539 Bacteria 1358
123 Ga0068853_100435278 3300005539 Bacteria 1232
124 Ga0070672_100003813 3300005543 Bacteria 9815
125 Ga0070672_100010911 3300005543 Bacteria 6321
126 Ga0070672_100045754 3300005543 Bacteria 3388
127 Ga0070686_100001626 3300005544 Bacteria 12566
128 Ga0070686_100082537 3300005544 Bacteria 2132
129 Ga0070686_100246696 3300005544 Bacteria 1302
130 Ga0070695_100046693 3300005545 Bacteria 2763
131 Ga0070695_100055370 3300005545 Bacteria 2556
132 Ga0070696_100067161 3300005546 Bacteria 2516
133 Ga0070693_100017104 3300005547 Bacteria 3764
134 Ga0070693_100027832 3300005547 Bacteria 3068
135 Ga0070693_100027871 3300005547 Bacteria 3066
136 Ga0070693_100031872 3300005547 Bacteria 2893
137 Ga0070693_100068195 3300005547 Bacteria 2087
138 Ga0070693_100112553 3300005547 Bacteria 1677
139 Ga0070665_100020348 3300005548 Bacteria 6665
140 Ga0070665_100023807 3300005548 Bacteria 6169
141 Ga0070665_100032508 3300005548 Bacteria 5251
142 Ga0070665_100177036 3300005548 Bacteria 2134
143 Ga0070665_100488953 3300005548 Bacteria 1242
144 Ga0070665_100641719 3300005548 Bacteria 1075
145 Ga0070704_100048327 3300005549 Bacteria 2978
146 Ga0068855_100007063 3300005563 Bacteria 13618
147 Ga0068855_100013690 3300005563 Bacteria 9782
148 Ga0068855_100019007 3300005563 Bacteria 8261
149 Ga0068855_100054408 3300005563 Bacteria 4704
150 Ga0068855_100061422 3300005563 Bacteria 4391
151 Ga0068855_100119768 3300005563 Bacteria 3013
152 Ga0068855_100184199 3300005563 Bacteria 2359
153 Ga0070664_100000409 3300005564 Bacteria 31980
154 Ga0070664_100011714 3300005564 Bacteria 7117
155 Ga0070664_100031009 3300005564 Bacteria 4464
156 Ga0070664_100124158 3300005564 Bacteria 2263
157 Ga0068857_100000045 3300005577 Bacteria 68428
158 Ga0068857_100019250 3300005577 Bacteria 5993
159 Ga0068857_100165300 3300005577 Bacteria 2009
160 Ga0068857_100264293 3300005577 Bacteria 1580
161 Ga0068854_100000943 3300005578 Bacteria 17491
162 Ga0068854_100004958 3300005578 Bacteria 8390
163 Ga0068854_100377213 3300005578 Bacteria 1168
164 Ga0068856_100000969 3300005614 Bacteria 30619
165 Ga0068856_100070577 3300005614 Bacteria 3456
166 Ga0068856_100110301 3300005614 Bacteria 2748
167 Ga0068856_100331805 3300005614 Bacteria 1539
168 Ga0070702_100074559 3300005615 Bacteria 2014
169 Ga0070702_100087054 3300005615 Bacteria 1886
170 Ga0070702_100107814 3300005615 Bacteria 1721
171 Ga0070702_100188045 3300005615 Bacteria 1357
172 Ga0070702_100322842 3300005615 Bacteria 1077
173 Ga0068852_100010493 3300005616 Bacteria 6926
174 Ga0068852_100022851 3300005616 Bacteria 5023
175 Ga0068852_100073144 3300005616 Bacteria 3015
176 Ga0068852_100287366 3300005616 Bacteria 1587
177 Ga0068852_100740716 3300005616 Bacteria 995
178 Ga0068852_100745225 3300005616 Bacteria 991
179 Ga0068859_100002138 3300005617 Bacteria 20097
180 Ga0068859_100006419 3300005617 Bacteria 11933
181 Ga0068859_100187733 3300005617 Bacteria 2151
182 Ga0068864_100001397 3300005618 Bacteria 19994
183 Ga0068864_100034925 3300005618 Bacteria 4279
184 Ga0068864_100092449 3300005618 Bacteria 2670
185 Ga0068866_10001396 3300005718 Bacteria 10405
186 Ga0068866_10067040 3300005718 Bacteria 1883
187 Ga0068861_100000449 3300005719 Bacteria 23927
188 Ga0068861_100059201 3300005719 Bacteria 2932
189 Ga0068861_100200551 3300005719 Bacteria 1674
190 Ga0068851_10002385 3300005834 Bacteria 8252
191 Ga0068870_10000840 3300005840 Bacteria 11962
192 Ga0068870_10159417 3300005840 Bacteria 1336
193 Ga0068863_100004325 3300005841 Bacteria 14003
194 Ga0068863_100216746 3300005841 Bacteria 1843
195 Ga0068858_100002574 3300005842 Bacteria 18264
196 Ga0068858_100020070 3300005842 Bacteria 6250
197 Ga0068858_100042918 3300005842 Bacteria 4193
198 Ga0068858_100053290 3300005842 Bacteria 3742
199 Ga0068858_100356005 3300005842 Bacteria 1402
200 Ga0068860_100006384 3300005843 Bacteria 11834
201 Ga0068860_100068705 3300005843 Bacteria 3367
202 Ga0068860_100160156 3300005843 Bacteria 2170
203 Ga0068860_100194817 3300005843 Bacteria 1962
204 Ga0068860_100205880 3300005843 Bacteria 1908
205 Ga0068860_100397843 3300005843 Bacteria 1362
206 Ga0068862_100003062 3300005844 Bacteria 14570
207 Ga0068862_100135682 3300005844 Bacteria 2180
208 Ga0081455_10001565 3300005937 Bacteria 28095
209 Ga0081455_10004842 3300005937 Bacteria 14942
210 Ga0081455_10005486 3300005937 Bacteria 13905
211 Ga0081455_10023977 3300005937 Bacteria 5662
212 Ga0081455_10025617 3300005937 Bacteria 5440
213 Ga0081455_10109038 3300005937 Bacteria 2204
214 Ga0081538_10051765 3300005981 Bacteria 2461
215 Ga0081540_1000076 3300005983 Bacteria 106701
216 Ga0081540_1000083 3300005983 Bacteria 100350
217 Ga0081540_1000780 3300005983 Bacteria 29224
218 Ga0081540_1001934 3300005983 Bacteria 17349
219 Ga0081540_1002260 3300005983 Bacteria 15841
220 Ga0081540_1004844 3300005983 Bacteria 10142
221 Ga0081540_1006350 3300005983 Bacteria 8632
222 Ga0081540_1006556 3300005983 Bacteria 8453
223 Ga0081540_1042269 3300005983 Bacteria 2352
224 Ga0081539_10000040 3300005985 Bacteria 292753
225 Ga0081539_10002516 3300005985 Bacteria 25625
226 Ga0081539_10052497 3300005985 Bacteria 2289
227 Ga0075365_10065664 3300006038 Bacteria 2432
228 Ga0075365_10107719 3300006038 Bacteria 1913
229 Ga0075368_10012932 3300006042 Bacteria 3059
230 Ga0075363_100213502 3300006048 Bacteria 1104
231 Ga0070716_100313125 3300006173 Bacteria 1097
232 Ga0070712_100017293 3300006175 Bacteria 4666
233 Ga0075369_10012643 3300006186 Bacteria 3335
234 Ga0075366_10193729 3300006195 Bacteria 1235
235 Ga0097621_100013398 3300006237 Bacteria 6113
236 Ga0097621_100059494 3300006237 Bacteria 3128
237 Ga0097621_100124098 3300006237 Bacteria 2192
238 Ga0068871_100002264 3300006358 Bacteria 13084
239 Ga0075428_100181146 3300006844 Bacteria 2280
240 Ga0075428_100211480 3300006844 Bacteria 2096
241 Ga0075430_100048637 3300006846 Bacteria 3581
242 Ga0075431_100166626 3300006847 Bacteria 2265
243 Ga0075433_10423792 3300006852 Bacteria 1174
244 Ga0075434_100150993 3300006871 Bacteria 2343
245 Ga0075434_100282382 3300006871 Bacteria 1679
246 Ga0075434_100308820 3300006871 Bacteria 1602
247 Ga0068865_100000468 3300006881 Bacteria 22582
248 Ga0068865_100006360 3300006881 Bacteria 7199
249 Ga0068865_100009816 3300006881 Bacteria 5945
250 Ga0068865_100127092 3300006881 Bacteria 1904
251 Ga0068865_100391653 3300006881 Unclassified 1136
252 Ga0097620_100002138 3300006931 Bacteria 20097
253 Ga0097620_100006418 3300006931 Bacteria 11933
254 Ga0097620_100187745 3300006931 Bacteria 2151
255 Ga0099794_10002060 3300007265 Bacteria 7292
256 Ga0099795_10105581 3300007788 Bacteria 1110
257 Ga0105240_10000911 3300009093 Bacteria 52804
258 Ga0105240_10007148 3300009093 Bacteria 16262
259 Ga0105240_10040900 3300009093 Bacteria 5923
260 Ga0105240_10043796 3300009093 Bacteria 5691
261 Ga0105240_10348608 3300009093 Bacteria 1680
262 Ga0111539_10005949 3300009094 Bacteria 15752
263 Ga0111539_10034475 3300009094 Bacteria 6137
264 Ga0111539_10233241 3300009094 Bacteria 2143
265 Ga0111539_10292188 3300009094 Bacteria 1896
266 Ga0105245_10000110 3300009098 Bacteria 79654
267 Ga0105245_10048588 3300009098 Bacteria 3796
268 Ga0105245_10341805 3300009098 Bacteria 1480
269 Ga0105247_10000779 3300009101 Bacteria 24470
270 Ga0105247_10085085 3300009101 Bacteria 1999
271 Ga0105247_10292969 3300009101 Bacteria 1126
272 Ga0114129_10079787 3300009147 Bacteria 4550
273 Ga0114129_10337361 3300009147 Bacteria 2000
274 Ga0105243_10001825 3300009148 Bacteria 18221
275 Ga0105243_10331838 3300009148 Bacteria 1389
276 Ga0105241_10000441 3300009174 Bacteria 31255
277 Ga0105241_10016275 3300009174 Bacteria 5450
278 Ga0105241_10045394 3300009174 Bacteria 3334
279 Ga0105241_10245421 3300009174 Bacteria 1516
280 Ga0105242_10003699 3300009176 Bacteria 11905
281 Ga0105242_10007991 3300009176 Bacteria 8149
282 Ga0105242_10016771 3300009176 Bacteria 5700
283 Ga0105242_10084280 3300009176 Bacteria 2663
284 Ga0105248_10007983 3300009177 Bacteria 11625
285 Ga0105248_10008973 3300009177 Bacteria 10995
286 Ga0105248_10132530 3300009177 Bacteria 2812
287 Ga0105248_10356813 3300009177 Bacteria 1646
288 Ga0105237_10004354 3300009545 Bacteria 16406
289 Ga0105237_10016097 3300009545 Bacteria 7778
290 Ga0105237_10034338 3300009545 Bacteria 5136
291 Ga0105237_10038469 3300009545 Bacteria 4830
292 Ga0105237_10152385 3300009545 Bacteria 2308
293 Ga0105237_10548970 3300009545 Bacteria 1162
294 Ga0105237_10610675 3300009545 Bacteria 1097
295 Ga0105238_10000246 3300009551 Bacteria 60435
296 Ga0105238_10037628 3300009551 Bacteria 4918
297 Ga0105238_10045861 3300009551 Bacteria 4415
298 Ga0105238_10057078 3300009551 Bacteria 3915
299 Ga0105238_10218265 3300009551 Bacteria 1883
300 Ga0105238_10678085 3300009551 Bacteria 1042
301 Ga0105249_10001617 3300009553 Bacteria 19729
302 Ga0105249_10005056 3300009553 Bacteria 11362
303 Ga0105249_10056577 3300009553 Bacteria 3591
304 Ga0105249_10381216 3300009553 Bacteria 1436
305 Ga0105239_10025154 3300010375 Bacteria 6557
306 Ga0105239_10039281 3300010375 Bacteria 5185
307 Ga0105239_10039841 3300010375 Bacteria 5147
308 Ga0105239_10080411 3300010375 Bacteria 3586
309 Ga0105239_10137433 3300010375 Bacteria 2721
310 Ga0105239_10286555 3300010375 Bacteria 1855
311 Ga0105239_10287340 3300010375 Bacteria 1852
312 Ga0105246_10042417 3300011119 Bacteria 3081
313 Ga0105246_10079100 3300011119 Bacteria 2337
314 Ga0157335_1000837 3300012492 Bacteria 1536
315 Ga0157326_1008196 3300012513 Bacteria 1137
316 Ga0157373_10004358 3300013100 Bacteria 10661
317 Ga0157373_10327913 3300013100 Bacteria 1090
318 Ga0157371_10006096 3300013102 Bacteria 10026
319 Ga0157371_10150770 3300013102 Bacteria 1658
320 Ga0157370_10011316 3300013104 Bacteria 9350
321 Ga0157370_10062592 3300013104 Bacteria 3528
322 Ga0157369_10012527 3300013105 Bacteria 9620
323 Ga0157369_10177141 3300013105 Bacteria 2244
324 Ga0157374_10000113 3300013296 Bacteria 74057
325 Ga0157374_10011568 3300013296 Bacteria 7649
326 Ga0157374_10058276 3300013296 Bacteria 3608
327 Ga0157374_10081673 3300013296 Bacteria 3067
328 Ga0157374_10366504 3300013296 Bacteria 1433
329 Ga0157378_10011085 3300013297 Bacteria 7889
330 Ga0157378_10026784 3300013297 Bacteria 5084
331 Ga0157378_10034001 3300013297 Bacteria 4509
332 Ga0157378_10094564 3300013297 Bacteria 2721
333 Ga0157378_10348838 3300013297 Bacteria 1445
334 Ga0163162_10000617 3300013306 Bacteria 33010
335 Ga0163162_10064022 3300013306 Bacteria 3722
336 Ga0163162_10179442 3300013306 Bacteria 2243
337 Ga0163162_10388730 3300013306 Bacteria 1528
338 Ga0163162_10576566 3300013306 Unclassified 1252
339 Ga0157372_10007152 3300013307 Bacteria 11880
340 Ga0157372_10050625 3300013307 Bacteria 4620
341 Ga0157372_10333153 3300013307 Bacteria 1768
342 Ga0157375_10001209 3300013308 Bacteria 22296
343 Ga0157375_10001227 3300013308 Bacteria 22128
344 Ga0157375_10007526 3300013308 Bacteria 9522
345 Ga0157375_10013332 3300013308 Bacteria 7310
346 Ga0157375_10077771 3300013308 Bacteria 3349
347 Ga0157375_10206394 3300013308 Bacteria 2121
348 Ga0163163_10013878 3300014325 Bacteria 7389
349 Ga0163163_10032740 3300014325 Bacteria 5022
350 Ga0163163_10049458 3300014325 Bacteria 4138
351 Ga0163163_10063508 3300014325 Bacteria 3662
352 Ga0157380_10029092 3300014326 Bacteria 4222
353 Ga0157380_10085162 3300014326 Bacteria 2593
354 Ga0157380_10110506 3300014326 Bacteria 2309
355 Ga0157380_10116556 3300014326 Bacteria 2255
356 Ga0157380_10186199 3300014326 Bacteria 1829
357 Ga0157377_10000265 3300014745 Bacteria 25633
358 Ga0157379_10000775 3300014968 Bacteria 25977
359 Ga0157379_10024010 3300014968 Bacteria 5411
360 Ga0157379_10073293 3300014968 Bacteria 3064
361 Ga0157379_10355004 3300014968 Bacteria 1343
362 Ga0157379_10439438 3300014968 Bacteria 1203
363 Ga0157376_10001710 3300014969 Bacteria 14602
364 Ga0157376_10016754 3300014969 Bacteria 5573
365 Ga0157376_10113593 3300014969 Bacteria 2388
366 Ga0209758_1006284 3300025297 Bacteria 8631
367 Ga0209758_1006935 3300025297 Bacteria 7901
368 Ga0207697_10000147 3300025315 Bacteria 34455
369 Ga0207656_10000871 3300025321 Bacteria 9831
370 Ga0207655_1017118 3300025728 Bacteria 3925
371 Ga0207682_10011662 3300025893 Bacteria 3435
372 Ga0207692_10046815 3300025898 Bacteria 2170
373 Ga0207642_10061668 3300025899 Bacteria 1745
374 Ga0207642_10320096 3300025899 Bacteria 905
375 Ga0207710_10016717 3300025900 Bacteria 3106
376 Ga0207688_10000086 3300025901 Bacteria 35591
377 Ga0207688_10009671 3300025901 Bacteria 5248
378 Ga0207680_10004502 3300025903 Bacteria 6609
379 Ga0207680_10064647 3300025903 Bacteria 2244
380 Ga0207680_10138589 3300025903 Bacteria 1611
381 Ga0207647_10002419 3300025904 Bacteria 14154
382 Ga0207647_10138492 3300025904 Bacteria 1427
383 Ga0207645_10000006 3300025907 Bacteria 197563
384 Ga0207645_10010075 3300025907 Bacteria 6507
385 Ga0207645_10023160 3300025907 Bacteria 4037
386 Ga0207643_10000019 3300025908 Bacteria 112372
387 Ga0207643_10074115 3300025908 Bacteria 1963
388 Ga0207705_10007653 3300025909 Bacteria 7940
389 Ga0207654_10001653 3300025911 Bacteria 11647
390 Ga0207654_10071490 3300025911 Bacteria 2063
391 Ga0207654_10295373 3300025911 Bacteria 1100
392 Ga0207707_10025800 3300025912 Bacteria 5140
393 Ga0207707_10305510 3300025912 Bacteria 1375
394 Ga0207695_10004251 3300025913 Bacteria 19672
395 Ga0207695_10040274 3300025913 Bacteria 5013
396 Ga0207695_10113566 3300025913 Bacteria 2685
397 Ga0207671_10007024 3300025914 Bacteria 9865
398 Ga0207671_10190124 3300025914 Bacteria 1601
399 Ga0207671_10216966 3300025914 Bacteria 1498
400 Ga0207693_10085746 3300025915 Bacteria 2467
401 Ga0207660_10054655 3300025917 Bacteria 2851
402 Ga0207662_10000002 3300025918 Bacteria 164937
403 Ga0207662_10008870 3300025918 Bacteria 5517
404 Ga0207662_10060786 3300025918 Bacteria 2267
405 Ga0207657_10000007 3300025919 Bacteria 205196
406 Ga0207657_10410742 3300025919 Bacteria 1064
407 Ga0207649_10002537 3300025920 Bacteria 10170
408 Ga0207649_10002680 3300025920 Bacteria 9868
409 Ga0207649_10008104 3300025920 Bacteria 5717
410 Ga0207652_10176872 3300025921 Bacteria 1916
411 Ga0207652_10289641 3300025921 Bacteria 1477
412 Ga0207646_10131038 3300025922 Bacteria 2257
413 Ga0207681_10001798 3300025923 Bacteria 13769
414 Ga0207681_10151091 3300025923 Bacteria 1740
415 Ga0207681_10349804 3300025923 Bacteria 1183
416 Ga0207694_10024306 3300025924 Bacteria 4600
417 Ga0207650_10000109 3300025925 Bacteria 108728
418 Ga0207650_10104192 3300025925 Bacteria 2188
419 Ga0207659_10001567 3300025926 Bacteria 13570
420 Ga0207659_10031235 3300025926 Bacteria 3644
421 Ga0207659_10124561 3300025926 Bacteria 1980
422 Ga0207687_10004863 3300025927 Bacteria 8931
423 Ga0207687_10091805 3300025927 Bacteria 2216
424 Ga0207687_10136303 3300025927 Bacteria 1857
425 Ga0207644_10000618 3300025931 Bacteria 22661
426 Ga0207690_10063101 3300025932 Bacteria 2525
427 Ga0207690_10236481 3300025932 Bacteria 1405
428 Ga0207706_10000066 3300025933 Bacteria 108138
429 Ga0207706_10002627 3300025933 Bacteria 17502
430 Ga0207706_10008600 3300025933 Bacteria 9406
431 Ga0207706_10013775 3300025933 Bacteria 7338
432 Ga0207706_10314679 3300025933 Unclassified 1363
433 Ga0207686_10003515 3300025934 Bacteria 8412
434 Ga0207686_10017329 3300025934 Unclassified 4057
435 Ga0207709_10008078 3300025935 Bacteria 5829
436 Ga0207709_10245453 3300025935 Bacteria 1305
437 Ga0207709_10319731 3300025935 Bacteria 1161
438 Ga0207709_10442794 3300025935 Bacteria 1002
439 Ga0207670_10004848 3300025936 Bacteria 7308
440 Ga0207670_10043926 3300025936 Bacteria 2954
441 Ga0207670_10054504 3300025936 Bacteria 2698
442 Ga0207669_10000286 3300025937 Bacteria 23124
443 Ga0207669_10004441 3300025937 Bacteria 6173
444 Ga0207669_10025214 3300025937 Bacteria 3209
445 Ga0207669_10029792 3300025937 Bacteria 3024
446 Ga0207669_10197430 3300025937 Bacteria 1457
447 Ga0207669_10288491 3300025937 Bacteria 1241
448 Ga0207704_10001245 3300025938 Bacteria 11361
449 Ga0207704_10018911 3300025938 Bacteria 3607
450 Ga0207704_10048601 3300025938 Unclassified 2545
451 Ga0207704_10097094 3300025938 Bacteria 1953
452 Ga0207704_10471942 3300025938 Bacteria 1005
453 Ga0207665_10009471 3300025939 Bacteria 6394
454 Ga0207691_10000628 3300025940 Bacteria 34907
455 Ga0207691_10026799 3300025940 Bacteria 5409
456 Ga0207691_10031739 3300025940 Bacteria 4929
457 Ga0207691_10599668 3300025940 Bacteria 932
458 Ga0207711_10000065 3300025941 Bacteria 119677
459 Ga0207711_10001337 3300025941 Bacteria 23334
460 Ga0207711_10023085 3300025941 Bacteria 5209
461 Ga0207711_10041147 3300025941 Bacteria 3935
462 Ga0207711_10204698 3300025941 Bacteria 1802
463 Ga0207689_10000070 3300025942 Bacteria 82939
464 Ga0207689_10005212 3300025942 Bacteria 11665
465 Ga0207689_10024310 3300025942 Bacteria 5084
466 Ga0207661_10051220 3300025944 Bacteria 3293
467 Ga0207661_10086145 3300025944 Bacteria 2606
468 Ga0207679_10000192 3300025945 Bacteria 49117
469 Ga0207679_10002439 3300025945 Bacteria 11459
470 Ga0207679_10023667 3300025945 Bacteria 4203
471 Ga0207679_10043202 3300025945 Bacteria 3244
472 Ga0207679_10270026 3300025945 Bacteria 1454
473 Ga0207667_10000244 3300025949 Bacteria 76441
474 Ga0207667_10006665 3300025949 Bacteria 13960
475 Ga0207667_10168344 3300025949 Bacteria 2252
476 Ga0207651_10002235 3300025960 Bacteria 9178
477 Ga0207651_10005114 3300025960 Bacteria 6697
478 Ga0207712_10000421 3300025961 Bacteria 36297
479 Ga0207712_10006564 3300025961 Bacteria 7341
480 Ga0207712_10046748 3300025961 Bacteria 3002
481 Ga0207712_10091256 3300025961 Bacteria 2244
482 Ga0207668_10040849 3300025972 Bacteria 3132
483 Ga0207668_10242019 3300025972 Bacteria 1460
484 Ga0207668_10358634 3300025972 Bacteria 1221
485 Ga0207640_10000169 3300025981 Bacteria 47286
486 Ga0207640_10002086 3300025981 Bacteria 10764
487 Ga0207658_10010070 3300025986 Bacteria 6421
488 Ga0207658_10026952 3300025986 Bacteria 4033
489 Ga0207658_10130696 3300025986 Bacteria 2017
490 Ga0207658_10291383 3300025986 Bacteria 1403
491 Ga0207677_10000187 3300026023 Bacteria 49830
492 Ga0207677_10008792 3300026023 Bacteria 5658
493 Ga0207677_10306387 3300026023 Bacteria 1314
494 Ga0207703_10000102 3300026035 Bacteria 100318
495 Ga0207703_10005716 3300026035 Bacteria 9975
496 Ga0207703_10018789 3300026035 Bacteria 5397
497 Ga0207703_10053526 3300026035 Bacteria 3280
498 Ga0207703_10406349 3300026035 Bacteria 1264
499 Ga0207703_10416604 3300026035 Bacteria 1249
500 Ga0207703_10451457 3300026035 Bacteria 1201
501 Ga0207639_10002412 3300026041 Bacteria 12553
502 Ga0207639_10168687 3300026041 Bacteria 1851
503 Ga0207678_10001138 3300026067 Bacteria 24371
504 Ga0207678_10014007 3300026067 Bacteria 7050
505 Ga0207678_10029116 3300026067 Bacteria 4820
506 Ga0207678_10122751 3300026067 Bacteria 2216
507 Ga0207678_10229069 3300026067 Bacteria 1591
508 Ga0207708_10014035 3300026075 Bacteria 5985
509 Ga0207708_10544529 3300026075 Archaea 978
510 Ga0207702_10058029 3300026078 Bacteria 3292
511 Ga0207702_10102076 3300026078 Bacteria 2534
512 Ga0207702_10166680 3300026078 Bacteria 2016
513 Ga0207702_10267828 3300026078 Bacteria 1611
514 Ga0207641_10024778 3300026088 Bacteria 4945
515 Ga0207641_10108912 3300026088 Bacteria 2453
516 Ga0207641_10168360 3300026088 Bacteria 1998
517 Ga0207648_10000099 3300026089 Bacteria 82716
518 Ga0207648_10001481 3300026089 Bacteria 25831
519 Ga0207648_10328994 3300026089 Bacteria 1374
520 Ga0207648_10425335 3300026089 Bacteria 1206
521 Ga0207676_10003294 3300026095 Bacteria 11475
522 Ga0207676_10090503 3300026095 Bacteria 2511
523 Ga0207674_10000030 3300026116 Bacteria 145695
524 Ga0207674_10009990 3300026116 Bacteria 10802
525 Ga0207674_10020542 3300026116 Bacteria 7132
526 Ga0207674_10100456 3300026116 Bacteria 2874
527 Ga0207675_100000007 3300026118 Bacteria 187048
528 Ga0207675_100092540 3300026118 Bacteria 2844
529 Ga0207675_100207607 3300026118 Bacteria 1883
530 Ga0207683_10000688 3300026121 Bacteria 30991
531 Ga0207683_10008652 3300026121 Bacteria 8704
532 Ga0207683_10028448 3300026121 Bacteria 4832
533 Ga0207683_10063460 3300026121 Bacteria 3254
534 Ga0207683_10116730 3300026121 Bacteria 2393
535 Ga0207683_10218267 3300026121 Bacteria 1737
536 Ga0207683_10271848 3300026121 Bacteria 1548
537 Ga0207698_10063176 3300026142 Bacteria 2896
538 Ga0207698_10097833 3300026142 Bacteria 2423
539 Ga0207698_10242596 3300026142 Bacteria 1643
540 Ga0209588_1031900 3300027671 Bacteria 1687
541 Ga0209998_10011711 3300027717 Bacteria 1818
542 Ga0207428_10012161 3300027907 Bacteria 7573
543 Ga0265356_1002334 3300028017 Bacteria 2553
544 Ga0268266_10000397 3300028379 Bacteria 65954
545 Ga0268266_10002092 3300028379 Bacteria 22080
546 Ga0268266_10011766 3300028379 Bacteria 7587
547 Ga0268266_10051335 3300028379 Bacteria 3539
548 Ga0268266_10136923 3300028379 Bacteria 2194
549 Ga0268265_10041140 3300028380 Bacteria 3417
550 Ga0268265_10173213 3300028380 Bacteria 1846
551 Ga0268265_10187328 3300028380 Bacteria 1784
552 Ga0268265_10357673 3300028380 Bacteria 1335
553 Ga0268265_10436587 3300028380 Bacteria 1219
554 Ga0268264_10000804 3300028381 Bacteria 33856
555 Ga0268264_10007291 3300028381 Bacteria 9252
556 Ga0268264_10016086 3300028381 Bacteria 6129
557 Ga0268264_10287733 3300028381 Bacteria 1542
558 Ga0265337_1012313 3300028556 Bacteria 2912
559 Ga0265326_10019538 3300028558 Bacteria 1945
560 Ga0265319_1008249 3300028563 Bacteria 4585
561 Ga0265334_10003965 3300028573 Bacteria 6660
562 Ga0265318_10007905 3300028577 Bacteria 4775
563 Ga0265323_10000311 3300028653 Bacteria 28078
564 Ga0265322_10004519 3300028654 Bacteria 4137
565 Ga0265336_10000074 3300028666 Bacteria 82727
566 Ga0307517_10000085 3300028786 Bacteria 131200
567 Ga0307517_10074853 3300028786 Bacteria 2979
568 Ga0307515_10059363 3300028794 Bacteria 5483
569 Ga0265338_10000137 3300028800 Bacteria 135705
570 Ga0265324_10000684 3300029957 Bacteria 22772
571 Ga0307512_10038614 3300030522 Bacteria 4014
572 Ga0265332_10001022 3300031238 Bacteria 16531
573 Ga0265328_10000061 3300031239 Bacteria 63197
574 Ga0265328_10000305 3300031239 Bacteria 22931
575 Ga0265328_10016966 3300031239 Bacteria 2826
576 Ga0265328_10127456 3300031239 Bacteria 951
577 Ga0265320_10025025 3300031240 Bacteria 3145
578 Ga0265329_10005533 3300031242 Bacteria 5096
579 Ga0265329_10007066 3300031242 Bacteria 4379
580 Ga0265340_10111001 3300031247 Bacteria 1268
581 Ga0265331_10001445 3300031250 Bacteria 17455
582 Ga0265331_10001600 3300031250 Bacteria 16533
583 Ga0265327_10013516 3300031251 Bacteria 5418
584 Ga0265327_10016623 3300031251 Bacteria 4662
585 Ga0265316_10001750 3300031344 Bacteria 22990
586 Ga0265316_10003254 3300031344 Bacteria 16504
587 Ga0307513_10034291 3300031456 Bacteria 5697
588 Ga0307509_10003945 3300031507 Bacteria 21884
589 Ga0307509_10291622 3300031507 Bacteria 1386
590 Ga0307508_10267428 3300031616 Bacteria 1304
591 Ga0307514_10056229 3300031649 Bacteria 3021
592 Ga0316575_10065222 3300031665 Bacteria 1458
593 Ga0265314_10003069 3300031711 Bacteria 16462
594 Ga0265342_10117254 3300031712 Bacteria 1502
595 Ga0316576_10019077 3300031727 Bacteria 4695
596 Ga0307516_10285369 3300031730 Bacteria 1331
597 Ga0307405_10200013 3300031731 Bacteria 1450
598 Ga0307518_10086710 3300031838 Bacteria 2256
599 Ga0307406_10083326 3300031901 Bacteria 2132
600 Ga0307406_10192287 3300031901 Bacteria 1495
601 Ga0307406_10226588 3300031901 Bacteria 1393
602 Ga0307414_10372349 3300032004 Bacteria 1232
603 Ga0307415_100160411 3300032126 Bacteria 1742
604 Ga0307510_10000779 3300033180 Bacteria 32991
605 Ga0307510_10007951 3300033180 Bacteria 12621
606 Ga0307510_10011080 3300033180 Bacteria 10717
607 Ga0373930_0003689 3300034816 Bacteria 2449
608 Ga0316574_0000392 3300035398 Bacteria 17117
609 Ga0316574_0048385 3300035398 Bacteria 2640
610 Ga0373931_0014394 3300035691 Bacteria 3865
611 Ga0373931_0066820 3300035691 Bacteria 1952
612 Ga0373931_0084598 3300035691 Bacteria 1757
613 Ga0373927_0018763 3300035695 Bacteria 4538
614 Ga0373927_0038026 3300035695 Bacteria 3126
615 Ga0373927_0136066 3300035695 Bacteria 1606
616 Ga0373927_0172204 3300035695 Bacteria 1419
617 Ga0373947_0001290 3300035725 Bacteria 15432
618 Ga0373947_0348930 3300035725 Bacteria 993
619 Ga0373937_0146484 3300036401 Bacteria 2211
620 Ga0316582_0047808 3300036647 Bacteria 2703
621 Ga0395898_0039339 3300037466 Bacteria 4681
622 Ga0395898_0131235 3300037466 Bacteria 2399
623 Ga0395905_0029346 3300037471 Bacteria 5182
624 Ga0316581_0013616 3300037588 Bacteria 2308
625 Ga0395901_0067826 3300038443 Bacteria 3716
626 Ga0400487_40084 3300039110 Bacteria 6241
627 Ga0436363_0046265 3300039450 Bacteria 1015
628 Ga0439465_0099112 3300041413 Bacteria 1005
629 Ga0451793_1474675 3300041452 Bacteria 958
630 Ga0439448_0016450 3300042005 Bacteria 2251
631 Ga0439459_0010244 3300042438 Bacteria 1632
632 Ga0451577_0006026 3300042876 Bacteria 12205
633 Ga0451577_0037073 3300042876 Bacteria 4389
634 Ga0451577_0067510 3300042876 Bacteria 3189
635 Ga0451577_0084294 3300042876 Bacteria 2836
636 Ga0466972_0000303 3300044658 Bacteria 29316
637 Ga0466972_0011092 3300044658 Bacteria 4522
638 Ga0453683_0010984 3300044673 Bacteria 5987
639 Ga0453683_0062673 3300044673 Bacteria 2324
640 Ga0453683_0062726 3300044673 Bacteria 2323
641 Ga0453683_0319146 3300044673 Bacteria 995
642 Ga0466965_0046472 3300044683 Bacteria 2149
643 Ga0466966_0001947 3300044684 Bacteria 13360
644 Ga0466966_0008904 3300044684 Bacteria 6649
645 Ga0466961_0028359 3300044693 Bacteria 3599
646 Ga0466964_0004069 3300044706 Bacteria 5380
647 Ga0453684_0006586 3300044712 Bacteria 21968
648 Ga0453684_0006667 3300044712 Bacteria 21798
649 Ga0453684_0010078 3300044712 Bacteria 16238
650 Ga0453684_0084806 3300044712 Bacteria 3939
651 Ga0453684_0092451 3300044712 Bacteria 3729
652 Ga0453684_0115171 3300044712 Bacteria 3257
653 Ga0453684_0848870 3300044712 Bacteria 981
654 Ga0466971_0016619 3300044719 Bacteria 3250
655 Ga0466970_0025629 3300044765 Bacteria 3088
656 Ga0466970_0026243 3300044765 Bacteria 3053
657 Ga0466957_0114111 3300044842 Bacteria 1716
658 Ga0466960_0079810 3300044901 Bacteria 1646
659 Ga0466959_0000006 3300045049 Bacteria 192678
660 Ga0451576_0002250 3300045051 Bacteria 29531
661 Ga0451576_0059005 3300045051 Bacteria 4007
662 Ga0466958_0020205 3300045836 Bacteria 3883
663 Ga0466958_0179957 3300045836 Bacteria 1341
664 Ga0495617_002531 3300046452 Bacteria 7222
665 Ga0495627_000264 3300046453 Bacteria 53754
666 Ga0495592_0000477 3300046454 Bacteria 29375
667 Ga0495603_0001659 3300046455 Bacteria 13046
668 Ga0495603_0004325 3300046455 Bacteria 8473
669 Ga0495629_0015731 3300046459 Bacteria 5431
670 Ga0495629_0244840 3300046459 Bacteria 1234
671 Ga0495638_0032968 3300046460 Bacteria 3314
672 Ga0495638_0146501 3300046460 Bacteria 1373
673 Ga0495651_0161867 3300046462 Bacteria 1602
674 Ga0495580_0011691 3300046472 Bacteria 6784
675 Ga0495580_0123323 3300046472 Bacteria 1798
676 Ga0495582_0003787 3300046473 Bacteria 8521
677 Ga0495582_0042988 3300046473 Bacteria 2488
678 Ga0495639_0009431 3300046475 Bacteria 4187
679 Ga0495639_0058898 3300046475 Bacteria 1758
680 Ga0495585_0023997 3300046492 Bacteria 3498
681 Ga0495585_0113881 3300046492 Bacteria 1436
682 Ga0495594_0062838 3300046499 Bacteria 2056
683 Ga0495594_0101364 3300046499 Bacteria 1620
684 Ga0495596_0005892 3300046500 Bacteria 5723
685 Ga0495606_0003543 3300046507 Bacteria 16488
686 Ga0495616_0002509 3300046513 Bacteria 12138
687 Ga0495631_0072644 3300046518 Bacteria 1486
688 Ga0495632_0000326 3300046519 Bacteria 45910
689 Ga0495637_0000299 3300046520 Bacteria 38328
690 Ga0495637_0000636 3300046520 Bacteria 24606
691 Ga0495648_0001787 3300046524 Bacteria 20689
692 Ga0495652_0287261 3300046529 Bacteria 1202
693 Ga0495622_0008847 3300046557 Bacteria 4662
694 Ga0495633_0152413 3300046558 Bacteria 1067
695 Ga0495656_0062004 3300046615 Bacteria 1634
696 Ga0495656_0076095 3300046615 Bacteria 1503
697 Ga0495668_0005067 3300046616 Bacteria 9069
698 Ga0495625_0004643 3300046660 Bacteria 12900
699 Ga0495625_0034589 3300046660 Bacteria 3728
700 Ga0495625_0184301 3300046660 Bacteria 1386
701 Ga0495625_0244662 3300046660 Bacteria 1166
702 Ga0495661_0002717 3300046665 Bacteria 13485
703 Ga0495661_0026583 3300046665 Bacteria 3727
704 Ga0495646_0257242 3300046680 Bacteria 934
705 Ga0495647_0069054 3300046681 Bacteria 1411
706 Ga0495669_0003990 3300046684 Bacteria 6074
707 Ga0495613_0001486 3300046689 Bacteria 17866
708 Ga0495670_0124107 3300046691 Bacteria 1343
709 Ga0495671_0090522 3300046692 Bacteria 1497
710 Ga0495649_0151045 3300046694 Bacteria 1220
711 Ga0495581_0040886 3300047315 Bacteria 2682
712 Ga0495672_0008975 3300047320 Bacteria 7300
713 Ga0495672_0097545 3300047320 Bacteria 1600
714 Ga0495672_0191705 3300047320 Bacteria 1027
715 Ga0495683_0010558 3300047323 Bacteria 4873
716 Ga0495677_0015067 3300047445 Bacteria 2810
717 Ga0495681_0000238 3300047470 Bacteria 45615
718 Ga0495686_0001767 3300047472 Bacteria 22109
719 Ga0495686_0136371 3300047472 Bacteria 1451
720 Ga0495593_0000446 3300047673 Bacteria 23131
721 Ga0495593_0092444 3300047673 Bacteria 1557
722 Ga0495614_0119755 3300048089 Bacteria 1160
723 Ga0496100_0005795 3300048903 Bacteria 6681
724 Ga0496100_0025224 3300048903 Bacteria 3634
725 Ga0496101_0010103 3300048904 Bacteria 6224
726 Ga0496101_0019033 3300048904 Bacteria 4679
727 Ga0496102_0011856 3300048905 Bacteria 7524
728 Ga0496102_0201977 3300048905 Bacteria 1874
729 Ga0496102_0254822 3300048905 Bacteria 1654
730 Ga0496103_0140383 3300048906 Bacteria 1545
731 Ga0496104_0015566 3300048907 Bacteria 6891
732 Ga0496104_0022192 3300048907 Bacteria 5830
733 Ga0496104_0186947 3300048907 Bacteria 1982
734 Ga0496105_0026038 3300048908 Bacteria 4767
735 Ga0496105_0029578 3300048908 Bacteria 4484
736 Ga0496106_0005656 3300048909 Bacteria 9248
737 Ga0496106_0013363 3300048909 Bacteria 6061
738 Ga0496106_0032016 3300048909 Bacteria 3919
739 Ga0496106_0119673 3300048909 Bacteria 2057
740 Ga0496106_0230865 3300048909 Bacteria 1477
741 Ga0496107_0032512 3300048910 Bacteria 3729
742 Ga0496107_0036371 3300048910 Bacteria 3532
743 Ga0496107_0051625 3300048910 Bacteria 2966
744 Ga0496108_0008883 3300048911 Bacteria 8146
745 Ga0496108_0035589 3300048911 Bacteria 4140
746 Ga0496108_0051166 3300048911 Bacteria 3460
747 Ga0496108_0070341 3300048911 Unclassified 2953
748 Ga0496109_0003474 3300048912 Bacteria 13156
749 Ga0496109_0035502 3300048912 Unclassified 4498
750 Ga0496109_0144708 3300048912 Bacteria 2223
751 Ga0496109_0243037 3300048912 Bacteria 1694
752 Ga0496110_0013188 3300048913 Bacteria 6824
753 Ga0496110_0117190 3300048913 Bacteria 2398
754 Ga0496110_0157635 3300048913 Bacteria 2057
755 Ga0496110_0203112 3300048913 Bacteria 1801
756 Ga0496111_0135494 3300048914 Bacteria 1824
757 Ga0496111_0291033 3300048914 Bacteria 1211
758 Ga0496112_0000055 3300048915 Bacteria 78086
759 Ga0496112_0009509 3300048915 Bacteria 8765
760 Ga0496112_0065158 3300048915 Unclassified 3595
761 Ga0496112_0294394 3300048915 Bacteria 1569
762 Ga0496112_0360210 3300048915 Bacteria 1396
763 Ga0496112_0399392 3300048915 Bacteria 1314
764 Ga0496112_0400274 3300048915 Bacteria 1313
765 Ga0496113_0051065 3300048916 Bacteria 3085
766 Ga0496113_0053156 3300048916 Bacteria 3028
767 Ga0496113_0074739 3300048916 Bacteria 2584
768 Ga0496113_0175206 3300048916 Bacteria 1699
769 Ga0496114_0001073 3300048917 Bacteria 20576
770 Ga0496114_0002928 3300048917 Bacteria 13087
771 Ga0496114_0060355 3300048917 Bacteria 3169
772 Ga0496114_0138873 3300048917 Bacteria 2103
773 Ga0496115_0005146 3300048918 Bacteria 9513
774 Ga0496115_0043332 3300048918 Bacteria 3589
775 Ga0496115_0316692 3300048918 Bacteria 1277
776 Ga0496116_0000761 3300048919 Bacteria 40895
777 Ga0496119_0086096 3300048922 Bacteria 1797
778 Ga0496121_0035863 3300048924 Bacteria 4432
779 Ga0496121_0078506 3300048924 Bacteria 2624
780 Ga0496125_0091688 3300048928 Bacteria 2275
781 Ga0496126_0018245 3300048929 Bacteria 6960
782 Ga0496126_0060848 3300048929 Bacteria 3394
783 Ga0496126_0061650 3300048929 Bacteria 3368
784 Ga0496126_0466137 3300048929 Bacteria 1014
785 Ga0501032_0097298 3300049569 Bacteria 1951
786 Ga0501036_0029531 3300049572 Bacteria 4631
787 Ga0501036_0058510 3300049572 Bacteria 3265
788 Ga0501036_0118227 3300049572 Bacteria 2238
789 Ga0501036_0392298 3300049572 Bacteria 1158
790 Ga0501037_0330602 3300049573 Bacteria 1054
791 Ga0501038_0222595 3300049574 Bacteria 1505
792 Ga0501039_0030209 3300049575 Bacteria 4177
793 Ga0501039_0044907 3300049575 Bacteria 3413
794 Ga0501039_0149845 3300049575 Bacteria 1833
795 Ga0501040_0018011 3300049576 Bacteria 4689
796 Ga0501040_0033501 3300049576 Bacteria 3480
797 Ga0501040_0069117 3300049576 Bacteria 2436
798 Ga0501041_0007187 3300049577 Bacteria 6533
799 Ga0501041_0019329 3300049577 Bacteria 4068
800 Ga0501041_0025566 3300049577 Bacteria 3549
801 Ga0501041_0031889 3300049577 Bacteria 3185
802 Ga0501041_0145102 3300049577 Bacteria 1481
803 Ga0501042_0046538 3300049578 Bacteria 3093
804 Ga0501042_0132874 3300049578 Bacteria 1794
805 Ga0501042_0145685 3300049578 Bacteria 1707
806 Ga0501042_0172787 3300049578 Bacteria 1559
807 Ga0501042_0221612 3300049578 Bacteria 1364
808 Ga0501043_0237949 3300049579 Bacteria 1405
809 Ga0501046_0173529 3300049580 Bacteria 1616
810 Ga0501046_0191132 3300049580 Bacteria 1527
811 Ga0501046_0201033 3300049580 Bacteria 1483
812 Ga0501047_0168663 3300049581 Bacteria 2059
813 Ga0501047_0194677 3300049581 Bacteria 1890
814 Ga0501048_0060023 3300049582 Bacteria 2695
815 Ga0501048_0061338 3300049582 Bacteria 2663
816 Ga0501067_0094161 3300049583 Bacteria 1663
817 Ga0501068_0077716 3300049584 Bacteria 2033
818 Ga0501071_0006808 3300049587 Bacteria 7445
819 Ga0501071_0016153 3300049587 Bacteria 5131
820 Ga0501071_0101966 3300049587 Bacteria 2116
821 Ga0501072_0055865 3300049588 Bacteria 3111
822 Ga0501072_0081665 3300049588 Bacteria 2562
823 Ga0501072_0094188 3300049588 Bacteria 2379
824 Ga0501074_0029568 3300049590 Bacteria 3969
825 Ga0501075_0018748 3300049591 Bacteria 5014
826 Ga0501075_0023911 3300049591 Bacteria 4475
827 Ga0501075_0072805 3300049591 Bacteria 2598
828 Ga0501075_0110772 3300049591 Bacteria 2087
829 Ga0501075_0175378 3300049591 Bacteria 1636
830 Ga0501076_0086089 3300049592 Bacteria 2525
831 Ga0501076_0132128 3300049592 Bacteria 2024
832 Ga0501076_0135960 3300049592 Bacteria 1995
833 Ga0501076_0281549 3300049592 Bacteria 1362
834 Ga0501077_0017078 3300049593 Bacteria 4577
835 Ga0501077_0052003 3300049593 Bacteria 2602
836 Ga0501077_0065354 3300049593 Bacteria 2307
837 Ga0501077_0166473 3300049593 Bacteria 1400
838 Ga0501079_0099138 3300049741 Bacteria 2258
839 Ga0501079_0201737 3300049741 Bacteria 1553
840 Ga0501079_0221742 3300049741 Bacteria 1477
841 Ga0501079_0467667 3300049741 Bacteria 991
842 Ga0501081_0019985 3300049743 Bacteria 4463
843 Ga0501081_0042249 3300049743 Bacteria 3123
844 Ga0501083_0076336 3300049744 Bacteria 2224
845 Ga0501035_0083881 3300049822 Bacteria 2811
846 Ga0501045_0018756 3300049824 Bacteria 4924
847 Ga0501045_0020480 3300049824 Bacteria 4725
848 Ga0501045_0032303 3300049824 Bacteria 3793
849 Ga0501045_0046763 3300049824 Bacteria 3151
850 Ga0501045_0082546 3300049824 Bacteria 2370
851 Ga0501045_0210803 3300049824 Bacteria 1447
852 Ga0501045_0246539 3300049824 Bacteria 1330
853 nmdc:mga03683_75246_c1 3300050489 Bacteria 1449
854 nmdc:mga03n38_81441_c1 3300050490 Bacteria 1522
855 nmdc:mga06z11_58418_c1 3300050494 Bacteria 2001
856 nmdc:mga04h51_46251_c1 3300050495 Bacteria 1442
857 nmdc:mga07m45_138574_c1 3300050496 Bacteria 1409
858 nmdc:mga05p37_114611_c1 3300050507 Bacteria 3313
859 nmdc:mga05p37_386924_c1 3300050507 Bacteria 1637
860 nmdc:mga0qj67_61672_c1 3300050509 Bacteria 2977
861 nmdc:mga06r32_219083_c1 3300050510 Bacteria 1891
862 nmdc:mga06r32_264328_c1 3300050510 Bacteria 1708
863 nmdc:mga08y16_121135_c1 3300050511 Bacteria 2722
864 nmdc:mga08y16_1696_c1 3300050511 Bacteria 22329
865 nmdc:mga08y16_20259_c1 3300050511 Bacteria 7019
866 nmdc:mga08y16_380809_c1 3300050511 Bacteria 1119
867 nmdc:mga0n895_142481_c1 3300050512 Bacteria 2426
868 nmdc:mga0n895_163658_c1 3300050512 Bacteria 2256
869 nmdc:mga0n895_396533_c1 3300050512 Bacteria 1396
870 nmdc:mga0sz30_17755_c1 3300050516 Bacteria 2841
871 nmdc:mga0sz30_99433_c1 3300050516 Bacteria 1270
872 Ga0495601_0008374 3300053077 Bacteria 6110
873 Ga0495655_0000348 3300053083 Bacteria 8127
874 Ga0495619_0003178 3300053085 Bacteria 10644
875 Ga0500644_0029153 3300053088 Bacteria 1733
876 Ga0500566_0064629 3300053094 Bacteria 2065
877 Ga0500641_0048888 3300053096 Bacteria 1733
878 Ga0500650_0041975 3300053098 Bacteria 2113
879 Ga0500554_001083 3300053102 Bacteria 5288
880 Ga0500562_019336 3300053108 Bacteria 1762
881 Ga0500595_000726 3300053119 Bacteria 19589
882 Ga0500595_010273 3300053119 Bacteria 3726
883 Ga0500652_114312 3300053131 Bacteria 1128
884 Ga0500559_0033238 3300053136 Bacteria 2220
885 Ga0500568_0026140 3300053139 Bacteria 2452
886 Ga0500568_0037166 3300053139 Bacteria 1977
887 Ga0500568_0040551 3300053139 Bacteria 1873
888 Ga0500603_006267 3300053150 Bacteria 2582
889 Ga0500604_0052160 3300053151 Bacteria 1265
890 Ga0500616_0000028 3300053153 Bacteria 435722
891 Ga0500616_0000964 3300053153 Bacteria 31200
892 Ga0500616_0081393 3300053153 Bacteria 1626
893 Ga0500619_002865 3300053154 Bacteria 3415
894 Ga0500622_0006697 3300053156 Bacteria 6639
895 Ga0500627_0082835 3300053158 Bacteria 1431
896 Ga0500638_008459 3300053162 Bacteria 4389
897 Ga0500636_0066934 3300053177 Bacteria 2088
898 Ga0500637_0000084 3300053178 Bacteria 33745
899 Ga0501084_0011524 3300054114 Bacteria 7322
900 Ga0501084_0078234 3300054114 Bacteria 2772
901 Ga0501084_0175213 3300054114 Bacteria 1810
902 Ga0501084_0272944 3300054114 Bacteria 1428
903 Ga0501084_0386602 3300054114 Bacteria 1182
904 Ga0500661_000602 3300055283 Bacteria 6739
905 Ga0501082_0029246 3300060353 Bacteria 4745
906 Ga0501082_0049411 3300060353 Bacteria 3627
907 Ga0501082_0061696 3300060353 Bacteria 3227
908 Ga0501082_0126941 3300060353 Bacteria 2212
909 Ga0501082_0169902 3300060353 Bacteria 1895
910 Ga0466962_0002323 3300061719 Bacteria 9011
911 Ga0530510_0015111 3300061734 Bacteria 5453
912 Ga0530510_0026282 3300061734 Bacteria 4166
913 Ga0530510_0097764 3300061734 Bacteria 2146
914 Ga0530510_0139829 3300061734 Bacteria 1783
915 Ga0530510_0244270 3300061734 Bacteria 1337
916 2511412531 2511231031 Bacteria 6558529
917 2513697397 2513237101 Bacteria 7952346
918 2524534453 2524023228 Bacteria 10118060
919 2723843112 2721755755 Bacteria 8322773
920 2793071181 2791355197 Bacteria 8420563
921 2793079481
922 2874612556 2874604998 Bacteria 7834745
923 2876813749 2876808645 Bacteria 8824342
924 2879118002 2879110137 Bacteria 8907982
925 2889033587 2889033259 Bacteria 9099371
926 2904705749
927 2906611430
928 2909044149 2909042592 Bacteria 6499737
929 2922366957 2922361189 Bacteria 7436256
930 2922390266 2922386360 Bacteria 7017218
931 2922427928
932 2928535604 2928531327 Bacteria 5101314
933 8002061099 8002060224 Bacteria 4026565
934 8006966492 8006964411 Bacteria 8966052
935 8006989318 8006984368 Bacteria 9651211
936 8006997802 8006994254 Bacteria 8309700
937 8019559510 8019555841 Bacteria 9642137
938 8019569613 8019565922 Bacteria 9639779
939 8056570726 8056569372 Bacteria 5997322
940 8056674837 8056673599 Bacteria 7871253
941 Ga0070683_100091044
942 MBSR1b_contig_4107868
943 JGI24737J22298_10066822
944 JGI24748J21848_1003601
945 JGI24751J29686_10011764
946 JGI25406J46586_10000168
947 JGI25406J46586_10015153
948 JGI25153J46596_10005034
949 rootH1_10148202
950 JGI25404J52841_10003367
951 Ga0065165_1005839
952 Ga0065715_10149744
953 Ga0070658_10007026
954 Ga0070658_10074612
955 Ga0070676_10000177
956 Ga0070676_10006855
957 Ga0070676_10183365
958 Ga0070683_100003236
959 Ga0070683_100098872
960 Ga0070690_100000161
961 Ga0070690_100020167
962 Ga0070690_100251059
963 Ga0070690_100259359
964 Ga0070670_100017668
965 Ga0070670_100034365
966 Ga0070677_10011383
967 Ga0070677_10047505
968 Ga0068869_100001688
969 Ga0068869_100004961
970 Ga0068869_100075691
971 Ga0068869_100239963
972 Ga0068869_100387811
973 Ga0070666_10000673
974 Ga0070666_10028516
975 Ga0070666_10035673
976 Ga0070680_100071083
977 Ga0070680_100078816
978 Ga0070680_100171282
979 Ga0070682_100065884
980 Ga0068868_100005707
981 Ga0068868_100017937
982 Ga0068868_100098697
983 Ga0068868_100153156
984 Ga0070660_100000841
985 Ga0070660_100483122
986 Ga0070660_100512165
987 Ga0070689_100000709
988 Ga0070689_100016859
989 Ga0070689_100269226
990 Ga0070691_10146074
991 Ga0070687_100000011
992 Ga0070687_100034677
993 Ga0070687_100039822
994 Ga0070661_100001135
995 Ga0070661_100006263
996 Ga0070661_100077201
997 Ga0070661_100105908
998 Ga0070692_10132575
999 Ga0070668_100005064
1000 Ga0070668_100293763
1001 Ga0070668_100551171
1002 Ga0070669_100006355
1003 Ga0070669_100014101
1004 Ga0070675_100000821
1005 Ga0070675_100002151
1006 Ga0070675_100170775
1007 Ga0070675_100314828
1008 Ga0070671_100001021
1009 Ga0070674_100002542
1010 Ga0070674_100003166
1011 Ga0070674_100182181
1012 Ga0070674_100302054
1013 Ga0070673_100003576
1014 Ga0070673_100005261
1015 Ga0070688_100001830
1016 Ga0070688_100332909
1017 Ga0070659_100000150
1018 Ga0070659_100378629
1019 Ga0070667_100005396
1020 Ga0070667_100115137
1021 Ga0070709_10071872
1022 Ga0070714_100435311
1023 Ga0070713_100217617
1024 Ga0070701_10002949
1025 Ga0070701_10035114
1026 Ga0070711_100062091
1027 Ga0070705_100000387
1028 Ga0070694_100182487
1029 Ga0070694_100345984
1030 Ga0070663_100000694
1031 Ga0070663_100013602
1032 Ga0070663_100056093
1033 Ga0070663_100065062
1034 Ga0070663_100097899
1035 Ga0070663_100159847
1036 Ga0070663_100161774
1037 Ga0070663_100222666
1038 Ga0070678_100022351
1039 Ga0070678_100024393
1040 Ga0070678_100042538
1041 Ga0070678_100153543
1042 Ga0070678_100485616
1043 Ga0070678_100585302
1044 Ga0070662_100000201
1045 Ga0070662_100015950
1046 Ga0070662_100022033
1047 Ga0070681_10030752
1048 Ga0070681_10237815
1049 Ga0068867_100000832
1050 Ga0068867_100156807
1051 Ga0070685_10003362
1052 Ga0070685_10044247
1053 Ga0070706_100256463
1054 Ga0070707_100423860
1055 Ga0070699_100036589
1056 Ga0070699_100079053
1057 Ga0070699_100192435
1058 Ga0070679_100022047
1059 Ga0070679_100068280
1060 Ga0070684_100036825
1061 Ga0068853_100005121
1062 Ga0068853_100358276
1063 Ga0068853_100435278
1064 Ga0070672_100003813
1065 Ga0070672_100010911
1066 Ga0070672_100045754
1067 Ga0070686_100001626
1068 Ga0070686_100082537
1069 Ga0070686_100246696
1070 Ga0070695_100046693
1071 Ga0070695_100055370
1072 Ga0070696_100067161
1073 Ga0070693_100017104
1074 Ga0070693_100027832
1075 Ga0070693_100027871
1076 Ga0070693_100031872
1077 Ga0070693_100068195
1078 Ga0070693_100112553
1079 Ga0070665_100020348
1080 Ga0070665_100023807
1081 Ga0070665_100032508
1082 Ga0070665_100177036
1083 Ga0070665_100488953
1084 Ga0070665_100641719
1085 Ga0070704_100048327
1086 Ga0068855_100007063
1087 Ga0068855_100013690
1088 Ga0068855_100019007
1089 Ga0068855_100054408
1090 Ga0068855_100061422
1091 Ga0068855_100119768
1092 Ga0068855_100184199
1093 Ga0070664_100000409
1094 Ga0070664_100011714
1095 Ga0070664_100031009
1096 Ga0070664_100124158
1097 Ga0068857_100000045
1098 Ga0068857_100019250
1099 Ga0068857_100165300
1100 Ga0068857_100264293
1101 Ga0068854_100000943
1102 Ga0068854_100004958
1103 Ga0068854_100377213
1104 Ga0068856_100000969
1105 Ga0068856_100070577
1106 Ga0068856_100110301
1107 Ga0068856_100331805
1108 Ga0070702_100074559
1109 Ga0070702_100087054
1110 Ga0070702_100107814
1111 Ga0070702_100188045
1112 Ga0070702_100322842
1113 Ga0068852_100010493
1114 Ga0068852_100022851
1115 Ga0068852_100073144
1116 Ga0068852_100287366
1117 Ga0068852_100740716
1118 Ga0068852_100745225
1119 Ga0068859_100002138
1120 Ga0068859_100006419
1121 Ga0068859_100187733
1122 Ga0068864_100001397
1123 Ga0068864_100034925
1124 Ga0068864_100092449
1125 Ga0068866_10001396
1126 Ga0068866_10067040
1127 Ga0068861_100000449
1128 Ga0068861_100059201
1129 Ga0068861_100200551
1130 Ga0068851_10002385
1131 Ga0068870_10000840
1132 Ga0068870_10159417
1133 Ga0068863_100004325
1134 Ga0068863_100216746
1135 Ga0068858_100002574
1136 Ga0068858_100020070
1137 Ga0068858_100042918
1138 Ga0068858_100053290
1139 Ga0068858_100356005
1140 Ga0068860_100006384
1141 Ga0068860_100068705
1142 Ga0068860_100160156
1143 Ga0068860_100194817
1144 Ga0068860_100205880
1145 Ga0068860_100397843
1146 Ga0068862_100003062
1147 Ga0068862_100135682
1148 Ga0081455_10001565
1149 Ga0081455_10004842
1150 Ga0081455_10005486
1151 Ga0081455_10023977
1152 Ga0081455_10025617
1153 Ga0081455_10109038
1154 Ga0081538_10051765
1155 Ga0081540_1000076
1156 Ga0081540_1000083
1157 Ga0081540_1000780
1158 Ga0081540_1001934
1159 Ga0081540_1002260
1160 Ga0081540_1004844
1161 Ga0081540_1006350
1162 Ga0081540_1006556
1163 Ga0081540_1042269
1164 Ga0081539_10000040
1165 Ga0081539_10002516
1166 Ga0081539_10052497
1167 Ga0075365_10065664
1168 Ga0075365_10107719
1169 Ga0075368_10012932
1170 Ga0075363_100213502
1171 Ga0070716_100313125
1172 Ga0070712_100017293
1173 Ga0075369_10012643
1174 Ga0075366_10193729
1175 Ga0097621_100013398
1176 Ga0097621_100059494
1177 Ga0097621_100124098
1178 Ga0068871_100002264
1179 Ga0075428_100181146
1180 Ga0075428_100211480
1181 Ga0075430_100048637
1182 Ga0075431_100166626
1183 Ga0075433_10423792
1184 Ga0075434_100150993
1185 Ga0075434_100282382
1186 Ga0075434_100308820
1187 Ga0068865_100000468
1188 Ga0068865_100006360
1189 Ga0068865_100009816
1190 Ga0068865_100127092
1191 Ga0068865_100391653
1192 Ga0097620_100002138
1193 Ga0097620_100006418
1194 Ga0097620_100187745
1195 Ga0099794_10002060
1196 Ga0099795_10105581
1197 Ga0105240_10000911
1198 Ga0105240_10007148
1199 Ga0105240_10040900
1200 Ga0105240_10043796
1201 Ga0105240_10348608
1202 Ga0111539_10005949
1203 Ga0111539_10034475
1204 Ga0111539_10233241
1205 Ga0111539_10292188
1206 Ga0105245_10000110
1207 Ga0105245_10048588
1208 Ga0105245_10341805
1209 Ga0105247_10000779
1210 Ga0105247_10085085
1211 Ga0105247_10292969
1212 Ga0114129_10079787
1213 Ga0114129_10337361
1214 Ga0105243_10001825
1215 Ga0105243_10331838
1216 Ga0105241_10000441
1217 Ga0105241_10016275
1218 Ga0105241_10045394
1219 Ga0105241_10245421
1220 Ga0105242_10003699
1221 Ga0105242_10007991
1222 Ga0105242_10016771
1223 Ga0105242_10084280
1224 Ga0105248_10007983
1225 Ga0105248_10008973
1226 Ga0105248_10132530
1227 Ga0105248_10356813
1228 Ga0105237_10004354
1229 Ga0105237_10016097
1230 Ga0105237_10034338
1231 Ga0105237_10038469
1232 Ga0105237_10152385
1233 Ga0105237_10548970
1234 Ga0105237_10610675
1235 Ga0105238_10000246
1236 Ga0105238_10037628
1237 Ga0105238_10045861
1238 Ga0105238_10057078
1239 Ga0105238_10218265
1240 Ga0105238_10678085
1241 Ga0105249_10001617
1242 Ga0105249_10005056
1243 Ga0105249_10056577
1244 Ga0105249_10381216
1245 Ga0105239_10025154
1246 Ga0105239_10039281
1247 Ga0105239_10039841
1248 Ga0105239_10080411
1249 Ga0105239_10137433
1250 Ga0105239_10286555
1251 Ga0105239_10287340
1252 Ga0105246_10042417
1253 Ga0105246_10079100
1254 Ga0157335_1000837
1255 Ga0157326_1008196
1256 Ga0157373_10004358
1257 Ga0157373_10327913
1258 Ga0157371_10006096
1259 Ga0157371_10150770
1260 Ga0157370_10011316
1261 Ga0157370_10062592
1262 Ga0157369_10012527
1263 Ga0157369_10177141
1264 Ga0157374_10000113
1265 Ga0157374_10011568
1266 Ga0157374_10058276
1267 Ga0157374_10081673
1268 Ga0157374_10366504
1269 Ga0157378_10011085
1270 Ga0157378_10026784
1271 Ga0157378_10034001
1272 Ga0157378_10094564
1273 Ga0157378_10348838
1274 Ga0163162_10000617
1275 Ga0163162_10064022
1276 Ga0163162_10179442
1277 Ga0163162_10388730
1278 Ga0163162_10576566
1279 Ga0157372_10007152
1280 Ga0157372_10050625
1281 Ga0157372_10333153
1282 Ga0157375_10001209
1283 Ga0157375_10001227
1284 Ga0157375_10007526
1285 Ga0157375_10013332
1286 Ga0157375_10077771
1287 Ga0157375_10206394
1288 Ga0163163_10013878
1289 Ga0163163_10032740
1290 Ga0163163_10049458
1291 Ga0163163_10063508
1292 Ga0157380_10029092
1293 Ga0157380_10085162
1294 Ga0157380_10110506
1295 Ga0157380_10116556
1296 Ga0157380_10186199
1297 Ga0157377_10000265
1298 Ga0157379_10000775
1299 Ga0157379_10024010
1300 Ga0157379_10073293
1301 Ga0157379_10355004
1302 Ga0157379_10439438
1303 Ga0157376_10001710
1304 Ga0157376_10016754
1305 Ga0157376_10113593
1306 Ga0209758_1006284
1307 Ga0209758_1006935
1308 Ga0207697_10000147
1309 Ga0207656_10000871
1310 Ga0207655_1017118
1311 Ga0207682_10011662
1312 Ga0207692_10046815
1313 Ga0207642_10061668
1314 Ga0207642_10320096
1315 Ga0207710_10016717
1316 Ga0207688_10000086
1317 Ga0207688_10009671
1318 Ga0207680_10004502
1319 Ga0207680_10064647
1320 Ga0207680_10138589
1321 Ga0207647_10002419
1322 Ga0207647_10138492
1323 Ga0207645_10000006
1324 Ga0207645_10010075
1325 Ga0207645_10023160
1326 Ga0207643_10000019
1327 Ga0207643_10074115
1328 Ga0207705_10007653
1329 Ga0207654_10001653
1330 Ga0207654_10071490
1331 Ga0207654_10295373
1332 Ga0207707_10025800
1333 Ga0207707_10305510
1334 Ga0207695_10004251
1335 Ga0207695_10040274
1336 Ga0207695_10113566
1337 Ga0207671_10007024
1338 Ga0207671_10190124
1339 Ga0207671_10216966
1340 Ga0207693_10085746
1341 Ga0207660_10054655
1342 Ga0207662_10000002
1343 Ga0207662_10008870
1344 Ga0207662_10060786
1345 Ga0207657_10000007
1346 Ga0207657_10410742
1347 Ga0207649_10002537
1348 Ga0207649_10002680
1349 Ga0207649_10008104
1350 Ga0207652_10176872
1351 Ga0207652_10289641
1352 Ga0207646_10131038
1353 Ga0207681_10001798
1354 Ga0207681_10151091
1355 Ga0207681_10349804
1356 Ga0207694_10024306
1357 Ga0207650_10000109
1358 Ga0207650_10104192
1359 Ga0207659_10001567
1360 Ga0207659_10031235
1361 Ga0207659_10124561
1362 Ga0207687_10004863
1363 Ga0207687_10091805
1364 Ga0207687_10136303
1365 Ga0207644_10000618
1366 Ga0207690_10063101
1367 Ga0207690_10236481
1368 Ga0207706_10000066
1369 Ga0207706_10002627
1370 Ga0207706_10008600
1371 Ga0207706_10013775
1372 Ga0207706_10314679
1373 Ga0207686_10003515
1374 Ga0207686_10017329
1375 Ga0207709_10008078
1376 Ga0207709_10245453
1377 Ga0207709_10319731
1378 Ga0207709_10442794
1379 Ga0207670_10004848
1380 Ga0207670_10043926
1381 Ga0207670_10054504
1382 Ga0207669_10000286
1383 Ga0207669_10004441
1384 Ga0207669_10025214
1385 Ga0207669_10029792
1386 Ga0207669_10197430
1387 Ga0207669_10288491
1388 Ga0207704_10001245
1389 Ga0207704_10018911
1390 Ga0207704_10048601
1391 Ga0207704_10097094
1392 Ga0207704_10471942
1393 Ga0207665_10009471
1394 Ga0207691_10000628
1395 Ga0207691_10026799
1396 Ga0207691_10031739
1397 Ga0207691_10599668
1398 Ga0207711_10000065
1399 Ga0207711_10001337
1400 Ga0207711_10023085
1401 Ga0207711_10041147
1402 Ga0207711_10204698
1403 Ga0207689_10000070
1404 Ga0207689_10005212
1405 Ga0207689_10024310
1406 Ga0207661_10051220
1407 Ga0207661_10086145
1408 Ga0207679_10000192
1409 Ga0207679_10002439
1410 Ga0207679_10023667
1411 Ga0207679_10043202
1412 Ga0207679_10270026
1413 Ga0207667_10000244
1414 Ga0207667_10006665
1415 Ga0207667_10168344
1416 Ga0207651_10002235
1417 Ga0207651_10005114
1418 Ga0207712_10000421
1419 Ga0207712_10006564
1420 Ga0207712_10046748
1421 Ga0207712_10091256
1422 Ga0207668_10040849
1423 Ga0207668_10242019
1424 Ga0207668_10358634
1425 Ga0207640_10000169
1426 Ga0207640_10002086
1427 Ga0207658_10010070
1428 Ga0207658_10026952
1429 Ga0207658_10130696
1430 Ga0207658_10291383
1431 Ga0207677_10000187
1432 Ga0207677_10008792
1433 Ga0207677_10306387
1434 Ga0207703_10000102
1435 Ga0207703_10005716
1436 Ga0207703_10018789
1437 Ga0207703_10053526
1438 Ga0207703_10406349
1439 Ga0207703_10416604
1440 Ga0207703_10451457
1441 Ga0207639_10002412
1442 Ga0207639_10168687
1443 Ga0207678_10001138
1444 Ga0207678_10014007
1445 Ga0207678_10029116
1446 Ga0207678_10122751
1447 Ga0207678_10229069
1448 Ga0207708_10014035
1449 Ga0207708_10544529
1450 Ga0207702_10058029
1451 Ga0207702_10102076
1452 Ga0207702_10166680
1453 Ga0207702_10267828
1454 Ga0207641_10024778
1455 Ga0207641_10108912
1456 Ga0207641_10168360
1457 Ga0207648_10000099
1458 Ga0207648_10001481
1459 Ga0207648_10328994
1460 Ga0207648_10425335
1461 Ga0207676_10003294
1462 Ga0207676_10090503
1463 Ga0207674_10000030
1464 Ga0207674_10009990
1465 Ga0207674_10020542
1466 Ga0207674_10100456
1467 Ga0207675_100000007
1468 Ga0207675_100092540
1469 Ga0207675_100207607
1470 Ga0207683_10000688
1471 Ga0207683_10008652
1472 Ga0207683_10028448
1473 Ga0207683_10063460
1474 Ga0207683_10116730
1475 Ga0207683_10218267
1476 Ga0207683_10271848
1477 Ga0207698_10063176
1478 Ga0207698_10097833
1479 Ga0207698_10242596
1480 Ga0209588_1031900
1481 Ga0209998_10011711
1482 Ga0207428_10012161
1483 Ga0265356_1002334
1484 Ga0268266_10000397
1485 Ga0268266_10002092
1486 Ga0268266_10011766
1487 Ga0268266_10051335
1488 Ga0268266_10136923
1489 Ga0268265_10041140
1490 Ga0268265_10173213
1491 Ga0268265_10187328
1492 Ga0268265_10357673
1493 Ga0268265_10436587
1494 Ga0268264_10000804
1495 Ga0268264_10007291
1496 Ga0268264_10016086
1497 Ga0268264_10287733
1498 Ga0265337_1012313
1499 Ga0265326_10019538
1500 Ga0265319_1008249
1501 Ga0265334_10003965
1502 Ga0265318_10007905
1503 Ga0265323_10000311
1504 Ga0265322_10004519
1505 Ga0265336_10000074
1506 Ga0307517_10000085
1507 Ga0307517_10074853
1508 Ga0307515_10059363
1509 Ga0265338_10000137
1510 Ga0265324_10000684
1511 Ga0307512_10038614
1512 Ga0265332_10001022
1513 Ga0265328_10000061
1514 Ga0265328_10000305
1515 Ga0265328_10016966
1516 Ga0265328_10127456
1517 Ga0265320_10025025
1518 Ga0265329_10005533
1519 Ga0265329_10007066
1520 Ga0265340_10111001
1521 Ga0265331_10001445
1522 Ga0265331_10001600
1523 Ga0265327_10013516
1524 Ga0265327_10016623
1525 Ga0265316_10001750
1526 Ga0265316_10003254
1527 Ga0307513_10034291
1528 Ga0307509_10003945
1529 Ga0307509_10291622
1530 Ga0307508_10267428
1531 Ga0307514_10056229
1532 Ga0316575_10065222
1533 Ga0265314_10003069
1534 Ga0265342_10117254
1535 Ga0316576_10019077
1536 Ga0307516_10285369
1537 Ga0307405_10200013
1538 Ga0307518_10086710
1539 Ga0307406_10083326
1540 Ga0307406_10192287
1541 Ga0307406_10226588
1542 Ga0307414_10372349
1543 Ga0307415_100160411
1544 Ga0307510_10000779
1545 Ga0307510_10007951
1546 Ga0307510_10011080
1547 Ga0373930_0003689
1548 Ga0316574_0000392
1549 Ga0316574_0048385
1550 Ga0373931_0014394
1551 Ga0373931_0066820
1552 Ga0373931_0084598
1553 Ga0373927_0018763
1554 Ga0373927_0038026
1555 Ga0373927_0136066
1556 Ga0373927_0172204
1557 Ga0373947_0001290
1558 Ga0373947_0348930
1559 Ga0373937_0146484
1560 Ga0316582_0047808
1561 Ga0395898_0039339
1562 Ga0395898_0131235
1563 Ga0395905_0029346
1564 Ga0316581_0013616
1565 Ga0395901_0067826
1566 Ga0400487_40084
1567 Ga0436363_0046265
1568 Ga0439465_0099112
1569 Ga0451793_1474675
1570 Ga0439448_0016450
1571 Ga0439459_0010244
1572 Ga0451577_0006026
1573 Ga0451577_0037073
1574 Ga0451577_0067510
1575 Ga0451577_0084294
1576 Ga0466972_0000303
1577 Ga0466972_0011092
1578 Ga0453683_0010984
1579 Ga0453683_0062673
1580 Ga0453683_0062726
1581 Ga0453683_0319146
1582 Ga0466965_0046472
1583 Ga0466966_0001947
1584 Ga0466966_0008904
1585 Ga0466961_0028359
1586 Ga0466964_0004069
1587 Ga0453684_0006586
1588 Ga0453684_0006667
1589 Ga0453684_0010078
1590 Ga0453684_0084806
1591 Ga0453684_0092451
1592 Ga0453684_0115171
1593 Ga0453684_0848870
1594 Ga0466971_0016619
1595 Ga0466970_0025629
1596 Ga0466970_0026243
1597 Ga0466957_0114111
1598 Ga0466960_0079810
1599 Ga0466959_0000006
1600 Ga0451576_0002250
1601 Ga0451576_0059005
1602 Ga0466958_0020205
1603 Ga0466958_0179957
1604 Ga0495617_002531
1605 Ga0495627_000264
1606 Ga0495592_0000477
1607 Ga0495603_0001659
1608 Ga0495603_0004325
1609 Ga0495629_0015731
1610 Ga0495629_0244840
1611 Ga0495638_0032968
1612 Ga0495638_0146501
1613 Ga0495651_0161867
1614 Ga0495580_0011691
1615 Ga0495580_0123323
1616 Ga0495582_0003787
1617 Ga0495582_0042988
1618 Ga0495639_0009431
1619 Ga0495639_0058898
1620 Ga0495585_0023997
1621 Ga0495585_0113881
1622 Ga0495594_0062838
1623 Ga0495594_0101364
1624 Ga0495596_0005892
1625 Ga0495606_0003543
1626 Ga0495616_0002509
1627 Ga0495631_0072644
1628 Ga0495632_0000326
1629 Ga0495637_0000299
1630 Ga0495637_0000636
1631 Ga0495648_0001787
1632 Ga0495652_0287261
1633 Ga0495622_0008847
1634 Ga0495633_0152413
1635 Ga0495656_0062004
1636 Ga0495656_0076095
1637 Ga0495668_0005067
1638 Ga0495625_0004643
1639 Ga0495625_0034589
1640 Ga0495625_0184301
1641 Ga0495625_0244662
1642 Ga0495661_0002717
1643 Ga0495661_0026583
1644 Ga0495646_0257242
1645 Ga0495647_0069054
1646 Ga0495669_0003990
1647 Ga0495613_0001486
1648 Ga0495670_0124107
1649 Ga0495671_0090522
1650 Ga0495649_0151045
1651 Ga0495581_0040886
1652 Ga0495672_0008975
1653 Ga0495672_0097545
1654 Ga0495672_0191705
1655 Ga0495683_0010558
1656 Ga0495677_0015067
1657 Ga0495681_0000238
1658 Ga0495686_0001767
1659 Ga0495686_0136371
1660 Ga0495593_0000446
1661 Ga0495593_0092444
1662 Ga0495614_0119755
1663 Ga0496100_0005795
1664 Ga0496100_0025224
1665 Ga0496101_0010103
1666 Ga0496101_0019033
1667 Ga0496102_0011856
1668 Ga0496102_0201977
1669 Ga0496102_0254822
1670 Ga0496103_0140383
1671 Ga0496104_0015566
1672 Ga0496104_0022192
1673 Ga0496104_0186947
1674 Ga0496105_0026038
1675 Ga0496105_0029578
1676 Ga0496106_0005656
1677 Ga0496106_0013363
1678 Ga0496106_0032016
1679 Ga0496106_0119673
1680 Ga0496106_0230865
1681 Ga0496107_0032512
1682 Ga0496107_0036371
1683 Ga0496107_0051625
1684 Ga0496108_0008883
1685 Ga0496108_0035589
1686 Ga0496108_0051166
1687 Ga0496108_0070341
1688 Ga0496109_0003474
1689 Ga0496109_0035502
1690 Ga0496109_0144708
1691 Ga0496109_0243037
1692 Ga0496110_0013188
1693 Ga0496110_0117190
1694 Ga0496110_0157635
1695 Ga0496110_0203112
1696 Ga0496111_0135494
1697 Ga0496111_0291033
1698 Ga0496112_0000055
1699 Ga0496112_0009509
1700 Ga0496112_0065158
1701 Ga0496112_0294394
1702 Ga0496112_0360210
1703 Ga0496112_0399392
1704 Ga0496112_0400274
1705 Ga0496113_0051065
1706 Ga0496113_0053156
1707 Ga0496113_0074739
1708 Ga0496113_0175206
1709 Ga0496114_0001073
1710 Ga0496114_0002928
1711 Ga0496114_0060355
1712 Ga0496114_0138873
1713 Ga0496115_0005146
1714 Ga0496115_0043332
1715 Ga0496115_0316692
1716 Ga0496116_0000761
1717 Ga0496119_0086096
1718 Ga0496121_0035863
1719 Ga0496121_0078506
1720 Ga0496125_0091688
1721 Ga0496126_0018245
1722 Ga0496126_0060848
1723 Ga0496126_0061650
1724 Ga0496126_0466137
1725 Ga0501032_0097298
1726 Ga0501036_0029531
1727 Ga0501036_0058510
1728 Ga0501036_0118227
1729 Ga0501036_0392298
1730 Ga0501037_0330602
1731 Ga0501038_0222595
1732 Ga0501039_0030209
1733 Ga0501039_0044907
1734 Ga0501039_0149845
1735 Ga0501040_0018011
1736 Ga0501040_0033501
1737 Ga0501040_0069117
1738 Ga0501041_0007187
1739 Ga0501041_0019329
1740 Ga0501041_0025566
1741 Ga0501041_0031889
1742 Ga0501041_0145102
1743 Ga0501042_0046538
1744 Ga0501042_0132874
1745 Ga0501042_0145685
1746 Ga0501042_0172787
1747 Ga0501042_0221612
1748 Ga0501043_0237949
1749 Ga0501046_0173529
1750 Ga0501046_0191132
1751 Ga0501046_0201033
1752 Ga0501047_0168663
1753 Ga0501047_0194677
1754 Ga0501048_0060023
1755 Ga0501048_0061338
1756 Ga0501067_0094161
1757 Ga0501068_0077716
1758 Ga0501071_0006808
1759 Ga0501071_0016153
1760 Ga0501071_0101966
1761 Ga0501072_0055865
1762 Ga0501072_0081665
1763 Ga0501072_0094188
1764 Ga0501074_0029568
1765 Ga0501075_0018748
1766 Ga0501075_0023911
1767 Ga0501075_0072805
1768 Ga0501075_0110772
1769 Ga0501075_0175378
1770 Ga0501076_0086089
1771 Ga0501076_0132128
1772 Ga0501076_0135960
1773 Ga0501076_0281549
1774 Ga0501077_0017078
1775 Ga0501077_0052003
1776 Ga0501077_0065354
1777 Ga0501077_0166473
1778 Ga0501079_0099138
1779 Ga0501079_0201737
1780 Ga0501079_0221742
1781 Ga0501079_0467667
1782 Ga0501081_0019985
1783 Ga0501081_0042249
1784 Ga0501083_0076336
1785 Ga0501035_0083881
1786 Ga0501045_0018756
1787 Ga0501045_0020480
1788 Ga0501045_0032303
1789 Ga0501045_0046763
1790 Ga0501045_0082546
1791 Ga0501045_0210803
1792 Ga0501045_0246539
1793 nmdc:mga03683_75246_c1
1794 nmdc:mga03n38_81441_c1
1795 nmdc:mga06z11_58418_c1
1796 nmdc:mga04h51_46251_c1
1797 nmdc:mga07m45_138574_c1
1798 nmdc:mga05p37_114611_c1
1799 nmdc:mga05p37_386924_c1
1800 nmdc:mga0qj67_61672_c1
1801 nmdc:mga06r32_219083_c1
1802 nmdc:mga06r32_264328_c1
1803 nmdc:mga08y16_121135_c1
1804 nmdc:mga08y16_1696_c1
1805 nmdc:mga08y16_20259_c1
1806 nmdc:mga08y16_380809_c1
1807 nmdc:mga0n895_142481_c1
1808 nmdc:mga0n895_163658_c1
1809 nmdc:mga0n895_396533_c1
1810 nmdc:mga0sz30_17755_c1
1811 nmdc:mga0sz30_99433_c1
1812 Ga0495601_0008374
1813 Ga0495655_0000348
1814 Ga0495619_0003178
1815 Ga0500644_0029153
1816 Ga0500566_0064629
1817 Ga0500641_0048888
1818 Ga0500650_0041975
1819 Ga0500554_001083
1820 Ga0500562_019336
1821 Ga0500595_000726
1822 Ga0500595_010273
1823 Ga0500652_114312
1824 Ga0500559_0033238
1825 Ga0500568_0026140
1826 Ga0500568_0037166
1827 Ga0500568_0040551
1828 Ga0500603_006267
1829 Ga0500604_0052160
1830 Ga0500616_0000028
1831 Ga0500616_0000964
1832 Ga0500616_0081393
1833 Ga0500619_002865
1834 Ga0500622_0006697
1835 Ga0500627_0082835
1836 Ga0500638_008459
1837 Ga0500636_0066934
1838 Ga0500637_0000084
1839 Ga0501084_0011524
1840 Ga0501084_0078234
1841 Ga0501084_0175213
1842 Ga0501084_0272944
1843 Ga0501084_0386602
1844 Ga0500661_000602
1845 Ga0501082_0029246
1846 Ga0501082_0049411
1847 Ga0501082_0061696
1848 Ga0501082_0126941
1849 Ga0501082_0169902
1850 Ga0466962_0002323
1851 Ga0530510_0015111
1852 Ga0530510_0026282
1853 Ga0530510_0097764
1854 Ga0530510_0139829
1855 Ga0530510_0244270
1856 2511412531
1857 2513697397
1858 2524534453
1859 2723843112
1860 2793071181
1861 2793079481
1862 2874612556
1863 2876813749
1864 2879118002
1865 2889033587
1866 2904705749
1867 2906611430
1868 2909044149
1869 2922366957
1870 2922390266
1871 2922427928
1872 2928535604
1873 8002061099
1874 8006966492
1875 8006989318
1876 8006997802
1877 8019559510
1878 8019569613
1879 8056570726
1880 8056674837

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

4

265

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.9185 5 274
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.8804 5 274
7tcx-assembly1.cif.gz_A methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b at 2.21 angstrom resolution 0.8421 6 266
7tcw-assembly2.cif.gz_B methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b, h210s mutant 0.8415 6 266
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8379 6 266
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9226 3 274 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8938 3 274 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6832 7 267 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6739 7 267 3.20.20.150
af_P50525_6_280_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6596 12 266 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A535A888-F1-model_v4 DUF692 domain-containing protein 0.9912 197 275
AF-A0A534I5P5-F1-model_v4 UPF0276 protein E6K21_11310 0.9867 3 274
AF-A0A2H5ZIT0-F1-model_v4 UPF0276 protein HRbin30_00920 0.9858 2 275
AF-A0A1A8XYK4-F1-model_v4 Uncharacterized protein 0.9846 163 275
AF-A0A2Z3KPT7-F1-model_v4 deleted 0.9836 3 275

Map