F486304
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 419 | 1880 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100091044|Ga0070683_1000910441 |
| Length | 278 |
| Sequence | MIRGFGLGLRPEHYRDFAQGAAAVDWLEILTENYLVPGGKPLDYLDRIRARYPVAMHGVSLSIAGESLDPEYLKQLEALARRVQPAWISDHLCWTGVGGRNLHDLLPIPFTAEALRHVAGRVGRVQDRLRRPLVLENVSSYVRMAEDEMTEWEFLRELVRRSGCELLLDVNNVYVNAVNHRFDARAFIDALPPQAIRQIHLAGHTDNGDHLVDTHDSPVCEAVWELYEHAVARFGPVPTMIERDDAIPPLAELVSELDIARRRAERALRSRTADALAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 117 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 227 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 252 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 376 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 377 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 379 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 395 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 396 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 397 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 398 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 399 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 400 | 2791355199 | |||
| 401 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 402 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 403 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 404 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 405 | 2904699407 | |||
| 406 | 2906610324 | |||
| 407 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 408 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 409 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 410 | 2922425934 | |||
| 411 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 412 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 413 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 414 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 415 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 416 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 417 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 418 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 419 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.76 |
| Metatranscriptomes | 0 |
| Isolates | 2.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.47 |
| Nodule | 1.6 |
| Rhizoplane | 5.74 |
| Rhizosphere | 84.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100091044 | 3300005329 | Bacteria | 2864 |
| 2 | MBSR1b_contig_4107868 | 2162886012 | Bacteria | 1120 |
| 3 | JGI24737J22298_10066822 | 3300001990 | Bacteria | 1076 |
| 4 | JGI24748J21848_1003601 | 3300002074 | Bacteria | 1771 |
| 5 | JGI24751J29686_10011764 | 3300002459 | Bacteria | 1805 |
| 6 | JGI25406J46586_10000168 | 3300003203 | Bacteria | 29130 |
| 7 | JGI25406J46586_10015153 | 3300003203 | Bacteria | 3258 |
| 8 | JGI25153J46596_10005034 | 3300003215 | Bacteria | 6990 |
| 9 | rootH1_10148202 | 3300003323 | Bacteria | 3457 |
| 10 | JGI25404J52841_10003367 | 3300003659 | Bacteria | 3152 |
| 11 | Ga0065165_1005839 | 3300005262 | Bacteria | 6705 |
| 12 | Ga0065715_10149744 | 3300005293 | Bacteria | 1743 |
| 13 | Ga0070658_10007026 | 3300005327 | Bacteria | 9088 |
| 14 | Ga0070658_10074612 | 3300005327 | Bacteria | 2782 |
| 15 | Ga0070676_10000177 | 3300005328 | Bacteria | 26323 |
| 16 | Ga0070676_10006855 | 3300005328 | Bacteria | 6100 |
| 17 | Ga0070676_10183365 | 3300005328 | Bacteria | 1362 |
| 18 | Ga0070683_100003236 | 3300005329 | Bacteria | 13150 |
| 19 | Ga0070683_100098872 | 3300005329 | Bacteria | 2746 |
| 20 | Ga0070690_100000161 | 3300005330 | Bacteria | 34386 |
| 21 | Ga0070690_100020167 | 3300005330 | Bacteria | 4058 |
| 22 | Ga0070690_100251059 | 3300005330 | Unclassified | 1251 |
| 23 | Ga0070690_100259359 | 3300005330 | Bacteria | 1232 |
| 24 | Ga0070670_100017668 | 3300005331 | Bacteria | 6120 |
| 25 | Ga0070670_100034365 | 3300005331 | Bacteria | 4362 |
| 26 | Ga0070677_10011383 | 3300005333 | Bacteria | 3067 |
| 27 | Ga0070677_10047505 | 3300005333 | Bacteria | 1721 |
| 28 | Ga0068869_100001688 | 3300005334 | Bacteria | 13183 |
| 29 | Ga0068869_100004961 | 3300005334 | Bacteria | 8328 |
| 30 | Ga0068869_100075691 | 3300005334 | Bacteria | 2501 |
| 31 | Ga0068869_100239963 | 3300005334 | Bacteria | 1444 |
| 32 | Ga0068869_100387811 | 3300005334 | Bacteria | 1146 |
| 33 | Ga0070666_10000673 | 3300005335 | Bacteria | 20665 |
| 34 | Ga0070666_10028516 | 3300005335 | Bacteria | 3664 |
| 35 | Ga0070666_10035673 | 3300005335 | Bacteria | 3298 |
| 36 | Ga0070680_100071083 | 3300005336 | Bacteria | 2859 |
| 37 | Ga0070680_100078816 | 3300005336 | Bacteria | 2714 |
| 38 | Ga0070680_100171282 | 3300005336 | Bacteria | 1827 |
| 39 | Ga0070682_100065884 | 3300005337 | Bacteria | 2303 |
| 40 | Ga0068868_100005707 | 3300005338 | Bacteria | 8760 |
| 41 | Ga0068868_100017937 | 3300005338 | Bacteria | 5281 |
| 42 | Ga0068868_100098697 | 3300005338 | Bacteria | 2362 |
| 43 | Ga0068868_100153156 | 3300005338 | Bacteria | 1900 |
| 44 | Ga0070660_100000841 | 3300005339 | Bacteria | 20418 |
| 45 | Ga0070660_100483122 | 3300005339 | Bacteria | 1029 |
| 46 | Ga0070660_100512165 | 3300005339 | Bacteria | 999 |
| 47 | Ga0070689_100000709 | 3300005340 | Bacteria | 20276 |
| 48 | Ga0070689_100016859 | 3300005340 | Bacteria | 5354 |
| 49 | Ga0070689_100269226 | 3300005340 | Bacteria | 1410 |
| 50 | Ga0070691_10146074 | 3300005341 | Bacteria | 1209 |
| 51 | Ga0070687_100000011 | 3300005343 | Bacteria | 57981 |
| 52 | Ga0070687_100034677 | 3300005343 | Bacteria | 2500 |
| 53 | Ga0070687_100039822 | 3300005343 | Bacteria | 2364 |
| 54 | Ga0070661_100001135 | 3300005344 | Bacteria | 18731 |
| 55 | Ga0070661_100006263 | 3300005344 | Bacteria | 8212 |
| 56 | Ga0070661_100077201 | 3300005344 | Bacteria | 2455 |
| 57 | Ga0070661_100105908 | 3300005344 | Bacteria | 2097 |
| 58 | Ga0070692_10132575 | 3300005345 | Bacteria | 1402 |
| 59 | Ga0070668_100005064 | 3300005347 | Bacteria | 9755 |
| 60 | Ga0070668_100293763 | 3300005347 | Unclassified | 1361 |
| 61 | Ga0070668_100551171 | 3300005347 | Bacteria | 1003 |
| 62 | Ga0070669_100006355 | 3300005353 | Bacteria | 8515 |
| 63 | Ga0070669_100014101 | 3300005353 | Bacteria | 5685 |
| 64 | Ga0070675_100000821 | 3300005354 | Bacteria | 21914 |
| 65 | Ga0070675_100002151 | 3300005354 | Bacteria | 14581 |
| 66 | Ga0070675_100170775 | 3300005354 | Bacteria | 1875 |
| 67 | Ga0070675_100314828 | 3300005354 | Bacteria | 1381 |
| 68 | Ga0070671_100001021 | 3300005355 | Bacteria | 20588 |
| 69 | Ga0070674_100002542 | 3300005356 | Bacteria | 10102 |
| 70 | Ga0070674_100003166 | 3300005356 | Bacteria | 9171 |
| 71 | Ga0070674_100182181 | 3300005356 | Bacteria | 1610 |
| 72 | Ga0070674_100302054 | 3300005356 | Bacteria | 1276 |
| 73 | Ga0070673_100003576 | 3300005364 | Bacteria | 9706 |
| 74 | Ga0070673_100005261 | 3300005364 | Bacteria | 8263 |
| 75 | Ga0070688_100001830 | 3300005365 | Bacteria | 10681 |
| 76 | Ga0070688_100332909 | 3300005365 | Unclassified | 1106 |
| 77 | Ga0070659_100000150 | 3300005366 | Bacteria | 53214 |
| 78 | Ga0070659_100378629 | 3300005366 | Bacteria | 1192 |
| 79 | Ga0070667_100005396 | 3300005367 | Bacteria | 10681 |
| 80 | Ga0070667_100115137 | 3300005367 | Bacteria | 2335 |
| 81 | Ga0070709_10071872 | 3300005434 | Bacteria | 2235 |
| 82 | Ga0070714_100435311 | 3300005435 | Bacteria | 1244 |
| 83 | Ga0070713_100217617 | 3300005436 | Bacteria | 1732 |
| 84 | Ga0070701_10002949 | 3300005438 | Bacteria | 6643 |
| 85 | Ga0070701_10035114 | 3300005438 | Bacteria | 2517 |
| 86 | Ga0070711_100062091 | 3300005439 | Bacteria | 2603 |
| 87 | Ga0070705_100000387 | 3300005440 | Bacteria | 25625 |
| 88 | Ga0070694_100182487 | 3300005444 | Bacteria | 1553 |
| 89 | Ga0070694_100345984 | 3300005444 | Bacteria | 1151 |
| 90 | Ga0070663_100000694 | 3300005455 | Bacteria | 18126 |
| 91 | Ga0070663_100013602 | 3300005455 | Bacteria | 5194 |
| 92 | Ga0070663_100056093 | 3300005455 | Bacteria | 2821 |
| 93 | Ga0070663_100065062 | 3300005455 | Bacteria | 2637 |
| 94 | Ga0070663_100097899 | 3300005455 | Bacteria | 2184 |
| 95 | Ga0070663_100159847 | 3300005455 | Bacteria | 1733 |
| 96 | Ga0070663_100161774 | 3300005455 | Bacteria | 1723 |
| 97 | Ga0070663_100222666 | 3300005455 | Bacteria | 1482 |
| 98 | Ga0070678_100022351 | 3300005456 | Bacteria | 4190 |
| 99 | Ga0070678_100024393 | 3300005456 | Unclassified | 4048 |
| 100 | Ga0070678_100042538 | 3300005456 | Bacteria | 3230 |
| 101 | Ga0070678_100153543 | 3300005456 | Bacteria | 1857 |
| 102 | Ga0070678_100485616 | 3300005456 | Bacteria | 1088 |
| 103 | Ga0070678_100585302 | 3300005456 | Bacteria | 994 |
| 104 | Ga0070662_100000201 | 3300005457 | Bacteria | 35043 |
| 105 | Ga0070662_100015950 | 3300005457 | Bacteria | 5039 |
| 106 | Ga0070662_100022033 | 3300005457 | Bacteria | 4357 |
| 107 | Ga0070681_10030752 | 3300005458 | Bacteria | 5388 |
| 108 | Ga0070681_10237815 | 3300005458 | Bacteria | 1735 |
| 109 | Ga0068867_100000832 | 3300005459 | Bacteria | 20752 |
| 110 | Ga0068867_100156807 | 3300005459 | Bacteria | 1792 |
| 111 | Ga0070685_10003362 | 3300005466 | Bacteria | 8138 |
| 112 | Ga0070685_10044247 | 3300005466 | Bacteria | 2548 |
| 113 | Ga0070706_100256463 | 3300005467 | Bacteria | 1633 |
| 114 | Ga0070707_100423860 | 3300005468 | Bacteria | 1291 |
| 115 | Ga0070699_100036589 | 3300005518 | Bacteria | 4247 |
| 116 | Ga0070699_100079053 | 3300005518 | Bacteria | 2864 |
| 117 | Ga0070699_100192435 | 3300005518 | Bacteria | 1812 |
| 118 | Ga0070679_100022047 | 3300005530 | Bacteria | 6222 |
| 119 | Ga0070679_100068280 | 3300005530 | Bacteria | 3546 |
| 120 | Ga0070684_100036825 | 3300005535 | Bacteria | 4194 |
| 121 | Ga0068853_100005121 | 3300005539 | Bacteria | 10244 |
| 122 | Ga0068853_100358276 | 3300005539 | Bacteria | 1358 |
| 123 | Ga0068853_100435278 | 3300005539 | Bacteria | 1232 |
| 124 | Ga0070672_100003813 | 3300005543 | Bacteria | 9815 |
| 125 | Ga0070672_100010911 | 3300005543 | Bacteria | 6321 |
| 126 | Ga0070672_100045754 | 3300005543 | Bacteria | 3388 |
| 127 | Ga0070686_100001626 | 3300005544 | Bacteria | 12566 |
| 128 | Ga0070686_100082537 | 3300005544 | Bacteria | 2132 |
| 129 | Ga0070686_100246696 | 3300005544 | Bacteria | 1302 |
| 130 | Ga0070695_100046693 | 3300005545 | Bacteria | 2763 |
| 131 | Ga0070695_100055370 | 3300005545 | Bacteria | 2556 |
| 132 | Ga0070696_100067161 | 3300005546 | Bacteria | 2516 |
| 133 | Ga0070693_100017104 | 3300005547 | Bacteria | 3764 |
| 134 | Ga0070693_100027832 | 3300005547 | Bacteria | 3068 |
| 135 | Ga0070693_100027871 | 3300005547 | Bacteria | 3066 |
| 136 | Ga0070693_100031872 | 3300005547 | Bacteria | 2893 |
| 137 | Ga0070693_100068195 | 3300005547 | Bacteria | 2087 |
| 138 | Ga0070693_100112553 | 3300005547 | Bacteria | 1677 |
| 139 | Ga0070665_100020348 | 3300005548 | Bacteria | 6665 |
| 140 | Ga0070665_100023807 | 3300005548 | Bacteria | 6169 |
| 141 | Ga0070665_100032508 | 3300005548 | Bacteria | 5251 |
| 142 | Ga0070665_100177036 | 3300005548 | Bacteria | 2134 |
| 143 | Ga0070665_100488953 | 3300005548 | Bacteria | 1242 |
| 144 | Ga0070665_100641719 | 3300005548 | Bacteria | 1075 |
| 145 | Ga0070704_100048327 | 3300005549 | Bacteria | 2978 |
| 146 | Ga0068855_100007063 | 3300005563 | Bacteria | 13618 |
| 147 | Ga0068855_100013690 | 3300005563 | Bacteria | 9782 |
| 148 | Ga0068855_100019007 | 3300005563 | Bacteria | 8261 |
| 149 | Ga0068855_100054408 | 3300005563 | Bacteria | 4704 |
| 150 | Ga0068855_100061422 | 3300005563 | Bacteria | 4391 |
| 151 | Ga0068855_100119768 | 3300005563 | Bacteria | 3013 |
| 152 | Ga0068855_100184199 | 3300005563 | Bacteria | 2359 |
| 153 | Ga0070664_100000409 | 3300005564 | Bacteria | 31980 |
| 154 | Ga0070664_100011714 | 3300005564 | Bacteria | 7117 |
| 155 | Ga0070664_100031009 | 3300005564 | Bacteria | 4464 |
| 156 | Ga0070664_100124158 | 3300005564 | Bacteria | 2263 |
| 157 | Ga0068857_100000045 | 3300005577 | Bacteria | 68428 |
| 158 | Ga0068857_100019250 | 3300005577 | Bacteria | 5993 |
| 159 | Ga0068857_100165300 | 3300005577 | Bacteria | 2009 |
| 160 | Ga0068857_100264293 | 3300005577 | Bacteria | 1580 |
| 161 | Ga0068854_100000943 | 3300005578 | Bacteria | 17491 |
| 162 | Ga0068854_100004958 | 3300005578 | Bacteria | 8390 |
| 163 | Ga0068854_100377213 | 3300005578 | Bacteria | 1168 |
| 164 | Ga0068856_100000969 | 3300005614 | Bacteria | 30619 |
| 165 | Ga0068856_100070577 | 3300005614 | Bacteria | 3456 |
| 166 | Ga0068856_100110301 | 3300005614 | Bacteria | 2748 |
| 167 | Ga0068856_100331805 | 3300005614 | Bacteria | 1539 |
| 168 | Ga0070702_100074559 | 3300005615 | Bacteria | 2014 |
| 169 | Ga0070702_100087054 | 3300005615 | Bacteria | 1886 |
| 170 | Ga0070702_100107814 | 3300005615 | Bacteria | 1721 |
| 171 | Ga0070702_100188045 | 3300005615 | Bacteria | 1357 |
| 172 | Ga0070702_100322842 | 3300005615 | Bacteria | 1077 |
| 173 | Ga0068852_100010493 | 3300005616 | Bacteria | 6926 |
| 174 | Ga0068852_100022851 | 3300005616 | Bacteria | 5023 |
| 175 | Ga0068852_100073144 | 3300005616 | Bacteria | 3015 |
| 176 | Ga0068852_100287366 | 3300005616 | Bacteria | 1587 |
| 177 | Ga0068852_100740716 | 3300005616 | Bacteria | 995 |
| 178 | Ga0068852_100745225 | 3300005616 | Bacteria | 991 |
| 179 | Ga0068859_100002138 | 3300005617 | Bacteria | 20097 |
| 180 | Ga0068859_100006419 | 3300005617 | Bacteria | 11933 |
| 181 | Ga0068859_100187733 | 3300005617 | Bacteria | 2151 |
| 182 | Ga0068864_100001397 | 3300005618 | Bacteria | 19994 |
| 183 | Ga0068864_100034925 | 3300005618 | Bacteria | 4279 |
| 184 | Ga0068864_100092449 | 3300005618 | Bacteria | 2670 |
| 185 | Ga0068866_10001396 | 3300005718 | Bacteria | 10405 |
| 186 | Ga0068866_10067040 | 3300005718 | Bacteria | 1883 |
| 187 | Ga0068861_100000449 | 3300005719 | Bacteria | 23927 |
| 188 | Ga0068861_100059201 | 3300005719 | Bacteria | 2932 |
| 189 | Ga0068861_100200551 | 3300005719 | Bacteria | 1674 |
| 190 | Ga0068851_10002385 | 3300005834 | Bacteria | 8252 |
| 191 | Ga0068870_10000840 | 3300005840 | Bacteria | 11962 |
| 192 | Ga0068870_10159417 | 3300005840 | Bacteria | 1336 |
| 193 | Ga0068863_100004325 | 3300005841 | Bacteria | 14003 |
| 194 | Ga0068863_100216746 | 3300005841 | Bacteria | 1843 |
| 195 | Ga0068858_100002574 | 3300005842 | Bacteria | 18264 |
| 196 | Ga0068858_100020070 | 3300005842 | Bacteria | 6250 |
| 197 | Ga0068858_100042918 | 3300005842 | Bacteria | 4193 |
| 198 | Ga0068858_100053290 | 3300005842 | Bacteria | 3742 |
| 199 | Ga0068858_100356005 | 3300005842 | Bacteria | 1402 |
| 200 | Ga0068860_100006384 | 3300005843 | Bacteria | 11834 |
| 201 | Ga0068860_100068705 | 3300005843 | Bacteria | 3367 |
| 202 | Ga0068860_100160156 | 3300005843 | Bacteria | 2170 |
| 203 | Ga0068860_100194817 | 3300005843 | Bacteria | 1962 |
| 204 | Ga0068860_100205880 | 3300005843 | Bacteria | 1908 |
| 205 | Ga0068860_100397843 | 3300005843 | Bacteria | 1362 |
| 206 | Ga0068862_100003062 | 3300005844 | Bacteria | 14570 |
| 207 | Ga0068862_100135682 | 3300005844 | Bacteria | 2180 |
| 208 | Ga0081455_10001565 | 3300005937 | Bacteria | 28095 |
| 209 | Ga0081455_10004842 | 3300005937 | Bacteria | 14942 |
| 210 | Ga0081455_10005486 | 3300005937 | Bacteria | 13905 |
| 211 | Ga0081455_10023977 | 3300005937 | Bacteria | 5662 |
| 212 | Ga0081455_10025617 | 3300005937 | Bacteria | 5440 |
| 213 | Ga0081455_10109038 | 3300005937 | Bacteria | 2204 |
| 214 | Ga0081538_10051765 | 3300005981 | Bacteria | 2461 |
| 215 | Ga0081540_1000076 | 3300005983 | Bacteria | 106701 |
| 216 | Ga0081540_1000083 | 3300005983 | Bacteria | 100350 |
| 217 | Ga0081540_1000780 | 3300005983 | Bacteria | 29224 |
| 218 | Ga0081540_1001934 | 3300005983 | Bacteria | 17349 |
| 219 | Ga0081540_1002260 | 3300005983 | Bacteria | 15841 |
| 220 | Ga0081540_1004844 | 3300005983 | Bacteria | 10142 |
| 221 | Ga0081540_1006350 | 3300005983 | Bacteria | 8632 |
| 222 | Ga0081540_1006556 | 3300005983 | Bacteria | 8453 |
| 223 | Ga0081540_1042269 | 3300005983 | Bacteria | 2352 |
| 224 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 225 | Ga0081539_10002516 | 3300005985 | Bacteria | 25625 |
| 226 | Ga0081539_10052497 | 3300005985 | Bacteria | 2289 |
| 227 | Ga0075365_10065664 | 3300006038 | Bacteria | 2432 |
| 228 | Ga0075365_10107719 | 3300006038 | Bacteria | 1913 |
| 229 | Ga0075368_10012932 | 3300006042 | Bacteria | 3059 |
| 230 | Ga0075363_100213502 | 3300006048 | Bacteria | 1104 |
| 231 | Ga0070716_100313125 | 3300006173 | Bacteria | 1097 |
| 232 | Ga0070712_100017293 | 3300006175 | Bacteria | 4666 |
| 233 | Ga0075369_10012643 | 3300006186 | Bacteria | 3335 |
| 234 | Ga0075366_10193729 | 3300006195 | Bacteria | 1235 |
| 235 | Ga0097621_100013398 | 3300006237 | Bacteria | 6113 |
| 236 | Ga0097621_100059494 | 3300006237 | Bacteria | 3128 |
| 237 | Ga0097621_100124098 | 3300006237 | Bacteria | 2192 |
| 238 | Ga0068871_100002264 | 3300006358 | Bacteria | 13084 |
| 239 | Ga0075428_100181146 | 3300006844 | Bacteria | 2280 |
| 240 | Ga0075428_100211480 | 3300006844 | Bacteria | 2096 |
| 241 | Ga0075430_100048637 | 3300006846 | Bacteria | 3581 |
| 242 | Ga0075431_100166626 | 3300006847 | Bacteria | 2265 |
| 243 | Ga0075433_10423792 | 3300006852 | Bacteria | 1174 |
| 244 | Ga0075434_100150993 | 3300006871 | Bacteria | 2343 |
| 245 | Ga0075434_100282382 | 3300006871 | Bacteria | 1679 |
| 246 | Ga0075434_100308820 | 3300006871 | Bacteria | 1602 |
| 247 | Ga0068865_100000468 | 3300006881 | Bacteria | 22582 |
| 248 | Ga0068865_100006360 | 3300006881 | Bacteria | 7199 |
| 249 | Ga0068865_100009816 | 3300006881 | Bacteria | 5945 |
| 250 | Ga0068865_100127092 | 3300006881 | Bacteria | 1904 |
| 251 | Ga0068865_100391653 | 3300006881 | Unclassified | 1136 |
| 252 | Ga0097620_100002138 | 3300006931 | Bacteria | 20097 |
| 253 | Ga0097620_100006418 | 3300006931 | Bacteria | 11933 |
| 254 | Ga0097620_100187745 | 3300006931 | Bacteria | 2151 |
| 255 | Ga0099794_10002060 | 3300007265 | Bacteria | 7292 |
| 256 | Ga0099795_10105581 | 3300007788 | Bacteria | 1110 |
| 257 | Ga0105240_10000911 | 3300009093 | Bacteria | 52804 |
| 258 | Ga0105240_10007148 | 3300009093 | Bacteria | 16262 |
| 259 | Ga0105240_10040900 | 3300009093 | Bacteria | 5923 |
| 260 | Ga0105240_10043796 | 3300009093 | Bacteria | 5691 |
| 261 | Ga0105240_10348608 | 3300009093 | Bacteria | 1680 |
| 262 | Ga0111539_10005949 | 3300009094 | Bacteria | 15752 |
| 263 | Ga0111539_10034475 | 3300009094 | Bacteria | 6137 |
| 264 | Ga0111539_10233241 | 3300009094 | Bacteria | 2143 |
| 265 | Ga0111539_10292188 | 3300009094 | Bacteria | 1896 |
| 266 | Ga0105245_10000110 | 3300009098 | Bacteria | 79654 |
| 267 | Ga0105245_10048588 | 3300009098 | Bacteria | 3796 |
| 268 | Ga0105245_10341805 | 3300009098 | Bacteria | 1480 |
| 269 | Ga0105247_10000779 | 3300009101 | Bacteria | 24470 |
| 270 | Ga0105247_10085085 | 3300009101 | Bacteria | 1999 |
| 271 | Ga0105247_10292969 | 3300009101 | Bacteria | 1126 |
| 272 | Ga0114129_10079787 | 3300009147 | Bacteria | 4550 |
| 273 | Ga0114129_10337361 | 3300009147 | Bacteria | 2000 |
| 274 | Ga0105243_10001825 | 3300009148 | Bacteria | 18221 |
| 275 | Ga0105243_10331838 | 3300009148 | Bacteria | 1389 |
| 276 | Ga0105241_10000441 | 3300009174 | Bacteria | 31255 |
| 277 | Ga0105241_10016275 | 3300009174 | Bacteria | 5450 |
| 278 | Ga0105241_10045394 | 3300009174 | Bacteria | 3334 |
| 279 | Ga0105241_10245421 | 3300009174 | Bacteria | 1516 |
| 280 | Ga0105242_10003699 | 3300009176 | Bacteria | 11905 |
| 281 | Ga0105242_10007991 | 3300009176 | Bacteria | 8149 |
| 282 | Ga0105242_10016771 | 3300009176 | Bacteria | 5700 |
| 283 | Ga0105242_10084280 | 3300009176 | Bacteria | 2663 |
| 284 | Ga0105248_10007983 | 3300009177 | Bacteria | 11625 |
| 285 | Ga0105248_10008973 | 3300009177 | Bacteria | 10995 |
| 286 | Ga0105248_10132530 | 3300009177 | Bacteria | 2812 |
| 287 | Ga0105248_10356813 | 3300009177 | Bacteria | 1646 |
| 288 | Ga0105237_10004354 | 3300009545 | Bacteria | 16406 |
| 289 | Ga0105237_10016097 | 3300009545 | Bacteria | 7778 |
| 290 | Ga0105237_10034338 | 3300009545 | Bacteria | 5136 |
| 291 | Ga0105237_10038469 | 3300009545 | Bacteria | 4830 |
| 292 | Ga0105237_10152385 | 3300009545 | Bacteria | 2308 |
| 293 | Ga0105237_10548970 | 3300009545 | Bacteria | 1162 |
| 294 | Ga0105237_10610675 | 3300009545 | Bacteria | 1097 |
| 295 | Ga0105238_10000246 | 3300009551 | Bacteria | 60435 |
| 296 | Ga0105238_10037628 | 3300009551 | Bacteria | 4918 |
| 297 | Ga0105238_10045861 | 3300009551 | Bacteria | 4415 |
| 298 | Ga0105238_10057078 | 3300009551 | Bacteria | 3915 |
| 299 | Ga0105238_10218265 | 3300009551 | Bacteria | 1883 |
| 300 | Ga0105238_10678085 | 3300009551 | Bacteria | 1042 |
| 301 | Ga0105249_10001617 | 3300009553 | Bacteria | 19729 |
| 302 | Ga0105249_10005056 | 3300009553 | Bacteria | 11362 |
| 303 | Ga0105249_10056577 | 3300009553 | Bacteria | 3591 |
| 304 | Ga0105249_10381216 | 3300009553 | Bacteria | 1436 |
| 305 | Ga0105239_10025154 | 3300010375 | Bacteria | 6557 |
| 306 | Ga0105239_10039281 | 3300010375 | Bacteria | 5185 |
| 307 | Ga0105239_10039841 | 3300010375 | Bacteria | 5147 |
| 308 | Ga0105239_10080411 | 3300010375 | Bacteria | 3586 |
| 309 | Ga0105239_10137433 | 3300010375 | Bacteria | 2721 |
| 310 | Ga0105239_10286555 | 3300010375 | Bacteria | 1855 |
| 311 | Ga0105239_10287340 | 3300010375 | Bacteria | 1852 |
| 312 | Ga0105246_10042417 | 3300011119 | Bacteria | 3081 |
| 313 | Ga0105246_10079100 | 3300011119 | Bacteria | 2337 |
| 314 | Ga0157335_1000837 | 3300012492 | Bacteria | 1536 |
| 315 | Ga0157326_1008196 | 3300012513 | Bacteria | 1137 |
| 316 | Ga0157373_10004358 | 3300013100 | Bacteria | 10661 |
| 317 | Ga0157373_10327913 | 3300013100 | Bacteria | 1090 |
| 318 | Ga0157371_10006096 | 3300013102 | Bacteria | 10026 |
| 319 | Ga0157371_10150770 | 3300013102 | Bacteria | 1658 |
| 320 | Ga0157370_10011316 | 3300013104 | Bacteria | 9350 |
| 321 | Ga0157370_10062592 | 3300013104 | Bacteria | 3528 |
| 322 | Ga0157369_10012527 | 3300013105 | Bacteria | 9620 |
| 323 | Ga0157369_10177141 | 3300013105 | Bacteria | 2244 |
| 324 | Ga0157374_10000113 | 3300013296 | Bacteria | 74057 |
| 325 | Ga0157374_10011568 | 3300013296 | Bacteria | 7649 |
| 326 | Ga0157374_10058276 | 3300013296 | Bacteria | 3608 |
| 327 | Ga0157374_10081673 | 3300013296 | Bacteria | 3067 |
| 328 | Ga0157374_10366504 | 3300013296 | Bacteria | 1433 |
| 329 | Ga0157378_10011085 | 3300013297 | Bacteria | 7889 |
| 330 | Ga0157378_10026784 | 3300013297 | Bacteria | 5084 |
| 331 | Ga0157378_10034001 | 3300013297 | Bacteria | 4509 |
| 332 | Ga0157378_10094564 | 3300013297 | Bacteria | 2721 |
| 333 | Ga0157378_10348838 | 3300013297 | Bacteria | 1445 |
| 334 | Ga0163162_10000617 | 3300013306 | Bacteria | 33010 |
| 335 | Ga0163162_10064022 | 3300013306 | Bacteria | 3722 |
| 336 | Ga0163162_10179442 | 3300013306 | Bacteria | 2243 |
| 337 | Ga0163162_10388730 | 3300013306 | Bacteria | 1528 |
| 338 | Ga0163162_10576566 | 3300013306 | Unclassified | 1252 |
| 339 | Ga0157372_10007152 | 3300013307 | Bacteria | 11880 |
| 340 | Ga0157372_10050625 | 3300013307 | Bacteria | 4620 |
| 341 | Ga0157372_10333153 | 3300013307 | Bacteria | 1768 |
| 342 | Ga0157375_10001209 | 3300013308 | Bacteria | 22296 |
| 343 | Ga0157375_10001227 | 3300013308 | Bacteria | 22128 |
| 344 | Ga0157375_10007526 | 3300013308 | Bacteria | 9522 |
| 345 | Ga0157375_10013332 | 3300013308 | Bacteria | 7310 |
| 346 | Ga0157375_10077771 | 3300013308 | Bacteria | 3349 |
| 347 | Ga0157375_10206394 | 3300013308 | Bacteria | 2121 |
| 348 | Ga0163163_10013878 | 3300014325 | Bacteria | 7389 |
| 349 | Ga0163163_10032740 | 3300014325 | Bacteria | 5022 |
| 350 | Ga0163163_10049458 | 3300014325 | Bacteria | 4138 |
| 351 | Ga0163163_10063508 | 3300014325 | Bacteria | 3662 |
| 352 | Ga0157380_10029092 | 3300014326 | Bacteria | 4222 |
| 353 | Ga0157380_10085162 | 3300014326 | Bacteria | 2593 |
| 354 | Ga0157380_10110506 | 3300014326 | Bacteria | 2309 |
| 355 | Ga0157380_10116556 | 3300014326 | Bacteria | 2255 |
| 356 | Ga0157380_10186199 | 3300014326 | Bacteria | 1829 |
| 357 | Ga0157377_10000265 | 3300014745 | Bacteria | 25633 |
| 358 | Ga0157379_10000775 | 3300014968 | Bacteria | 25977 |
| 359 | Ga0157379_10024010 | 3300014968 | Bacteria | 5411 |
| 360 | Ga0157379_10073293 | 3300014968 | Bacteria | 3064 |
| 361 | Ga0157379_10355004 | 3300014968 | Bacteria | 1343 |
| 362 | Ga0157379_10439438 | 3300014968 | Bacteria | 1203 |
| 363 | Ga0157376_10001710 | 3300014969 | Bacteria | 14602 |
| 364 | Ga0157376_10016754 | 3300014969 | Bacteria | 5573 |
| 365 | Ga0157376_10113593 | 3300014969 | Bacteria | 2388 |
| 366 | Ga0209758_1006284 | 3300025297 | Bacteria | 8631 |
| 367 | Ga0209758_1006935 | 3300025297 | Bacteria | 7901 |
| 368 | Ga0207697_10000147 | 3300025315 | Bacteria | 34455 |
| 369 | Ga0207656_10000871 | 3300025321 | Bacteria | 9831 |
| 370 | Ga0207655_1017118 | 3300025728 | Bacteria | 3925 |
| 371 | Ga0207682_10011662 | 3300025893 | Bacteria | 3435 |
| 372 | Ga0207692_10046815 | 3300025898 | Bacteria | 2170 |
| 373 | Ga0207642_10061668 | 3300025899 | Bacteria | 1745 |
| 374 | Ga0207642_10320096 | 3300025899 | Bacteria | 905 |
| 375 | Ga0207710_10016717 | 3300025900 | Bacteria | 3106 |
| 376 | Ga0207688_10000086 | 3300025901 | Bacteria | 35591 |
| 377 | Ga0207688_10009671 | 3300025901 | Bacteria | 5248 |
| 378 | Ga0207680_10004502 | 3300025903 | Bacteria | 6609 |
| 379 | Ga0207680_10064647 | 3300025903 | Bacteria | 2244 |
| 380 | Ga0207680_10138589 | 3300025903 | Bacteria | 1611 |
| 381 | Ga0207647_10002419 | 3300025904 | Bacteria | 14154 |
| 382 | Ga0207647_10138492 | 3300025904 | Bacteria | 1427 |
| 383 | Ga0207645_10000006 | 3300025907 | Bacteria | 197563 |
| 384 | Ga0207645_10010075 | 3300025907 | Bacteria | 6507 |
| 385 | Ga0207645_10023160 | 3300025907 | Bacteria | 4037 |
| 386 | Ga0207643_10000019 | 3300025908 | Bacteria | 112372 |
| 387 | Ga0207643_10074115 | 3300025908 | Bacteria | 1963 |
| 388 | Ga0207705_10007653 | 3300025909 | Bacteria | 7940 |
| 389 | Ga0207654_10001653 | 3300025911 | Bacteria | 11647 |
| 390 | Ga0207654_10071490 | 3300025911 | Bacteria | 2063 |
| 391 | Ga0207654_10295373 | 3300025911 | Bacteria | 1100 |
| 392 | Ga0207707_10025800 | 3300025912 | Bacteria | 5140 |
| 393 | Ga0207707_10305510 | 3300025912 | Bacteria | 1375 |
| 394 | Ga0207695_10004251 | 3300025913 | Bacteria | 19672 |
| 395 | Ga0207695_10040274 | 3300025913 | Bacteria | 5013 |
| 396 | Ga0207695_10113566 | 3300025913 | Bacteria | 2685 |
| 397 | Ga0207671_10007024 | 3300025914 | Bacteria | 9865 |
| 398 | Ga0207671_10190124 | 3300025914 | Bacteria | 1601 |
| 399 | Ga0207671_10216966 | 3300025914 | Bacteria | 1498 |
| 400 | Ga0207693_10085746 | 3300025915 | Bacteria | 2467 |
| 401 | Ga0207660_10054655 | 3300025917 | Bacteria | 2851 |
| 402 | Ga0207662_10000002 | 3300025918 | Bacteria | 164937 |
| 403 | Ga0207662_10008870 | 3300025918 | Bacteria | 5517 |
| 404 | Ga0207662_10060786 | 3300025918 | Bacteria | 2267 |
| 405 | Ga0207657_10000007 | 3300025919 | Bacteria | 205196 |
| 406 | Ga0207657_10410742 | 3300025919 | Bacteria | 1064 |
| 407 | Ga0207649_10002537 | 3300025920 | Bacteria | 10170 |
| 408 | Ga0207649_10002680 | 3300025920 | Bacteria | 9868 |
| 409 | Ga0207649_10008104 | 3300025920 | Bacteria | 5717 |
| 410 | Ga0207652_10176872 | 3300025921 | Bacteria | 1916 |
| 411 | Ga0207652_10289641 | 3300025921 | Bacteria | 1477 |
| 412 | Ga0207646_10131038 | 3300025922 | Bacteria | 2257 |
| 413 | Ga0207681_10001798 | 3300025923 | Bacteria | 13769 |
| 414 | Ga0207681_10151091 | 3300025923 | Bacteria | 1740 |
| 415 | Ga0207681_10349804 | 3300025923 | Bacteria | 1183 |
| 416 | Ga0207694_10024306 | 3300025924 | Bacteria | 4600 |
| 417 | Ga0207650_10000109 | 3300025925 | Bacteria | 108728 |
| 418 | Ga0207650_10104192 | 3300025925 | Bacteria | 2188 |
| 419 | Ga0207659_10001567 | 3300025926 | Bacteria | 13570 |
| 420 | Ga0207659_10031235 | 3300025926 | Bacteria | 3644 |
| 421 | Ga0207659_10124561 | 3300025926 | Bacteria | 1980 |
| 422 | Ga0207687_10004863 | 3300025927 | Bacteria | 8931 |
| 423 | Ga0207687_10091805 | 3300025927 | Bacteria | 2216 |
| 424 | Ga0207687_10136303 | 3300025927 | Bacteria | 1857 |
| 425 | Ga0207644_10000618 | 3300025931 | Bacteria | 22661 |
| 426 | Ga0207690_10063101 | 3300025932 | Bacteria | 2525 |
| 427 | Ga0207690_10236481 | 3300025932 | Bacteria | 1405 |
| 428 | Ga0207706_10000066 | 3300025933 | Bacteria | 108138 |
| 429 | Ga0207706_10002627 | 3300025933 | Bacteria | 17502 |
| 430 | Ga0207706_10008600 | 3300025933 | Bacteria | 9406 |
| 431 | Ga0207706_10013775 | 3300025933 | Bacteria | 7338 |
| 432 | Ga0207706_10314679 | 3300025933 | Unclassified | 1363 |
| 433 | Ga0207686_10003515 | 3300025934 | Bacteria | 8412 |
| 434 | Ga0207686_10017329 | 3300025934 | Unclassified | 4057 |
| 435 | Ga0207709_10008078 | 3300025935 | Bacteria | 5829 |
| 436 | Ga0207709_10245453 | 3300025935 | Bacteria | 1305 |
| 437 | Ga0207709_10319731 | 3300025935 | Bacteria | 1161 |
| 438 | Ga0207709_10442794 | 3300025935 | Bacteria | 1002 |
| 439 | Ga0207670_10004848 | 3300025936 | Bacteria | 7308 |
| 440 | Ga0207670_10043926 | 3300025936 | Bacteria | 2954 |
| 441 | Ga0207670_10054504 | 3300025936 | Bacteria | 2698 |
| 442 | Ga0207669_10000286 | 3300025937 | Bacteria | 23124 |
| 443 | Ga0207669_10004441 | 3300025937 | Bacteria | 6173 |
| 444 | Ga0207669_10025214 | 3300025937 | Bacteria | 3209 |
| 445 | Ga0207669_10029792 | 3300025937 | Bacteria | 3024 |
| 446 | Ga0207669_10197430 | 3300025937 | Bacteria | 1457 |
| 447 | Ga0207669_10288491 | 3300025937 | Bacteria | 1241 |
| 448 | Ga0207704_10001245 | 3300025938 | Bacteria | 11361 |
| 449 | Ga0207704_10018911 | 3300025938 | Bacteria | 3607 |
| 450 | Ga0207704_10048601 | 3300025938 | Unclassified | 2545 |
| 451 | Ga0207704_10097094 | 3300025938 | Bacteria | 1953 |
| 452 | Ga0207704_10471942 | 3300025938 | Bacteria | 1005 |
| 453 | Ga0207665_10009471 | 3300025939 | Bacteria | 6394 |
| 454 | Ga0207691_10000628 | 3300025940 | Bacteria | 34907 |
| 455 | Ga0207691_10026799 | 3300025940 | Bacteria | 5409 |
| 456 | Ga0207691_10031739 | 3300025940 | Bacteria | 4929 |
| 457 | Ga0207691_10599668 | 3300025940 | Bacteria | 932 |
| 458 | Ga0207711_10000065 | 3300025941 | Bacteria | 119677 |
| 459 | Ga0207711_10001337 | 3300025941 | Bacteria | 23334 |
| 460 | Ga0207711_10023085 | 3300025941 | Bacteria | 5209 |
| 461 | Ga0207711_10041147 | 3300025941 | Bacteria | 3935 |
| 462 | Ga0207711_10204698 | 3300025941 | Bacteria | 1802 |
| 463 | Ga0207689_10000070 | 3300025942 | Bacteria | 82939 |
| 464 | Ga0207689_10005212 | 3300025942 | Bacteria | 11665 |
| 465 | Ga0207689_10024310 | 3300025942 | Bacteria | 5084 |
| 466 | Ga0207661_10051220 | 3300025944 | Bacteria | 3293 |
| 467 | Ga0207661_10086145 | 3300025944 | Bacteria | 2606 |
| 468 | Ga0207679_10000192 | 3300025945 | Bacteria | 49117 |
| 469 | Ga0207679_10002439 | 3300025945 | Bacteria | 11459 |
| 470 | Ga0207679_10023667 | 3300025945 | Bacteria | 4203 |
| 471 | Ga0207679_10043202 | 3300025945 | Bacteria | 3244 |
| 472 | Ga0207679_10270026 | 3300025945 | Bacteria | 1454 |
| 473 | Ga0207667_10000244 | 3300025949 | Bacteria | 76441 |
| 474 | Ga0207667_10006665 | 3300025949 | Bacteria | 13960 |
| 475 | Ga0207667_10168344 | 3300025949 | Bacteria | 2252 |
| 476 | Ga0207651_10002235 | 3300025960 | Bacteria | 9178 |
| 477 | Ga0207651_10005114 | 3300025960 | Bacteria | 6697 |
| 478 | Ga0207712_10000421 | 3300025961 | Bacteria | 36297 |
| 479 | Ga0207712_10006564 | 3300025961 | Bacteria | 7341 |
| 480 | Ga0207712_10046748 | 3300025961 | Bacteria | 3002 |
| 481 | Ga0207712_10091256 | 3300025961 | Bacteria | 2244 |
| 482 | Ga0207668_10040849 | 3300025972 | Bacteria | 3132 |
| 483 | Ga0207668_10242019 | 3300025972 | Bacteria | 1460 |
| 484 | Ga0207668_10358634 | 3300025972 | Bacteria | 1221 |
| 485 | Ga0207640_10000169 | 3300025981 | Bacteria | 47286 |
| 486 | Ga0207640_10002086 | 3300025981 | Bacteria | 10764 |
| 487 | Ga0207658_10010070 | 3300025986 | Bacteria | 6421 |
| 488 | Ga0207658_10026952 | 3300025986 | Bacteria | 4033 |
| 489 | Ga0207658_10130696 | 3300025986 | Bacteria | 2017 |
| 490 | Ga0207658_10291383 | 3300025986 | Bacteria | 1403 |
| 491 | Ga0207677_10000187 | 3300026023 | Bacteria | 49830 |
| 492 | Ga0207677_10008792 | 3300026023 | Bacteria | 5658 |
| 493 | Ga0207677_10306387 | 3300026023 | Bacteria | 1314 |
| 494 | Ga0207703_10000102 | 3300026035 | Bacteria | 100318 |
| 495 | Ga0207703_10005716 | 3300026035 | Bacteria | 9975 |
| 496 | Ga0207703_10018789 | 3300026035 | Bacteria | 5397 |
| 497 | Ga0207703_10053526 | 3300026035 | Bacteria | 3280 |
| 498 | Ga0207703_10406349 | 3300026035 | Bacteria | 1264 |
| 499 | Ga0207703_10416604 | 3300026035 | Bacteria | 1249 |
| 500 | Ga0207703_10451457 | 3300026035 | Bacteria | 1201 |
| 501 | Ga0207639_10002412 | 3300026041 | Bacteria | 12553 |
| 502 | Ga0207639_10168687 | 3300026041 | Bacteria | 1851 |
| 503 | Ga0207678_10001138 | 3300026067 | Bacteria | 24371 |
| 504 | Ga0207678_10014007 | 3300026067 | Bacteria | 7050 |
| 505 | Ga0207678_10029116 | 3300026067 | Bacteria | 4820 |
| 506 | Ga0207678_10122751 | 3300026067 | Bacteria | 2216 |
| 507 | Ga0207678_10229069 | 3300026067 | Bacteria | 1591 |
| 508 | Ga0207708_10014035 | 3300026075 | Bacteria | 5985 |
| 509 | Ga0207708_10544529 | 3300026075 | Archaea | 978 |
| 510 | Ga0207702_10058029 | 3300026078 | Bacteria | 3292 |
| 511 | Ga0207702_10102076 | 3300026078 | Bacteria | 2534 |
| 512 | Ga0207702_10166680 | 3300026078 | Bacteria | 2016 |
| 513 | Ga0207702_10267828 | 3300026078 | Bacteria | 1611 |
| 514 | Ga0207641_10024778 | 3300026088 | Bacteria | 4945 |
| 515 | Ga0207641_10108912 | 3300026088 | Bacteria | 2453 |
| 516 | Ga0207641_10168360 | 3300026088 | Bacteria | 1998 |
| 517 | Ga0207648_10000099 | 3300026089 | Bacteria | 82716 |
| 518 | Ga0207648_10001481 | 3300026089 | Bacteria | 25831 |
| 519 | Ga0207648_10328994 | 3300026089 | Bacteria | 1374 |
| 520 | Ga0207648_10425335 | 3300026089 | Bacteria | 1206 |
| 521 | Ga0207676_10003294 | 3300026095 | Bacteria | 11475 |
| 522 | Ga0207676_10090503 | 3300026095 | Bacteria | 2511 |
| 523 | Ga0207674_10000030 | 3300026116 | Bacteria | 145695 |
| 524 | Ga0207674_10009990 | 3300026116 | Bacteria | 10802 |
| 525 | Ga0207674_10020542 | 3300026116 | Bacteria | 7132 |
| 526 | Ga0207674_10100456 | 3300026116 | Bacteria | 2874 |
| 527 | Ga0207675_100000007 | 3300026118 | Bacteria | 187048 |
| 528 | Ga0207675_100092540 | 3300026118 | Bacteria | 2844 |
| 529 | Ga0207675_100207607 | 3300026118 | Bacteria | 1883 |
| 530 | Ga0207683_10000688 | 3300026121 | Bacteria | 30991 |
| 531 | Ga0207683_10008652 | 3300026121 | Bacteria | 8704 |
| 532 | Ga0207683_10028448 | 3300026121 | Bacteria | 4832 |
| 533 | Ga0207683_10063460 | 3300026121 | Bacteria | 3254 |
| 534 | Ga0207683_10116730 | 3300026121 | Bacteria | 2393 |
| 535 | Ga0207683_10218267 | 3300026121 | Bacteria | 1737 |
| 536 | Ga0207683_10271848 | 3300026121 | Bacteria | 1548 |
| 537 | Ga0207698_10063176 | 3300026142 | Bacteria | 2896 |
| 538 | Ga0207698_10097833 | 3300026142 | Bacteria | 2423 |
| 539 | Ga0207698_10242596 | 3300026142 | Bacteria | 1643 |
| 540 | Ga0209588_1031900 | 3300027671 | Bacteria | 1687 |
| 541 | Ga0209998_10011711 | 3300027717 | Bacteria | 1818 |
| 542 | Ga0207428_10012161 | 3300027907 | Bacteria | 7573 |
| 543 | Ga0265356_1002334 | 3300028017 | Bacteria | 2553 |
| 544 | Ga0268266_10000397 | 3300028379 | Bacteria | 65954 |
| 545 | Ga0268266_10002092 | 3300028379 | Bacteria | 22080 |
| 546 | Ga0268266_10011766 | 3300028379 | Bacteria | 7587 |
| 547 | Ga0268266_10051335 | 3300028379 | Bacteria | 3539 |
| 548 | Ga0268266_10136923 | 3300028379 | Bacteria | 2194 |
| 549 | Ga0268265_10041140 | 3300028380 | Bacteria | 3417 |
| 550 | Ga0268265_10173213 | 3300028380 | Bacteria | 1846 |
| 551 | Ga0268265_10187328 | 3300028380 | Bacteria | 1784 |
| 552 | Ga0268265_10357673 | 3300028380 | Bacteria | 1335 |
| 553 | Ga0268265_10436587 | 3300028380 | Bacteria | 1219 |
| 554 | Ga0268264_10000804 | 3300028381 | Bacteria | 33856 |
| 555 | Ga0268264_10007291 | 3300028381 | Bacteria | 9252 |
| 556 | Ga0268264_10016086 | 3300028381 | Bacteria | 6129 |
| 557 | Ga0268264_10287733 | 3300028381 | Bacteria | 1542 |
| 558 | Ga0265337_1012313 | 3300028556 | Bacteria | 2912 |
| 559 | Ga0265326_10019538 | 3300028558 | Bacteria | 1945 |
| 560 | Ga0265319_1008249 | 3300028563 | Bacteria | 4585 |
| 561 | Ga0265334_10003965 | 3300028573 | Bacteria | 6660 |
| 562 | Ga0265318_10007905 | 3300028577 | Bacteria | 4775 |
| 563 | Ga0265323_10000311 | 3300028653 | Bacteria | 28078 |
| 564 | Ga0265322_10004519 | 3300028654 | Bacteria | 4137 |
| 565 | Ga0265336_10000074 | 3300028666 | Bacteria | 82727 |
| 566 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 567 | Ga0307517_10074853 | 3300028786 | Bacteria | 2979 |
| 568 | Ga0307515_10059363 | 3300028794 | Bacteria | 5483 |
| 569 | Ga0265338_10000137 | 3300028800 | Bacteria | 135705 |
| 570 | Ga0265324_10000684 | 3300029957 | Bacteria | 22772 |
| 571 | Ga0307512_10038614 | 3300030522 | Bacteria | 4014 |
| 572 | Ga0265332_10001022 | 3300031238 | Bacteria | 16531 |
| 573 | Ga0265328_10000061 | 3300031239 | Bacteria | 63197 |
| 574 | Ga0265328_10000305 | 3300031239 | Bacteria | 22931 |
| 575 | Ga0265328_10016966 | 3300031239 | Bacteria | 2826 |
| 576 | Ga0265328_10127456 | 3300031239 | Bacteria | 951 |
| 577 | Ga0265320_10025025 | 3300031240 | Bacteria | 3145 |
| 578 | Ga0265329_10005533 | 3300031242 | Bacteria | 5096 |
| 579 | Ga0265329_10007066 | 3300031242 | Bacteria | 4379 |
| 580 | Ga0265340_10111001 | 3300031247 | Bacteria | 1268 |
| 581 | Ga0265331_10001445 | 3300031250 | Bacteria | 17455 |
| 582 | Ga0265331_10001600 | 3300031250 | Bacteria | 16533 |
| 583 | Ga0265327_10013516 | 3300031251 | Bacteria | 5418 |
| 584 | Ga0265327_10016623 | 3300031251 | Bacteria | 4662 |
| 585 | Ga0265316_10001750 | 3300031344 | Bacteria | 22990 |
| 586 | Ga0265316_10003254 | 3300031344 | Bacteria | 16504 |
| 587 | Ga0307513_10034291 | 3300031456 | Bacteria | 5697 |
| 588 | Ga0307509_10003945 | 3300031507 | Bacteria | 21884 |
| 589 | Ga0307509_10291622 | 3300031507 | Bacteria | 1386 |
| 590 | Ga0307508_10267428 | 3300031616 | Bacteria | 1304 |
| 591 | Ga0307514_10056229 | 3300031649 | Bacteria | 3021 |
| 592 | Ga0316575_10065222 | 3300031665 | Bacteria | 1458 |
| 593 | Ga0265314_10003069 | 3300031711 | Bacteria | 16462 |
| 594 | Ga0265342_10117254 | 3300031712 | Bacteria | 1502 |
| 595 | Ga0316576_10019077 | 3300031727 | Bacteria | 4695 |
| 596 | Ga0307516_10285369 | 3300031730 | Bacteria | 1331 |
| 597 | Ga0307405_10200013 | 3300031731 | Bacteria | 1450 |
| 598 | Ga0307518_10086710 | 3300031838 | Bacteria | 2256 |
| 599 | Ga0307406_10083326 | 3300031901 | Bacteria | 2132 |
| 600 | Ga0307406_10192287 | 3300031901 | Bacteria | 1495 |
| 601 | Ga0307406_10226588 | 3300031901 | Bacteria | 1393 |
| 602 | Ga0307414_10372349 | 3300032004 | Bacteria | 1232 |
| 603 | Ga0307415_100160411 | 3300032126 | Bacteria | 1742 |
| 604 | Ga0307510_10000779 | 3300033180 | Bacteria | 32991 |
| 605 | Ga0307510_10007951 | 3300033180 | Bacteria | 12621 |
| 606 | Ga0307510_10011080 | 3300033180 | Bacteria | 10717 |
| 607 | Ga0373930_0003689 | 3300034816 | Bacteria | 2449 |
| 608 | Ga0316574_0000392 | 3300035398 | Bacteria | 17117 |
| 609 | Ga0316574_0048385 | 3300035398 | Bacteria | 2640 |
| 610 | Ga0373931_0014394 | 3300035691 | Bacteria | 3865 |
| 611 | Ga0373931_0066820 | 3300035691 | Bacteria | 1952 |
| 612 | Ga0373931_0084598 | 3300035691 | Bacteria | 1757 |
| 613 | Ga0373927_0018763 | 3300035695 | Bacteria | 4538 |
| 614 | Ga0373927_0038026 | 3300035695 | Bacteria | 3126 |
| 615 | Ga0373927_0136066 | 3300035695 | Bacteria | 1606 |
| 616 | Ga0373927_0172204 | 3300035695 | Bacteria | 1419 |
| 617 | Ga0373947_0001290 | 3300035725 | Bacteria | 15432 |
| 618 | Ga0373947_0348930 | 3300035725 | Bacteria | 993 |
| 619 | Ga0373937_0146484 | 3300036401 | Bacteria | 2211 |
| 620 | Ga0316582_0047808 | 3300036647 | Bacteria | 2703 |
| 621 | Ga0395898_0039339 | 3300037466 | Bacteria | 4681 |
| 622 | Ga0395898_0131235 | 3300037466 | Bacteria | 2399 |
| 623 | Ga0395905_0029346 | 3300037471 | Bacteria | 5182 |
| 624 | Ga0316581_0013616 | 3300037588 | Bacteria | 2308 |
| 625 | Ga0395901_0067826 | 3300038443 | Bacteria | 3716 |
| 626 | Ga0400487_40084 | 3300039110 | Bacteria | 6241 |
| 627 | Ga0436363_0046265 | 3300039450 | Bacteria | 1015 |
| 628 | Ga0439465_0099112 | 3300041413 | Bacteria | 1005 |
| 629 | Ga0451793_1474675 | 3300041452 | Bacteria | 958 |
| 630 | Ga0439448_0016450 | 3300042005 | Bacteria | 2251 |
| 631 | Ga0439459_0010244 | 3300042438 | Bacteria | 1632 |
| 632 | Ga0451577_0006026 | 3300042876 | Bacteria | 12205 |
| 633 | Ga0451577_0037073 | 3300042876 | Bacteria | 4389 |
| 634 | Ga0451577_0067510 | 3300042876 | Bacteria | 3189 |
| 635 | Ga0451577_0084294 | 3300042876 | Bacteria | 2836 |
| 636 | Ga0466972_0000303 | 3300044658 | Bacteria | 29316 |
| 637 | Ga0466972_0011092 | 3300044658 | Bacteria | 4522 |
| 638 | Ga0453683_0010984 | 3300044673 | Bacteria | 5987 |
| 639 | Ga0453683_0062673 | 3300044673 | Bacteria | 2324 |
| 640 | Ga0453683_0062726 | 3300044673 | Bacteria | 2323 |
| 641 | Ga0453683_0319146 | 3300044673 | Bacteria | 995 |
| 642 | Ga0466965_0046472 | 3300044683 | Bacteria | 2149 |
| 643 | Ga0466966_0001947 | 3300044684 | Bacteria | 13360 |
| 644 | Ga0466966_0008904 | 3300044684 | Bacteria | 6649 |
| 645 | Ga0466961_0028359 | 3300044693 | Bacteria | 3599 |
| 646 | Ga0466964_0004069 | 3300044706 | Bacteria | 5380 |
| 647 | Ga0453684_0006586 | 3300044712 | Bacteria | 21968 |
| 648 | Ga0453684_0006667 | 3300044712 | Bacteria | 21798 |
| 649 | Ga0453684_0010078 | 3300044712 | Bacteria | 16238 |
| 650 | Ga0453684_0084806 | 3300044712 | Bacteria | 3939 |
| 651 | Ga0453684_0092451 | 3300044712 | Bacteria | 3729 |
| 652 | Ga0453684_0115171 | 3300044712 | Bacteria | 3257 |
| 653 | Ga0453684_0848870 | 3300044712 | Bacteria | 981 |
| 654 | Ga0466971_0016619 | 3300044719 | Bacteria | 3250 |
| 655 | Ga0466970_0025629 | 3300044765 | Bacteria | 3088 |
| 656 | Ga0466970_0026243 | 3300044765 | Bacteria | 3053 |
| 657 | Ga0466957_0114111 | 3300044842 | Bacteria | 1716 |
| 658 | Ga0466960_0079810 | 3300044901 | Bacteria | 1646 |
| 659 | Ga0466959_0000006 | 3300045049 | Bacteria | 192678 |
| 660 | Ga0451576_0002250 | 3300045051 | Bacteria | 29531 |
| 661 | Ga0451576_0059005 | 3300045051 | Bacteria | 4007 |
| 662 | Ga0466958_0020205 | 3300045836 | Bacteria | 3883 |
| 663 | Ga0466958_0179957 | 3300045836 | Bacteria | 1341 |
| 664 | Ga0495617_002531 | 3300046452 | Bacteria | 7222 |
| 665 | Ga0495627_000264 | 3300046453 | Bacteria | 53754 |
| 666 | Ga0495592_0000477 | 3300046454 | Bacteria | 29375 |
| 667 | Ga0495603_0001659 | 3300046455 | Bacteria | 13046 |
| 668 | Ga0495603_0004325 | 3300046455 | Bacteria | 8473 |
| 669 | Ga0495629_0015731 | 3300046459 | Bacteria | 5431 |
| 670 | Ga0495629_0244840 | 3300046459 | Bacteria | 1234 |
| 671 | Ga0495638_0032968 | 3300046460 | Bacteria | 3314 |
| 672 | Ga0495638_0146501 | 3300046460 | Bacteria | 1373 |
| 673 | Ga0495651_0161867 | 3300046462 | Bacteria | 1602 |
| 674 | Ga0495580_0011691 | 3300046472 | Bacteria | 6784 |
| 675 | Ga0495580_0123323 | 3300046472 | Bacteria | 1798 |
| 676 | Ga0495582_0003787 | 3300046473 | Bacteria | 8521 |
| 677 | Ga0495582_0042988 | 3300046473 | Bacteria | 2488 |
| 678 | Ga0495639_0009431 | 3300046475 | Bacteria | 4187 |
| 679 | Ga0495639_0058898 | 3300046475 | Bacteria | 1758 |
| 680 | Ga0495585_0023997 | 3300046492 | Bacteria | 3498 |
| 681 | Ga0495585_0113881 | 3300046492 | Bacteria | 1436 |
| 682 | Ga0495594_0062838 | 3300046499 | Bacteria | 2056 |
| 683 | Ga0495594_0101364 | 3300046499 | Bacteria | 1620 |
| 684 | Ga0495596_0005892 | 3300046500 | Bacteria | 5723 |
| 685 | Ga0495606_0003543 | 3300046507 | Bacteria | 16488 |
| 686 | Ga0495616_0002509 | 3300046513 | Bacteria | 12138 |
| 687 | Ga0495631_0072644 | 3300046518 | Bacteria | 1486 |
| 688 | Ga0495632_0000326 | 3300046519 | Bacteria | 45910 |
| 689 | Ga0495637_0000299 | 3300046520 | Bacteria | 38328 |
| 690 | Ga0495637_0000636 | 3300046520 | Bacteria | 24606 |
| 691 | Ga0495648_0001787 | 3300046524 | Bacteria | 20689 |
| 692 | Ga0495652_0287261 | 3300046529 | Bacteria | 1202 |
| 693 | Ga0495622_0008847 | 3300046557 | Bacteria | 4662 |
| 694 | Ga0495633_0152413 | 3300046558 | Bacteria | 1067 |
| 695 | Ga0495656_0062004 | 3300046615 | Bacteria | 1634 |
| 696 | Ga0495656_0076095 | 3300046615 | Bacteria | 1503 |
| 697 | Ga0495668_0005067 | 3300046616 | Bacteria | 9069 |
| 698 | Ga0495625_0004643 | 3300046660 | Bacteria | 12900 |
| 699 | Ga0495625_0034589 | 3300046660 | Bacteria | 3728 |
| 700 | Ga0495625_0184301 | 3300046660 | Bacteria | 1386 |
| 701 | Ga0495625_0244662 | 3300046660 | Bacteria | 1166 |
| 702 | Ga0495661_0002717 | 3300046665 | Bacteria | 13485 |
| 703 | Ga0495661_0026583 | 3300046665 | Bacteria | 3727 |
| 704 | Ga0495646_0257242 | 3300046680 | Bacteria | 934 |
| 705 | Ga0495647_0069054 | 3300046681 | Bacteria | 1411 |
| 706 | Ga0495669_0003990 | 3300046684 | Bacteria | 6074 |
| 707 | Ga0495613_0001486 | 3300046689 | Bacteria | 17866 |
| 708 | Ga0495670_0124107 | 3300046691 | Bacteria | 1343 |
| 709 | Ga0495671_0090522 | 3300046692 | Bacteria | 1497 |
| 710 | Ga0495649_0151045 | 3300046694 | Bacteria | 1220 |
| 711 | Ga0495581_0040886 | 3300047315 | Bacteria | 2682 |
| 712 | Ga0495672_0008975 | 3300047320 | Bacteria | 7300 |
| 713 | Ga0495672_0097545 | 3300047320 | Bacteria | 1600 |
| 714 | Ga0495672_0191705 | 3300047320 | Bacteria | 1027 |
| 715 | Ga0495683_0010558 | 3300047323 | Bacteria | 4873 |
| 716 | Ga0495677_0015067 | 3300047445 | Bacteria | 2810 |
| 717 | Ga0495681_0000238 | 3300047470 | Bacteria | 45615 |
| 718 | Ga0495686_0001767 | 3300047472 | Bacteria | 22109 |
| 719 | Ga0495686_0136371 | 3300047472 | Bacteria | 1451 |
| 720 | Ga0495593_0000446 | 3300047673 | Bacteria | 23131 |
| 721 | Ga0495593_0092444 | 3300047673 | Bacteria | 1557 |
| 722 | Ga0495614_0119755 | 3300048089 | Bacteria | 1160 |
| 723 | Ga0496100_0005795 | 3300048903 | Bacteria | 6681 |
| 724 | Ga0496100_0025224 | 3300048903 | Bacteria | 3634 |
| 725 | Ga0496101_0010103 | 3300048904 | Bacteria | 6224 |
| 726 | Ga0496101_0019033 | 3300048904 | Bacteria | 4679 |
| 727 | Ga0496102_0011856 | 3300048905 | Bacteria | 7524 |
| 728 | Ga0496102_0201977 | 3300048905 | Bacteria | 1874 |
| 729 | Ga0496102_0254822 | 3300048905 | Bacteria | 1654 |
| 730 | Ga0496103_0140383 | 3300048906 | Bacteria | 1545 |
| 731 | Ga0496104_0015566 | 3300048907 | Bacteria | 6891 |
| 732 | Ga0496104_0022192 | 3300048907 | Bacteria | 5830 |
| 733 | Ga0496104_0186947 | 3300048907 | Bacteria | 1982 |
| 734 | Ga0496105_0026038 | 3300048908 | Bacteria | 4767 |
| 735 | Ga0496105_0029578 | 3300048908 | Bacteria | 4484 |
| 736 | Ga0496106_0005656 | 3300048909 | Bacteria | 9248 |
| 737 | Ga0496106_0013363 | 3300048909 | Bacteria | 6061 |
| 738 | Ga0496106_0032016 | 3300048909 | Bacteria | 3919 |
| 739 | Ga0496106_0119673 | 3300048909 | Bacteria | 2057 |
| 740 | Ga0496106_0230865 | 3300048909 | Bacteria | 1477 |
| 741 | Ga0496107_0032512 | 3300048910 | Bacteria | 3729 |
| 742 | Ga0496107_0036371 | 3300048910 | Bacteria | 3532 |
| 743 | Ga0496107_0051625 | 3300048910 | Bacteria | 2966 |
| 744 | Ga0496108_0008883 | 3300048911 | Bacteria | 8146 |
| 745 | Ga0496108_0035589 | 3300048911 | Bacteria | 4140 |
| 746 | Ga0496108_0051166 | 3300048911 | Bacteria | 3460 |
| 747 | Ga0496108_0070341 | 3300048911 | Unclassified | 2953 |
| 748 | Ga0496109_0003474 | 3300048912 | Bacteria | 13156 |
| 749 | Ga0496109_0035502 | 3300048912 | Unclassified | 4498 |
| 750 | Ga0496109_0144708 | 3300048912 | Bacteria | 2223 |
| 751 | Ga0496109_0243037 | 3300048912 | Bacteria | 1694 |
| 752 | Ga0496110_0013188 | 3300048913 | Bacteria | 6824 |
| 753 | Ga0496110_0117190 | 3300048913 | Bacteria | 2398 |
| 754 | Ga0496110_0157635 | 3300048913 | Bacteria | 2057 |
| 755 | Ga0496110_0203112 | 3300048913 | Bacteria | 1801 |
| 756 | Ga0496111_0135494 | 3300048914 | Bacteria | 1824 |
| 757 | Ga0496111_0291033 | 3300048914 | Bacteria | 1211 |
| 758 | Ga0496112_0000055 | 3300048915 | Bacteria | 78086 |
| 759 | Ga0496112_0009509 | 3300048915 | Bacteria | 8765 |
| 760 | Ga0496112_0065158 | 3300048915 | Unclassified | 3595 |
| 761 | Ga0496112_0294394 | 3300048915 | Bacteria | 1569 |
| 762 | Ga0496112_0360210 | 3300048915 | Bacteria | 1396 |
| 763 | Ga0496112_0399392 | 3300048915 | Bacteria | 1314 |
| 764 | Ga0496112_0400274 | 3300048915 | Bacteria | 1313 |
| 765 | Ga0496113_0051065 | 3300048916 | Bacteria | 3085 |
| 766 | Ga0496113_0053156 | 3300048916 | Bacteria | 3028 |
| 767 | Ga0496113_0074739 | 3300048916 | Bacteria | 2584 |
| 768 | Ga0496113_0175206 | 3300048916 | Bacteria | 1699 |
| 769 | Ga0496114_0001073 | 3300048917 | Bacteria | 20576 |
| 770 | Ga0496114_0002928 | 3300048917 | Bacteria | 13087 |
| 771 | Ga0496114_0060355 | 3300048917 | Bacteria | 3169 |
| 772 | Ga0496114_0138873 | 3300048917 | Bacteria | 2103 |
| 773 | Ga0496115_0005146 | 3300048918 | Bacteria | 9513 |
| 774 | Ga0496115_0043332 | 3300048918 | Bacteria | 3589 |
| 775 | Ga0496115_0316692 | 3300048918 | Bacteria | 1277 |
| 776 | Ga0496116_0000761 | 3300048919 | Bacteria | 40895 |
| 777 | Ga0496119_0086096 | 3300048922 | Bacteria | 1797 |
| 778 | Ga0496121_0035863 | 3300048924 | Bacteria | 4432 |
| 779 | Ga0496121_0078506 | 3300048924 | Bacteria | 2624 |
| 780 | Ga0496125_0091688 | 3300048928 | Bacteria | 2275 |
| 781 | Ga0496126_0018245 | 3300048929 | Bacteria | 6960 |
| 782 | Ga0496126_0060848 | 3300048929 | Bacteria | 3394 |
| 783 | Ga0496126_0061650 | 3300048929 | Bacteria | 3368 |
| 784 | Ga0496126_0466137 | 3300048929 | Bacteria | 1014 |
| 785 | Ga0501032_0097298 | 3300049569 | Bacteria | 1951 |
| 786 | Ga0501036_0029531 | 3300049572 | Bacteria | 4631 |
| 787 | Ga0501036_0058510 | 3300049572 | Bacteria | 3265 |
| 788 | Ga0501036_0118227 | 3300049572 | Bacteria | 2238 |
| 789 | Ga0501036_0392298 | 3300049572 | Bacteria | 1158 |
| 790 | Ga0501037_0330602 | 3300049573 | Bacteria | 1054 |
| 791 | Ga0501038_0222595 | 3300049574 | Bacteria | 1505 |
| 792 | Ga0501039_0030209 | 3300049575 | Bacteria | 4177 |
| 793 | Ga0501039_0044907 | 3300049575 | Bacteria | 3413 |
| 794 | Ga0501039_0149845 | 3300049575 | Bacteria | 1833 |
| 795 | Ga0501040_0018011 | 3300049576 | Bacteria | 4689 |
| 796 | Ga0501040_0033501 | 3300049576 | Bacteria | 3480 |
| 797 | Ga0501040_0069117 | 3300049576 | Bacteria | 2436 |
| 798 | Ga0501041_0007187 | 3300049577 | Bacteria | 6533 |
| 799 | Ga0501041_0019329 | 3300049577 | Bacteria | 4068 |
| 800 | Ga0501041_0025566 | 3300049577 | Bacteria | 3549 |
| 801 | Ga0501041_0031889 | 3300049577 | Bacteria | 3185 |
| 802 | Ga0501041_0145102 | 3300049577 | Bacteria | 1481 |
| 803 | Ga0501042_0046538 | 3300049578 | Bacteria | 3093 |
| 804 | Ga0501042_0132874 | 3300049578 | Bacteria | 1794 |
| 805 | Ga0501042_0145685 | 3300049578 | Bacteria | 1707 |
| 806 | Ga0501042_0172787 | 3300049578 | Bacteria | 1559 |
| 807 | Ga0501042_0221612 | 3300049578 | Bacteria | 1364 |
| 808 | Ga0501043_0237949 | 3300049579 | Bacteria | 1405 |
| 809 | Ga0501046_0173529 | 3300049580 | Bacteria | 1616 |
| 810 | Ga0501046_0191132 | 3300049580 | Bacteria | 1527 |
| 811 | Ga0501046_0201033 | 3300049580 | Bacteria | 1483 |
| 812 | Ga0501047_0168663 | 3300049581 | Bacteria | 2059 |
| 813 | Ga0501047_0194677 | 3300049581 | Bacteria | 1890 |
| 814 | Ga0501048_0060023 | 3300049582 | Bacteria | 2695 |
| 815 | Ga0501048_0061338 | 3300049582 | Bacteria | 2663 |
| 816 | Ga0501067_0094161 | 3300049583 | Bacteria | 1663 |
| 817 | Ga0501068_0077716 | 3300049584 | Bacteria | 2033 |
| 818 | Ga0501071_0006808 | 3300049587 | Bacteria | 7445 |
| 819 | Ga0501071_0016153 | 3300049587 | Bacteria | 5131 |
| 820 | Ga0501071_0101966 | 3300049587 | Bacteria | 2116 |
| 821 | Ga0501072_0055865 | 3300049588 | Bacteria | 3111 |
| 822 | Ga0501072_0081665 | 3300049588 | Bacteria | 2562 |
| 823 | Ga0501072_0094188 | 3300049588 | Bacteria | 2379 |
| 824 | Ga0501074_0029568 | 3300049590 | Bacteria | 3969 |
| 825 | Ga0501075_0018748 | 3300049591 | Bacteria | 5014 |
| 826 | Ga0501075_0023911 | 3300049591 | Bacteria | 4475 |
| 827 | Ga0501075_0072805 | 3300049591 | Bacteria | 2598 |
| 828 | Ga0501075_0110772 | 3300049591 | Bacteria | 2087 |
| 829 | Ga0501075_0175378 | 3300049591 | Bacteria | 1636 |
| 830 | Ga0501076_0086089 | 3300049592 | Bacteria | 2525 |
| 831 | Ga0501076_0132128 | 3300049592 | Bacteria | 2024 |
| 832 | Ga0501076_0135960 | 3300049592 | Bacteria | 1995 |
| 833 | Ga0501076_0281549 | 3300049592 | Bacteria | 1362 |
| 834 | Ga0501077_0017078 | 3300049593 | Bacteria | 4577 |
| 835 | Ga0501077_0052003 | 3300049593 | Bacteria | 2602 |
| 836 | Ga0501077_0065354 | 3300049593 | Bacteria | 2307 |
| 837 | Ga0501077_0166473 | 3300049593 | Bacteria | 1400 |
| 838 | Ga0501079_0099138 | 3300049741 | Bacteria | 2258 |
| 839 | Ga0501079_0201737 | 3300049741 | Bacteria | 1553 |
| 840 | Ga0501079_0221742 | 3300049741 | Bacteria | 1477 |
| 841 | Ga0501079_0467667 | 3300049741 | Bacteria | 991 |
| 842 | Ga0501081_0019985 | 3300049743 | Bacteria | 4463 |
| 843 | Ga0501081_0042249 | 3300049743 | Bacteria | 3123 |
| 844 | Ga0501083_0076336 | 3300049744 | Bacteria | 2224 |
| 845 | Ga0501035_0083881 | 3300049822 | Bacteria | 2811 |
| 846 | Ga0501045_0018756 | 3300049824 | Bacteria | 4924 |
| 847 | Ga0501045_0020480 | 3300049824 | Bacteria | 4725 |
| 848 | Ga0501045_0032303 | 3300049824 | Bacteria | 3793 |
| 849 | Ga0501045_0046763 | 3300049824 | Bacteria | 3151 |
| 850 | Ga0501045_0082546 | 3300049824 | Bacteria | 2370 |
| 851 | Ga0501045_0210803 | 3300049824 | Bacteria | 1447 |
| 852 | Ga0501045_0246539 | 3300049824 | Bacteria | 1330 |
| 853 | nmdc:mga03683_75246_c1 | 3300050489 | Bacteria | 1449 |
| 854 | nmdc:mga03n38_81441_c1 | 3300050490 | Bacteria | 1522 |
| 855 | nmdc:mga06z11_58418_c1 | 3300050494 | Bacteria | 2001 |
| 856 | nmdc:mga04h51_46251_c1 | 3300050495 | Bacteria | 1442 |
| 857 | nmdc:mga07m45_138574_c1 | 3300050496 | Bacteria | 1409 |
| 858 | nmdc:mga05p37_114611_c1 | 3300050507 | Bacteria | 3313 |
| 859 | nmdc:mga05p37_386924_c1 | 3300050507 | Bacteria | 1637 |
| 860 | nmdc:mga0qj67_61672_c1 | 3300050509 | Bacteria | 2977 |
| 861 | nmdc:mga06r32_219083_c1 | 3300050510 | Bacteria | 1891 |
| 862 | nmdc:mga06r32_264328_c1 | 3300050510 | Bacteria | 1708 |
| 863 | nmdc:mga08y16_121135_c1 | 3300050511 | Bacteria | 2722 |
| 864 | nmdc:mga08y16_1696_c1 | 3300050511 | Bacteria | 22329 |
| 865 | nmdc:mga08y16_20259_c1 | 3300050511 | Bacteria | 7019 |
| 866 | nmdc:mga08y16_380809_c1 | 3300050511 | Bacteria | 1119 |
| 867 | nmdc:mga0n895_142481_c1 | 3300050512 | Bacteria | 2426 |
| 868 | nmdc:mga0n895_163658_c1 | 3300050512 | Bacteria | 2256 |
| 869 | nmdc:mga0n895_396533_c1 | 3300050512 | Bacteria | 1396 |
| 870 | nmdc:mga0sz30_17755_c1 | 3300050516 | Bacteria | 2841 |
| 871 | nmdc:mga0sz30_99433_c1 | 3300050516 | Bacteria | 1270 |
| 872 | Ga0495601_0008374 | 3300053077 | Bacteria | 6110 |
| 873 | Ga0495655_0000348 | 3300053083 | Bacteria | 8127 |
| 874 | Ga0495619_0003178 | 3300053085 | Bacteria | 10644 |
| 875 | Ga0500644_0029153 | 3300053088 | Bacteria | 1733 |
| 876 | Ga0500566_0064629 | 3300053094 | Bacteria | 2065 |
| 877 | Ga0500641_0048888 | 3300053096 | Bacteria | 1733 |
| 878 | Ga0500650_0041975 | 3300053098 | Bacteria | 2113 |
| 879 | Ga0500554_001083 | 3300053102 | Bacteria | 5288 |
| 880 | Ga0500562_019336 | 3300053108 | Bacteria | 1762 |
| 881 | Ga0500595_000726 | 3300053119 | Bacteria | 19589 |
| 882 | Ga0500595_010273 | 3300053119 | Bacteria | 3726 |
| 883 | Ga0500652_114312 | 3300053131 | Bacteria | 1128 |
| 884 | Ga0500559_0033238 | 3300053136 | Bacteria | 2220 |
| 885 | Ga0500568_0026140 | 3300053139 | Bacteria | 2452 |
| 886 | Ga0500568_0037166 | 3300053139 | Bacteria | 1977 |
| 887 | Ga0500568_0040551 | 3300053139 | Bacteria | 1873 |
| 888 | Ga0500603_006267 | 3300053150 | Bacteria | 2582 |
| 889 | Ga0500604_0052160 | 3300053151 | Bacteria | 1265 |
| 890 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 891 | Ga0500616_0000964 | 3300053153 | Bacteria | 31200 |
| 892 | Ga0500616_0081393 | 3300053153 | Bacteria | 1626 |
| 893 | Ga0500619_002865 | 3300053154 | Bacteria | 3415 |
| 894 | Ga0500622_0006697 | 3300053156 | Bacteria | 6639 |
| 895 | Ga0500627_0082835 | 3300053158 | Bacteria | 1431 |
| 896 | Ga0500638_008459 | 3300053162 | Bacteria | 4389 |
| 897 | Ga0500636_0066934 | 3300053177 | Bacteria | 2088 |
| 898 | Ga0500637_0000084 | 3300053178 | Bacteria | 33745 |
| 899 | Ga0501084_0011524 | 3300054114 | Bacteria | 7322 |
| 900 | Ga0501084_0078234 | 3300054114 | Bacteria | 2772 |
| 901 | Ga0501084_0175213 | 3300054114 | Bacteria | 1810 |
| 902 | Ga0501084_0272944 | 3300054114 | Bacteria | 1428 |
| 903 | Ga0501084_0386602 | 3300054114 | Bacteria | 1182 |
| 904 | Ga0500661_000602 | 3300055283 | Bacteria | 6739 |
| 905 | Ga0501082_0029246 | 3300060353 | Bacteria | 4745 |
| 906 | Ga0501082_0049411 | 3300060353 | Bacteria | 3627 |
| 907 | Ga0501082_0061696 | 3300060353 | Bacteria | 3227 |
| 908 | Ga0501082_0126941 | 3300060353 | Bacteria | 2212 |
| 909 | Ga0501082_0169902 | 3300060353 | Bacteria | 1895 |
| 910 | Ga0466962_0002323 | 3300061719 | Bacteria | 9011 |
| 911 | Ga0530510_0015111 | 3300061734 | Bacteria | 5453 |
| 912 | Ga0530510_0026282 | 3300061734 | Bacteria | 4166 |
| 913 | Ga0530510_0097764 | 3300061734 | Bacteria | 2146 |
| 914 | Ga0530510_0139829 | 3300061734 | Bacteria | 1783 |
| 915 | Ga0530510_0244270 | 3300061734 | Bacteria | 1337 |
| 916 | 2511412531 | 2511231031 | Bacteria | 6558529 |
| 917 | 2513697397 | 2513237101 | Bacteria | 7952346 |
| 918 | 2524534453 | 2524023228 | Bacteria | 10118060 |
| 919 | 2723843112 | 2721755755 | Bacteria | 8322773 |
| 920 | 2793071181 | 2791355197 | Bacteria | 8420563 |
| 921 | 2793079481 | |||
| 922 | 2874612556 | 2874604998 | Bacteria | 7834745 |
| 923 | 2876813749 | 2876808645 | Bacteria | 8824342 |
| 924 | 2879118002 | 2879110137 | Bacteria | 8907982 |
| 925 | 2889033587 | 2889033259 | Bacteria | 9099371 |
| 926 | 2904705749 | |||
| 927 | 2906611430 | |||
| 928 | 2909044149 | 2909042592 | Bacteria | 6499737 |
| 929 | 2922366957 | 2922361189 | Bacteria | 7436256 |
| 930 | 2922390266 | 2922386360 | Bacteria | 7017218 |
| 931 | 2922427928 | |||
| 932 | 2928535604 | 2928531327 | Bacteria | 5101314 |
| 933 | 8002061099 | 8002060224 | Bacteria | 4026565 |
| 934 | 8006966492 | 8006964411 | Bacteria | 8966052 |
| 935 | 8006989318 | 8006984368 | Bacteria | 9651211 |
| 936 | 8006997802 | 8006994254 | Bacteria | 8309700 |
| 937 | 8019559510 | 8019555841 | Bacteria | 9642137 |
| 938 | 8019569613 | 8019565922 | Bacteria | 9639779 |
| 939 | 8056570726 | 8056569372 | Bacteria | 5997322 |
| 940 | 8056674837 | 8056673599 | Bacteria | 7871253 |
| 941 | Ga0070683_100091044 | |||
| 942 | MBSR1b_contig_4107868 | |||
| 943 | JGI24737J22298_10066822 | |||
| 944 | JGI24748J21848_1003601 | |||
| 945 | JGI24751J29686_10011764 | |||
| 946 | JGI25406J46586_10000168 | |||
| 947 | JGI25406J46586_10015153 | |||
| 948 | JGI25153J46596_10005034 | |||
| 949 | rootH1_10148202 | |||
| 950 | JGI25404J52841_10003367 | |||
| 951 | Ga0065165_1005839 | |||
| 952 | Ga0065715_10149744 | |||
| 953 | Ga0070658_10007026 | |||
| 954 | Ga0070658_10074612 | |||
| 955 | Ga0070676_10000177 | |||
| 956 | Ga0070676_10006855 | |||
| 957 | Ga0070676_10183365 | |||
| 958 | Ga0070683_100003236 | |||
| 959 | Ga0070683_100098872 | |||
| 960 | Ga0070690_100000161 | |||
| 961 | Ga0070690_100020167 | |||
| 962 | Ga0070690_100251059 | |||
| 963 | Ga0070690_100259359 | |||
| 964 | Ga0070670_100017668 | |||
| 965 | Ga0070670_100034365 | |||
| 966 | Ga0070677_10011383 | |||
| 967 | Ga0070677_10047505 | |||
| 968 | Ga0068869_100001688 | |||
| 969 | Ga0068869_100004961 | |||
| 970 | Ga0068869_100075691 | |||
| 971 | Ga0068869_100239963 | |||
| 972 | Ga0068869_100387811 | |||
| 973 | Ga0070666_10000673 | |||
| 974 | Ga0070666_10028516 | |||
| 975 | Ga0070666_10035673 | |||
| 976 | Ga0070680_100071083 | |||
| 977 | Ga0070680_100078816 | |||
| 978 | Ga0070680_100171282 | |||
| 979 | Ga0070682_100065884 | |||
| 980 | Ga0068868_100005707 | |||
| 981 | Ga0068868_100017937 | |||
| 982 | Ga0068868_100098697 | |||
| 983 | Ga0068868_100153156 | |||
| 984 | Ga0070660_100000841 | |||
| 985 | Ga0070660_100483122 | |||
| 986 | Ga0070660_100512165 | |||
| 987 | Ga0070689_100000709 | |||
| 988 | Ga0070689_100016859 | |||
| 989 | Ga0070689_100269226 | |||
| 990 | Ga0070691_10146074 | |||
| 991 | Ga0070687_100000011 | |||
| 992 | Ga0070687_100034677 | |||
| 993 | Ga0070687_100039822 | |||
| 994 | Ga0070661_100001135 | |||
| 995 | Ga0070661_100006263 | |||
| 996 | Ga0070661_100077201 | |||
| 997 | Ga0070661_100105908 | |||
| 998 | Ga0070692_10132575 | |||
| 999 | Ga0070668_100005064 | |||
| 1000 | Ga0070668_100293763 | |||
| 1001 | Ga0070668_100551171 | |||
| 1002 | Ga0070669_100006355 | |||
| 1003 | Ga0070669_100014101 | |||
| 1004 | Ga0070675_100000821 | |||
| 1005 | Ga0070675_100002151 | |||
| 1006 | Ga0070675_100170775 | |||
| 1007 | Ga0070675_100314828 | |||
| 1008 | Ga0070671_100001021 | |||
| 1009 | Ga0070674_100002542 | |||
| 1010 | Ga0070674_100003166 | |||
| 1011 | Ga0070674_100182181 | |||
| 1012 | Ga0070674_100302054 | |||
| 1013 | Ga0070673_100003576 | |||
| 1014 | Ga0070673_100005261 | |||
| 1015 | Ga0070688_100001830 | |||
| 1016 | Ga0070688_100332909 | |||
| 1017 | Ga0070659_100000150 | |||
| 1018 | Ga0070659_100378629 | |||
| 1019 | Ga0070667_100005396 | |||
| 1020 | Ga0070667_100115137 | |||
| 1021 | Ga0070709_10071872 | |||
| 1022 | Ga0070714_100435311 | |||
| 1023 | Ga0070713_100217617 | |||
| 1024 | Ga0070701_10002949 | |||
| 1025 | Ga0070701_10035114 | |||
| 1026 | Ga0070711_100062091 | |||
| 1027 | Ga0070705_100000387 | |||
| 1028 | Ga0070694_100182487 | |||
| 1029 | Ga0070694_100345984 | |||
| 1030 | Ga0070663_100000694 | |||
| 1031 | Ga0070663_100013602 | |||
| 1032 | Ga0070663_100056093 | |||
| 1033 | Ga0070663_100065062 | |||
| 1034 | Ga0070663_100097899 | |||
| 1035 | Ga0070663_100159847 | |||
| 1036 | Ga0070663_100161774 | |||
| 1037 | Ga0070663_100222666 | |||
| 1038 | Ga0070678_100022351 | |||
| 1039 | Ga0070678_100024393 | |||
| 1040 | Ga0070678_100042538 | |||
| 1041 | Ga0070678_100153543 | |||
| 1042 | Ga0070678_100485616 | |||
| 1043 | Ga0070678_100585302 | |||
| 1044 | Ga0070662_100000201 | |||
| 1045 | Ga0070662_100015950 | |||
| 1046 | Ga0070662_100022033 | |||
| 1047 | Ga0070681_10030752 | |||
| 1048 | Ga0070681_10237815 | |||
| 1049 | Ga0068867_100000832 | |||
| 1050 | Ga0068867_100156807 | |||
| 1051 | Ga0070685_10003362 | |||
| 1052 | Ga0070685_10044247 | |||
| 1053 | Ga0070706_100256463 | |||
| 1054 | Ga0070707_100423860 | |||
| 1055 | Ga0070699_100036589 | |||
| 1056 | Ga0070699_100079053 | |||
| 1057 | Ga0070699_100192435 | |||
| 1058 | Ga0070679_100022047 | |||
| 1059 | Ga0070679_100068280 | |||
| 1060 | Ga0070684_100036825 | |||
| 1061 | Ga0068853_100005121 | |||
| 1062 | Ga0068853_100358276 | |||
| 1063 | Ga0068853_100435278 | |||
| 1064 | Ga0070672_100003813 | |||
| 1065 | Ga0070672_100010911 | |||
| 1066 | Ga0070672_100045754 | |||
| 1067 | Ga0070686_100001626 | |||
| 1068 | Ga0070686_100082537 | |||
| 1069 | Ga0070686_100246696 | |||
| 1070 | Ga0070695_100046693 | |||
| 1071 | Ga0070695_100055370 | |||
| 1072 | Ga0070696_100067161 | |||
| 1073 | Ga0070693_100017104 | |||
| 1074 | Ga0070693_100027832 | |||
| 1075 | Ga0070693_100027871 | |||
| 1076 | Ga0070693_100031872 | |||
| 1077 | Ga0070693_100068195 | |||
| 1078 | Ga0070693_100112553 | |||
| 1079 | Ga0070665_100020348 | |||
| 1080 | Ga0070665_100023807 | |||
| 1081 | Ga0070665_100032508 | |||
| 1082 | Ga0070665_100177036 | |||
| 1083 | Ga0070665_100488953 | |||
| 1084 | Ga0070665_100641719 | |||
| 1085 | Ga0070704_100048327 | |||
| 1086 | Ga0068855_100007063 | |||
| 1087 | Ga0068855_100013690 | |||
| 1088 | Ga0068855_100019007 | |||
| 1089 | Ga0068855_100054408 | |||
| 1090 | Ga0068855_100061422 | |||
| 1091 | Ga0068855_100119768 | |||
| 1092 | Ga0068855_100184199 | |||
| 1093 | Ga0070664_100000409 | |||
| 1094 | Ga0070664_100011714 | |||
| 1095 | Ga0070664_100031009 | |||
| 1096 | Ga0070664_100124158 | |||
| 1097 | Ga0068857_100000045 | |||
| 1098 | Ga0068857_100019250 | |||
| 1099 | Ga0068857_100165300 | |||
| 1100 | Ga0068857_100264293 | |||
| 1101 | Ga0068854_100000943 | |||
| 1102 | Ga0068854_100004958 | |||
| 1103 | Ga0068854_100377213 | |||
| 1104 | Ga0068856_100000969 | |||
| 1105 | Ga0068856_100070577 | |||
| 1106 | Ga0068856_100110301 | |||
| 1107 | Ga0068856_100331805 | |||
| 1108 | Ga0070702_100074559 | |||
| 1109 | Ga0070702_100087054 | |||
| 1110 | Ga0070702_100107814 | |||
| 1111 | Ga0070702_100188045 | |||
| 1112 | Ga0070702_100322842 | |||
| 1113 | Ga0068852_100010493 | |||
| 1114 | Ga0068852_100022851 | |||
| 1115 | Ga0068852_100073144 | |||
| 1116 | Ga0068852_100287366 | |||
| 1117 | Ga0068852_100740716 | |||
| 1118 | Ga0068852_100745225 | |||
| 1119 | Ga0068859_100002138 | |||
| 1120 | Ga0068859_100006419 | |||
| 1121 | Ga0068859_100187733 | |||
| 1122 | Ga0068864_100001397 | |||
| 1123 | Ga0068864_100034925 | |||
| 1124 | Ga0068864_100092449 | |||
| 1125 | Ga0068866_10001396 | |||
| 1126 | Ga0068866_10067040 | |||
| 1127 | Ga0068861_100000449 | |||
| 1128 | Ga0068861_100059201 | |||
| 1129 | Ga0068861_100200551 | |||
| 1130 | Ga0068851_10002385 | |||
| 1131 | Ga0068870_10000840 | |||
| 1132 | Ga0068870_10159417 | |||
| 1133 | Ga0068863_100004325 | |||
| 1134 | Ga0068863_100216746 | |||
| 1135 | Ga0068858_100002574 | |||
| 1136 | Ga0068858_100020070 | |||
| 1137 | Ga0068858_100042918 | |||
| 1138 | Ga0068858_100053290 | |||
| 1139 | Ga0068858_100356005 | |||
| 1140 | Ga0068860_100006384 | |||
| 1141 | Ga0068860_100068705 | |||
| 1142 | Ga0068860_100160156 | |||
| 1143 | Ga0068860_100194817 | |||
| 1144 | Ga0068860_100205880 | |||
| 1145 | Ga0068860_100397843 | |||
| 1146 | Ga0068862_100003062 | |||
| 1147 | Ga0068862_100135682 | |||
| 1148 | Ga0081455_10001565 | |||
| 1149 | Ga0081455_10004842 | |||
| 1150 | Ga0081455_10005486 | |||
| 1151 | Ga0081455_10023977 | |||
| 1152 | Ga0081455_10025617 | |||
| 1153 | Ga0081455_10109038 | |||
| 1154 | Ga0081538_10051765 | |||
| 1155 | Ga0081540_1000076 | |||
| 1156 | Ga0081540_1000083 | |||
| 1157 | Ga0081540_1000780 | |||
| 1158 | Ga0081540_1001934 | |||
| 1159 | Ga0081540_1002260 | |||
| 1160 | Ga0081540_1004844 | |||
| 1161 | Ga0081540_1006350 | |||
| 1162 | Ga0081540_1006556 | |||
| 1163 | Ga0081540_1042269 | |||
| 1164 | Ga0081539_10000040 | |||
| 1165 | Ga0081539_10002516 | |||
| 1166 | Ga0081539_10052497 | |||
| 1167 | Ga0075365_10065664 | |||
| 1168 | Ga0075365_10107719 | |||
| 1169 | Ga0075368_10012932 | |||
| 1170 | Ga0075363_100213502 | |||
| 1171 | Ga0070716_100313125 | |||
| 1172 | Ga0070712_100017293 | |||
| 1173 | Ga0075369_10012643 | |||
| 1174 | Ga0075366_10193729 | |||
| 1175 | Ga0097621_100013398 | |||
| 1176 | Ga0097621_100059494 | |||
| 1177 | Ga0097621_100124098 | |||
| 1178 | Ga0068871_100002264 | |||
| 1179 | Ga0075428_100181146 | |||
| 1180 | Ga0075428_100211480 | |||
| 1181 | Ga0075430_100048637 | |||
| 1182 | Ga0075431_100166626 | |||
| 1183 | Ga0075433_10423792 | |||
| 1184 | Ga0075434_100150993 | |||
| 1185 | Ga0075434_100282382 | |||
| 1186 | Ga0075434_100308820 | |||
| 1187 | Ga0068865_100000468 | |||
| 1188 | Ga0068865_100006360 | |||
| 1189 | Ga0068865_100009816 | |||
| 1190 | Ga0068865_100127092 | |||
| 1191 | Ga0068865_100391653 | |||
| 1192 | Ga0097620_100002138 | |||
| 1193 | Ga0097620_100006418 | |||
| 1194 | Ga0097620_100187745 | |||
| 1195 | Ga0099794_10002060 | |||
| 1196 | Ga0099795_10105581 | |||
| 1197 | Ga0105240_10000911 | |||
| 1198 | Ga0105240_10007148 | |||
| 1199 | Ga0105240_10040900 | |||
| 1200 | Ga0105240_10043796 | |||
| 1201 | Ga0105240_10348608 | |||
| 1202 | Ga0111539_10005949 | |||
| 1203 | Ga0111539_10034475 | |||
| 1204 | Ga0111539_10233241 | |||
| 1205 | Ga0111539_10292188 | |||
| 1206 | Ga0105245_10000110 | |||
| 1207 | Ga0105245_10048588 | |||
| 1208 | Ga0105245_10341805 | |||
| 1209 | Ga0105247_10000779 | |||
| 1210 | Ga0105247_10085085 | |||
| 1211 | Ga0105247_10292969 | |||
| 1212 | Ga0114129_10079787 | |||
| 1213 | Ga0114129_10337361 | |||
| 1214 | Ga0105243_10001825 | |||
| 1215 | Ga0105243_10331838 | |||
| 1216 | Ga0105241_10000441 | |||
| 1217 | Ga0105241_10016275 | |||
| 1218 | Ga0105241_10045394 | |||
| 1219 | Ga0105241_10245421 | |||
| 1220 | Ga0105242_10003699 | |||
| 1221 | Ga0105242_10007991 | |||
| 1222 | Ga0105242_10016771 | |||
| 1223 | Ga0105242_10084280 | |||
| 1224 | Ga0105248_10007983 | |||
| 1225 | Ga0105248_10008973 | |||
| 1226 | Ga0105248_10132530 | |||
| 1227 | Ga0105248_10356813 | |||
| 1228 | Ga0105237_10004354 | |||
| 1229 | Ga0105237_10016097 | |||
| 1230 | Ga0105237_10034338 | |||
| 1231 | Ga0105237_10038469 | |||
| 1232 | Ga0105237_10152385 | |||
| 1233 | Ga0105237_10548970 | |||
| 1234 | Ga0105237_10610675 | |||
| 1235 | Ga0105238_10000246 | |||
| 1236 | Ga0105238_10037628 | |||
| 1237 | Ga0105238_10045861 | |||
| 1238 | Ga0105238_10057078 | |||
| 1239 | Ga0105238_10218265 | |||
| 1240 | Ga0105238_10678085 | |||
| 1241 | Ga0105249_10001617 | |||
| 1242 | Ga0105249_10005056 | |||
| 1243 | Ga0105249_10056577 | |||
| 1244 | Ga0105249_10381216 | |||
| 1245 | Ga0105239_10025154 | |||
| 1246 | Ga0105239_10039281 | |||
| 1247 | Ga0105239_10039841 | |||
| 1248 | Ga0105239_10080411 | |||
| 1249 | Ga0105239_10137433 | |||
| 1250 | Ga0105239_10286555 | |||
| 1251 | Ga0105239_10287340 | |||
| 1252 | Ga0105246_10042417 | |||
| 1253 | Ga0105246_10079100 | |||
| 1254 | Ga0157335_1000837 | |||
| 1255 | Ga0157326_1008196 | |||
| 1256 | Ga0157373_10004358 | |||
| 1257 | Ga0157373_10327913 | |||
| 1258 | Ga0157371_10006096 | |||
| 1259 | Ga0157371_10150770 | |||
| 1260 | Ga0157370_10011316 | |||
| 1261 | Ga0157370_10062592 | |||
| 1262 | Ga0157369_10012527 | |||
| 1263 | Ga0157369_10177141 | |||
| 1264 | Ga0157374_10000113 | |||
| 1265 | Ga0157374_10011568 | |||
| 1266 | Ga0157374_10058276 | |||
| 1267 | Ga0157374_10081673 | |||
| 1268 | Ga0157374_10366504 | |||
| 1269 | Ga0157378_10011085 | |||
| 1270 | Ga0157378_10026784 | |||
| 1271 | Ga0157378_10034001 | |||
| 1272 | Ga0157378_10094564 | |||
| 1273 | Ga0157378_10348838 | |||
| 1274 | Ga0163162_10000617 | |||
| 1275 | Ga0163162_10064022 | |||
| 1276 | Ga0163162_10179442 | |||
| 1277 | Ga0163162_10388730 | |||
| 1278 | Ga0163162_10576566 | |||
| 1279 | Ga0157372_10007152 | |||
| 1280 | Ga0157372_10050625 | |||
| 1281 | Ga0157372_10333153 | |||
| 1282 | Ga0157375_10001209 | |||
| 1283 | Ga0157375_10001227 | |||
| 1284 | Ga0157375_10007526 | |||
| 1285 | Ga0157375_10013332 | |||
| 1286 | Ga0157375_10077771 | |||
| 1287 | Ga0157375_10206394 | |||
| 1288 | Ga0163163_10013878 | |||
| 1289 | Ga0163163_10032740 | |||
| 1290 | Ga0163163_10049458 | |||
| 1291 | Ga0163163_10063508 | |||
| 1292 | Ga0157380_10029092 | |||
| 1293 | Ga0157380_10085162 | |||
| 1294 | Ga0157380_10110506 | |||
| 1295 | Ga0157380_10116556 | |||
| 1296 | Ga0157380_10186199 | |||
| 1297 | Ga0157377_10000265 | |||
| 1298 | Ga0157379_10000775 | |||
| 1299 | Ga0157379_10024010 | |||
| 1300 | Ga0157379_10073293 | |||
| 1301 | Ga0157379_10355004 | |||
| 1302 | Ga0157379_10439438 | |||
| 1303 | Ga0157376_10001710 | |||
| 1304 | Ga0157376_10016754 | |||
| 1305 | Ga0157376_10113593 | |||
| 1306 | Ga0209758_1006284 | |||
| 1307 | Ga0209758_1006935 | |||
| 1308 | Ga0207697_10000147 | |||
| 1309 | Ga0207656_10000871 | |||
| 1310 | Ga0207655_1017118 | |||
| 1311 | Ga0207682_10011662 | |||
| 1312 | Ga0207692_10046815 | |||
| 1313 | Ga0207642_10061668 | |||
| 1314 | Ga0207642_10320096 | |||
| 1315 | Ga0207710_10016717 | |||
| 1316 | Ga0207688_10000086 | |||
| 1317 | Ga0207688_10009671 | |||
| 1318 | Ga0207680_10004502 | |||
| 1319 | Ga0207680_10064647 | |||
| 1320 | Ga0207680_10138589 | |||
| 1321 | Ga0207647_10002419 | |||
| 1322 | Ga0207647_10138492 | |||
| 1323 | Ga0207645_10000006 | |||
| 1324 | Ga0207645_10010075 | |||
| 1325 | Ga0207645_10023160 | |||
| 1326 | Ga0207643_10000019 | |||
| 1327 | Ga0207643_10074115 | |||
| 1328 | Ga0207705_10007653 | |||
| 1329 | Ga0207654_10001653 | |||
| 1330 | Ga0207654_10071490 | |||
| 1331 | Ga0207654_10295373 | |||
| 1332 | Ga0207707_10025800 | |||
| 1333 | Ga0207707_10305510 | |||
| 1334 | Ga0207695_10004251 | |||
| 1335 | Ga0207695_10040274 | |||
| 1336 | Ga0207695_10113566 | |||
| 1337 | Ga0207671_10007024 | |||
| 1338 | Ga0207671_10190124 | |||
| 1339 | Ga0207671_10216966 | |||
| 1340 | Ga0207693_10085746 | |||
| 1341 | Ga0207660_10054655 | |||
| 1342 | Ga0207662_10000002 | |||
| 1343 | Ga0207662_10008870 | |||
| 1344 | Ga0207662_10060786 | |||
| 1345 | Ga0207657_10000007 | |||
| 1346 | Ga0207657_10410742 | |||
| 1347 | Ga0207649_10002537 | |||
| 1348 | Ga0207649_10002680 | |||
| 1349 | Ga0207649_10008104 | |||
| 1350 | Ga0207652_10176872 | |||
| 1351 | Ga0207652_10289641 | |||
| 1352 | Ga0207646_10131038 | |||
| 1353 | Ga0207681_10001798 | |||
| 1354 | Ga0207681_10151091 | |||
| 1355 | Ga0207681_10349804 | |||
| 1356 | Ga0207694_10024306 | |||
| 1357 | Ga0207650_10000109 | |||
| 1358 | Ga0207650_10104192 | |||
| 1359 | Ga0207659_10001567 | |||
| 1360 | Ga0207659_10031235 | |||
| 1361 | Ga0207659_10124561 | |||
| 1362 | Ga0207687_10004863 | |||
| 1363 | Ga0207687_10091805 | |||
| 1364 | Ga0207687_10136303 | |||
| 1365 | Ga0207644_10000618 | |||
| 1366 | Ga0207690_10063101 | |||
| 1367 | Ga0207690_10236481 | |||
| 1368 | Ga0207706_10000066 | |||
| 1369 | Ga0207706_10002627 | |||
| 1370 | Ga0207706_10008600 | |||
| 1371 | Ga0207706_10013775 | |||
| 1372 | Ga0207706_10314679 | |||
| 1373 | Ga0207686_10003515 | |||
| 1374 | Ga0207686_10017329 | |||
| 1375 | Ga0207709_10008078 | |||
| 1376 | Ga0207709_10245453 | |||
| 1377 | Ga0207709_10319731 | |||
| 1378 | Ga0207709_10442794 | |||
| 1379 | Ga0207670_10004848 | |||
| 1380 | Ga0207670_10043926 | |||
| 1381 | Ga0207670_10054504 | |||
| 1382 | Ga0207669_10000286 | |||
| 1383 | Ga0207669_10004441 | |||
| 1384 | Ga0207669_10025214 | |||
| 1385 | Ga0207669_10029792 | |||
| 1386 | Ga0207669_10197430 | |||
| 1387 | Ga0207669_10288491 | |||
| 1388 | Ga0207704_10001245 | |||
| 1389 | Ga0207704_10018911 | |||
| 1390 | Ga0207704_10048601 | |||
| 1391 | Ga0207704_10097094 | |||
| 1392 | Ga0207704_10471942 | |||
| 1393 | Ga0207665_10009471 | |||
| 1394 | Ga0207691_10000628 | |||
| 1395 | Ga0207691_10026799 | |||
| 1396 | Ga0207691_10031739 | |||
| 1397 | Ga0207691_10599668 | |||
| 1398 | Ga0207711_10000065 | |||
| 1399 | Ga0207711_10001337 | |||
| 1400 | Ga0207711_10023085 | |||
| 1401 | Ga0207711_10041147 | |||
| 1402 | Ga0207711_10204698 | |||
| 1403 | Ga0207689_10000070 | |||
| 1404 | Ga0207689_10005212 | |||
| 1405 | Ga0207689_10024310 | |||
| 1406 | Ga0207661_10051220 | |||
| 1407 | Ga0207661_10086145 | |||
| 1408 | Ga0207679_10000192 | |||
| 1409 | Ga0207679_10002439 | |||
| 1410 | Ga0207679_10023667 | |||
| 1411 | Ga0207679_10043202 | |||
| 1412 | Ga0207679_10270026 | |||
| 1413 | Ga0207667_10000244 | |||
| 1414 | Ga0207667_10006665 | |||
| 1415 | Ga0207667_10168344 | |||
| 1416 | Ga0207651_10002235 | |||
| 1417 | Ga0207651_10005114 | |||
| 1418 | Ga0207712_10000421 | |||
| 1419 | Ga0207712_10006564 | |||
| 1420 | Ga0207712_10046748 | |||
| 1421 | Ga0207712_10091256 | |||
| 1422 | Ga0207668_10040849 | |||
| 1423 | Ga0207668_10242019 | |||
| 1424 | Ga0207668_10358634 | |||
| 1425 | Ga0207640_10000169 | |||
| 1426 | Ga0207640_10002086 | |||
| 1427 | Ga0207658_10010070 | |||
| 1428 | Ga0207658_10026952 | |||
| 1429 | Ga0207658_10130696 | |||
| 1430 | Ga0207658_10291383 | |||
| 1431 | Ga0207677_10000187 | |||
| 1432 | Ga0207677_10008792 | |||
| 1433 | Ga0207677_10306387 | |||
| 1434 | Ga0207703_10000102 | |||
| 1435 | Ga0207703_10005716 | |||
| 1436 | Ga0207703_10018789 | |||
| 1437 | Ga0207703_10053526 | |||
| 1438 | Ga0207703_10406349 | |||
| 1439 | Ga0207703_10416604 | |||
| 1440 | Ga0207703_10451457 | |||
| 1441 | Ga0207639_10002412 | |||
| 1442 | Ga0207639_10168687 | |||
| 1443 | Ga0207678_10001138 | |||
| 1444 | Ga0207678_10014007 | |||
| 1445 | Ga0207678_10029116 | |||
| 1446 | Ga0207678_10122751 | |||
| 1447 | Ga0207678_10229069 | |||
| 1448 | Ga0207708_10014035 | |||
| 1449 | Ga0207708_10544529 | |||
| 1450 | Ga0207702_10058029 | |||
| 1451 | Ga0207702_10102076 | |||
| 1452 | Ga0207702_10166680 | |||
| 1453 | Ga0207702_10267828 | |||
| 1454 | Ga0207641_10024778 | |||
| 1455 | Ga0207641_10108912 | |||
| 1456 | Ga0207641_10168360 | |||
| 1457 | Ga0207648_10000099 | |||
| 1458 | Ga0207648_10001481 | |||
| 1459 | Ga0207648_10328994 | |||
| 1460 | Ga0207648_10425335 | |||
| 1461 | Ga0207676_10003294 | |||
| 1462 | Ga0207676_10090503 | |||
| 1463 | Ga0207674_10000030 | |||
| 1464 | Ga0207674_10009990 | |||
| 1465 | Ga0207674_10020542 | |||
| 1466 | Ga0207674_10100456 | |||
| 1467 | Ga0207675_100000007 | |||
| 1468 | Ga0207675_100092540 | |||
| 1469 | Ga0207675_100207607 | |||
| 1470 | Ga0207683_10000688 | |||
| 1471 | Ga0207683_10008652 | |||
| 1472 | Ga0207683_10028448 | |||
| 1473 | Ga0207683_10063460 | |||
| 1474 | Ga0207683_10116730 | |||
| 1475 | Ga0207683_10218267 | |||
| 1476 | Ga0207683_10271848 | |||
| 1477 | Ga0207698_10063176 | |||
| 1478 | Ga0207698_10097833 | |||
| 1479 | Ga0207698_10242596 | |||
| 1480 | Ga0209588_1031900 | |||
| 1481 | Ga0209998_10011711 | |||
| 1482 | Ga0207428_10012161 | |||
| 1483 | Ga0265356_1002334 | |||
| 1484 | Ga0268266_10000397 | |||
| 1485 | Ga0268266_10002092 | |||
| 1486 | Ga0268266_10011766 | |||
| 1487 | Ga0268266_10051335 | |||
| 1488 | Ga0268266_10136923 | |||
| 1489 | Ga0268265_10041140 | |||
| 1490 | Ga0268265_10173213 | |||
| 1491 | Ga0268265_10187328 | |||
| 1492 | Ga0268265_10357673 | |||
| 1493 | Ga0268265_10436587 | |||
| 1494 | Ga0268264_10000804 | |||
| 1495 | Ga0268264_10007291 | |||
| 1496 | Ga0268264_10016086 | |||
| 1497 | Ga0268264_10287733 | |||
| 1498 | Ga0265337_1012313 | |||
| 1499 | Ga0265326_10019538 | |||
| 1500 | Ga0265319_1008249 | |||
| 1501 | Ga0265334_10003965 | |||
| 1502 | Ga0265318_10007905 | |||
| 1503 | Ga0265323_10000311 | |||
| 1504 | Ga0265322_10004519 | |||
| 1505 | Ga0265336_10000074 | |||
| 1506 | Ga0307517_10000085 | |||
| 1507 | Ga0307517_10074853 | |||
| 1508 | Ga0307515_10059363 | |||
| 1509 | Ga0265338_10000137 | |||
| 1510 | Ga0265324_10000684 | |||
| 1511 | Ga0307512_10038614 | |||
| 1512 | Ga0265332_10001022 | |||
| 1513 | Ga0265328_10000061 | |||
| 1514 | Ga0265328_10000305 | |||
| 1515 | Ga0265328_10016966 | |||
| 1516 | Ga0265328_10127456 | |||
| 1517 | Ga0265320_10025025 | |||
| 1518 | Ga0265329_10005533 | |||
| 1519 | Ga0265329_10007066 | |||
| 1520 | Ga0265340_10111001 | |||
| 1521 | Ga0265331_10001445 | |||
| 1522 | Ga0265331_10001600 | |||
| 1523 | Ga0265327_10013516 | |||
| 1524 | Ga0265327_10016623 | |||
| 1525 | Ga0265316_10001750 | |||
| 1526 | Ga0265316_10003254 | |||
| 1527 | Ga0307513_10034291 | |||
| 1528 | Ga0307509_10003945 | |||
| 1529 | Ga0307509_10291622 | |||
| 1530 | Ga0307508_10267428 | |||
| 1531 | Ga0307514_10056229 | |||
| 1532 | Ga0316575_10065222 | |||
| 1533 | Ga0265314_10003069 | |||
| 1534 | Ga0265342_10117254 | |||
| 1535 | Ga0316576_10019077 | |||
| 1536 | Ga0307516_10285369 | |||
| 1537 | Ga0307405_10200013 | |||
| 1538 | Ga0307518_10086710 | |||
| 1539 | Ga0307406_10083326 | |||
| 1540 | Ga0307406_10192287 | |||
| 1541 | Ga0307406_10226588 | |||
| 1542 | Ga0307414_10372349 | |||
| 1543 | Ga0307415_100160411 | |||
| 1544 | Ga0307510_10000779 | |||
| 1545 | Ga0307510_10007951 | |||
| 1546 | Ga0307510_10011080 | |||
| 1547 | Ga0373930_0003689 | |||
| 1548 | Ga0316574_0000392 | |||
| 1549 | Ga0316574_0048385 | |||
| 1550 | Ga0373931_0014394 | |||
| 1551 | Ga0373931_0066820 | |||
| 1552 | Ga0373931_0084598 | |||
| 1553 | Ga0373927_0018763 | |||
| 1554 | Ga0373927_0038026 | |||
| 1555 | Ga0373927_0136066 | |||
| 1556 | Ga0373927_0172204 | |||
| 1557 | Ga0373947_0001290 | |||
| 1558 | Ga0373947_0348930 | |||
| 1559 | Ga0373937_0146484 | |||
| 1560 | Ga0316582_0047808 | |||
| 1561 | Ga0395898_0039339 | |||
| 1562 | Ga0395898_0131235 | |||
| 1563 | Ga0395905_0029346 | |||
| 1564 | Ga0316581_0013616 | |||
| 1565 | Ga0395901_0067826 | |||
| 1566 | Ga0400487_40084 | |||
| 1567 | Ga0436363_0046265 | |||
| 1568 | Ga0439465_0099112 | |||
| 1569 | Ga0451793_1474675 | |||
| 1570 | Ga0439448_0016450 | |||
| 1571 | Ga0439459_0010244 | |||
| 1572 | Ga0451577_0006026 | |||
| 1573 | Ga0451577_0037073 | |||
| 1574 | Ga0451577_0067510 | |||
| 1575 | Ga0451577_0084294 | |||
| 1576 | Ga0466972_0000303 | |||
| 1577 | Ga0466972_0011092 | |||
| 1578 | Ga0453683_0010984 | |||
| 1579 | Ga0453683_0062673 | |||
| 1580 | Ga0453683_0062726 | |||
| 1581 | Ga0453683_0319146 | |||
| 1582 | Ga0466965_0046472 | |||
| 1583 | Ga0466966_0001947 | |||
| 1584 | Ga0466966_0008904 | |||
| 1585 | Ga0466961_0028359 | |||
| 1586 | Ga0466964_0004069 | |||
| 1587 | Ga0453684_0006586 | |||
| 1588 | Ga0453684_0006667 | |||
| 1589 | Ga0453684_0010078 | |||
| 1590 | Ga0453684_0084806 | |||
| 1591 | Ga0453684_0092451 | |||
| 1592 | Ga0453684_0115171 | |||
| 1593 | Ga0453684_0848870 | |||
| 1594 | Ga0466971_0016619 | |||
| 1595 | Ga0466970_0025629 | |||
| 1596 | Ga0466970_0026243 | |||
| 1597 | Ga0466957_0114111 | |||
| 1598 | Ga0466960_0079810 | |||
| 1599 | Ga0466959_0000006 | |||
| 1600 | Ga0451576_0002250 | |||
| 1601 | Ga0451576_0059005 | |||
| 1602 | Ga0466958_0020205 | |||
| 1603 | Ga0466958_0179957 | |||
| 1604 | Ga0495617_002531 | |||
| 1605 | Ga0495627_000264 | |||
| 1606 | Ga0495592_0000477 | |||
| 1607 | Ga0495603_0001659 | |||
| 1608 | Ga0495603_0004325 | |||
| 1609 | Ga0495629_0015731 | |||
| 1610 | Ga0495629_0244840 | |||
| 1611 | Ga0495638_0032968 | |||
| 1612 | Ga0495638_0146501 | |||
| 1613 | Ga0495651_0161867 | |||
| 1614 | Ga0495580_0011691 | |||
| 1615 | Ga0495580_0123323 | |||
| 1616 | Ga0495582_0003787 | |||
| 1617 | Ga0495582_0042988 | |||
| 1618 | Ga0495639_0009431 | |||
| 1619 | Ga0495639_0058898 | |||
| 1620 | Ga0495585_0023997 | |||
| 1621 | Ga0495585_0113881 | |||
| 1622 | Ga0495594_0062838 | |||
| 1623 | Ga0495594_0101364 | |||
| 1624 | Ga0495596_0005892 | |||
| 1625 | Ga0495606_0003543 | |||
| 1626 | Ga0495616_0002509 | |||
| 1627 | Ga0495631_0072644 | |||
| 1628 | Ga0495632_0000326 | |||
| 1629 | Ga0495637_0000299 | |||
| 1630 | Ga0495637_0000636 | |||
| 1631 | Ga0495648_0001787 | |||
| 1632 | Ga0495652_0287261 | |||
| 1633 | Ga0495622_0008847 | |||
| 1634 | Ga0495633_0152413 | |||
| 1635 | Ga0495656_0062004 | |||
| 1636 | Ga0495656_0076095 | |||
| 1637 | Ga0495668_0005067 | |||
| 1638 | Ga0495625_0004643 | |||
| 1639 | Ga0495625_0034589 | |||
| 1640 | Ga0495625_0184301 | |||
| 1641 | Ga0495625_0244662 | |||
| 1642 | Ga0495661_0002717 | |||
| 1643 | Ga0495661_0026583 | |||
| 1644 | Ga0495646_0257242 | |||
| 1645 | Ga0495647_0069054 | |||
| 1646 | Ga0495669_0003990 | |||
| 1647 | Ga0495613_0001486 | |||
| 1648 | Ga0495670_0124107 | |||
| 1649 | Ga0495671_0090522 | |||
| 1650 | Ga0495649_0151045 | |||
| 1651 | Ga0495581_0040886 | |||
| 1652 | Ga0495672_0008975 | |||
| 1653 | Ga0495672_0097545 | |||
| 1654 | Ga0495672_0191705 | |||
| 1655 | Ga0495683_0010558 | |||
| 1656 | Ga0495677_0015067 | |||
| 1657 | Ga0495681_0000238 | |||
| 1658 | Ga0495686_0001767 | |||
| 1659 | Ga0495686_0136371 | |||
| 1660 | Ga0495593_0000446 | |||
| 1661 | Ga0495593_0092444 | |||
| 1662 | Ga0495614_0119755 | |||
| 1663 | Ga0496100_0005795 | |||
| 1664 | Ga0496100_0025224 | |||
| 1665 | Ga0496101_0010103 | |||
| 1666 | Ga0496101_0019033 | |||
| 1667 | Ga0496102_0011856 | |||
| 1668 | Ga0496102_0201977 | |||
| 1669 | Ga0496102_0254822 | |||
| 1670 | Ga0496103_0140383 | |||
| 1671 | Ga0496104_0015566 | |||
| 1672 | Ga0496104_0022192 | |||
| 1673 | Ga0496104_0186947 | |||
| 1674 | Ga0496105_0026038 | |||
| 1675 | Ga0496105_0029578 | |||
| 1676 | Ga0496106_0005656 | |||
| 1677 | Ga0496106_0013363 | |||
| 1678 | Ga0496106_0032016 | |||
| 1679 | Ga0496106_0119673 | |||
| 1680 | Ga0496106_0230865 | |||
| 1681 | Ga0496107_0032512 | |||
| 1682 | Ga0496107_0036371 | |||
| 1683 | Ga0496107_0051625 | |||
| 1684 | Ga0496108_0008883 | |||
| 1685 | Ga0496108_0035589 | |||
| 1686 | Ga0496108_0051166 | |||
| 1687 | Ga0496108_0070341 | |||
| 1688 | Ga0496109_0003474 | |||
| 1689 | Ga0496109_0035502 | |||
| 1690 | Ga0496109_0144708 | |||
| 1691 | Ga0496109_0243037 | |||
| 1692 | Ga0496110_0013188 | |||
| 1693 | Ga0496110_0117190 | |||
| 1694 | Ga0496110_0157635 | |||
| 1695 | Ga0496110_0203112 | |||
| 1696 | Ga0496111_0135494 | |||
| 1697 | Ga0496111_0291033 | |||
| 1698 | Ga0496112_0000055 | |||
| 1699 | Ga0496112_0009509 | |||
| 1700 | Ga0496112_0065158 | |||
| 1701 | Ga0496112_0294394 | |||
| 1702 | Ga0496112_0360210 | |||
| 1703 | Ga0496112_0399392 | |||
| 1704 | Ga0496112_0400274 | |||
| 1705 | Ga0496113_0051065 | |||
| 1706 | Ga0496113_0053156 | |||
| 1707 | Ga0496113_0074739 | |||
| 1708 | Ga0496113_0175206 | |||
| 1709 | Ga0496114_0001073 | |||
| 1710 | Ga0496114_0002928 | |||
| 1711 | Ga0496114_0060355 | |||
| 1712 | Ga0496114_0138873 | |||
| 1713 | Ga0496115_0005146 | |||
| 1714 | Ga0496115_0043332 | |||
| 1715 | Ga0496115_0316692 | |||
| 1716 | Ga0496116_0000761 | |||
| 1717 | Ga0496119_0086096 | |||
| 1718 | Ga0496121_0035863 | |||
| 1719 | Ga0496121_0078506 | |||
| 1720 | Ga0496125_0091688 | |||
| 1721 | Ga0496126_0018245 | |||
| 1722 | Ga0496126_0060848 | |||
| 1723 | Ga0496126_0061650 | |||
| 1724 | Ga0496126_0466137 | |||
| 1725 | Ga0501032_0097298 | |||
| 1726 | Ga0501036_0029531 | |||
| 1727 | Ga0501036_0058510 | |||
| 1728 | Ga0501036_0118227 | |||
| 1729 | Ga0501036_0392298 | |||
| 1730 | Ga0501037_0330602 | |||
| 1731 | Ga0501038_0222595 | |||
| 1732 | Ga0501039_0030209 | |||
| 1733 | Ga0501039_0044907 | |||
| 1734 | Ga0501039_0149845 | |||
| 1735 | Ga0501040_0018011 | |||
| 1736 | Ga0501040_0033501 | |||
| 1737 | Ga0501040_0069117 | |||
| 1738 | Ga0501041_0007187 | |||
| 1739 | Ga0501041_0019329 | |||
| 1740 | Ga0501041_0025566 | |||
| 1741 | Ga0501041_0031889 | |||
| 1742 | Ga0501041_0145102 | |||
| 1743 | Ga0501042_0046538 | |||
| 1744 | Ga0501042_0132874 | |||
| 1745 | Ga0501042_0145685 | |||
| 1746 | Ga0501042_0172787 | |||
| 1747 | Ga0501042_0221612 | |||
| 1748 | Ga0501043_0237949 | |||
| 1749 | Ga0501046_0173529 | |||
| 1750 | Ga0501046_0191132 | |||
| 1751 | Ga0501046_0201033 | |||
| 1752 | Ga0501047_0168663 | |||
| 1753 | Ga0501047_0194677 | |||
| 1754 | Ga0501048_0060023 | |||
| 1755 | Ga0501048_0061338 | |||
| 1756 | Ga0501067_0094161 | |||
| 1757 | Ga0501068_0077716 | |||
| 1758 | Ga0501071_0006808 | |||
| 1759 | Ga0501071_0016153 | |||
| 1760 | Ga0501071_0101966 | |||
| 1761 | Ga0501072_0055865 | |||
| 1762 | Ga0501072_0081665 | |||
| 1763 | Ga0501072_0094188 | |||
| 1764 | Ga0501074_0029568 | |||
| 1765 | Ga0501075_0018748 | |||
| 1766 | Ga0501075_0023911 | |||
| 1767 | Ga0501075_0072805 | |||
| 1768 | Ga0501075_0110772 | |||
| 1769 | Ga0501075_0175378 | |||
| 1770 | Ga0501076_0086089 | |||
| 1771 | Ga0501076_0132128 | |||
| 1772 | Ga0501076_0135960 | |||
| 1773 | Ga0501076_0281549 | |||
| 1774 | Ga0501077_0017078 | |||
| 1775 | Ga0501077_0052003 | |||
| 1776 | Ga0501077_0065354 | |||
| 1777 | Ga0501077_0166473 | |||
| 1778 | Ga0501079_0099138 | |||
| 1779 | Ga0501079_0201737 | |||
| 1780 | Ga0501079_0221742 | |||
| 1781 | Ga0501079_0467667 | |||
| 1782 | Ga0501081_0019985 | |||
| 1783 | Ga0501081_0042249 | |||
| 1784 | Ga0501083_0076336 | |||
| 1785 | Ga0501035_0083881 | |||
| 1786 | Ga0501045_0018756 | |||
| 1787 | Ga0501045_0020480 | |||
| 1788 | Ga0501045_0032303 | |||
| 1789 | Ga0501045_0046763 | |||
| 1790 | Ga0501045_0082546 | |||
| 1791 | Ga0501045_0210803 | |||
| 1792 | Ga0501045_0246539 | |||
| 1793 | nmdc:mga03683_75246_c1 | |||
| 1794 | nmdc:mga03n38_81441_c1 | |||
| 1795 | nmdc:mga06z11_58418_c1 | |||
| 1796 | nmdc:mga04h51_46251_c1 | |||
| 1797 | nmdc:mga07m45_138574_c1 | |||
| 1798 | nmdc:mga05p37_114611_c1 | |||
| 1799 | nmdc:mga05p37_386924_c1 | |||
| 1800 | nmdc:mga0qj67_61672_c1 | |||
| 1801 | nmdc:mga06r32_219083_c1 | |||
| 1802 | nmdc:mga06r32_264328_c1 | |||
| 1803 | nmdc:mga08y16_121135_c1 | |||
| 1804 | nmdc:mga08y16_1696_c1 | |||
| 1805 | nmdc:mga08y16_20259_c1 | |||
| 1806 | nmdc:mga08y16_380809_c1 | |||
| 1807 | nmdc:mga0n895_142481_c1 | |||
| 1808 | nmdc:mga0n895_163658_c1 | |||
| 1809 | nmdc:mga0n895_396533_c1 | |||
| 1810 | nmdc:mga0sz30_17755_c1 | |||
| 1811 | nmdc:mga0sz30_99433_c1 | |||
| 1812 | Ga0495601_0008374 | |||
| 1813 | Ga0495655_0000348 | |||
| 1814 | Ga0495619_0003178 | |||
| 1815 | Ga0500644_0029153 | |||
| 1816 | Ga0500566_0064629 | |||
| 1817 | Ga0500641_0048888 | |||
| 1818 | Ga0500650_0041975 | |||
| 1819 | Ga0500554_001083 | |||
| 1820 | Ga0500562_019336 | |||
| 1821 | Ga0500595_000726 | |||
| 1822 | Ga0500595_010273 | |||
| 1823 | Ga0500652_114312 | |||
| 1824 | Ga0500559_0033238 | |||
| 1825 | Ga0500568_0026140 | |||
| 1826 | Ga0500568_0037166 | |||
| 1827 | Ga0500568_0040551 | |||
| 1828 | Ga0500603_006267 | |||
| 1829 | Ga0500604_0052160 | |||
| 1830 | Ga0500616_0000028 | |||
| 1831 | Ga0500616_0000964 | |||
| 1832 | Ga0500616_0081393 | |||
| 1833 | Ga0500619_002865 | |||
| 1834 | Ga0500622_0006697 | |||
| 1835 | Ga0500627_0082835 | |||
| 1836 | Ga0500638_008459 | |||
| 1837 | Ga0500636_0066934 | |||
| 1838 | Ga0500637_0000084 | |||
| 1839 | Ga0501084_0011524 | |||
| 1840 | Ga0501084_0078234 | |||
| 1841 | Ga0501084_0175213 | |||
| 1842 | Ga0501084_0272944 | |||
| 1843 | Ga0501084_0386602 | |||
| 1844 | Ga0500661_000602 | |||
| 1845 | Ga0501082_0029246 | |||
| 1846 | Ga0501082_0049411 | |||
| 1847 | Ga0501082_0061696 | |||
| 1848 | Ga0501082_0126941 | |||
| 1849 | Ga0501082_0169902 | |||
| 1850 | Ga0466962_0002323 | |||
| 1851 | Ga0530510_0015111 | |||
| 1852 | Ga0530510_0026282 | |||
| 1853 | Ga0530510_0097764 | |||
| 1854 | Ga0530510_0139829 | |||
| 1855 | Ga0530510_0244270 | |||
| 1856 | 2511412531 | |||
| 1857 | 2513697397 | |||
| 1858 | 2524534453 | |||
| 1859 | 2723843112 | |||
| 1860 | 2793071181 | |||
| 1861 | 2793079481 | |||
| 1862 | 2874612556 | |||
| 1863 | 2876813749 | |||
| 1864 | 2879118002 | |||
| 1865 | 2889033587 | |||
| 1866 | 2904705749 | |||
| 1867 | 2906611430 | |||
| 1868 | 2909044149 | |||
| 1869 | 2922366957 | |||
| 1870 | 2922390266 | |||
| 1871 | 2922427928 | |||
| 1872 | 2928535604 | |||
| 1873 | 8002061099 | |||
| 1874 | 8006966492 | |||
| 1875 | 8006989318 | |||
| 1876 | 8006997802 | |||
| 1877 | 8019559510 | |||
| 1878 | 8019569613 | |||
| 1879 | 8056570726 | |||
| 1880 | 8056674837 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bww-assembly1.cif.gz_A | crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution | 0.9185 | 5 | 274 |
| 3bww-assembly1.cif.gz_A | crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution | 0.8804 | 5 | 274 |
| 7tcx-assembly1.cif.gz_A | methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b at 2.21 angstrom resolution | 0.8421 | 6 | 266 |
| 7tcw-assembly2.cif.gz_B | methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b, h210s mutant | 0.8415 | 6 | 266 |
| 7fc0-assembly1.cif.gz_B | reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) | 0.8379 | 6 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bwwA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9226 | 3 | 274 | 3.20.20.150 |
| 3bwwA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8938 | 3 | 274 | 3.20.20.150 |
| af_P9WQ13_1_251_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.6832 | 7 | 267 | 3.20.20.150 |
| af_P9WQ13_1_251_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.6739 | 7 | 267 | 3.20.20.150 |
| af_P50525_6_280_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.6596 | 12 | 266 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535A888-F1-model_v4 | DUF692 domain-containing protein | 0.9912 | 197 | 275 |
|
| AF-A0A534I5P5-F1-model_v4 | UPF0276 protein E6K21_11310 | 0.9867 | 3 | 274 |
|
| AF-A0A2H5ZIT0-F1-model_v4 | UPF0276 protein HRbin30_00920 | 0.9858 | 2 | 275 |
|
| AF-A0A1A8XYK4-F1-model_v4 | Uncharacterized protein | 0.9846 | 163 | 275 |
|
| AF-A0A2Z3KPT7-F1-model_v4 | deleted | 0.9836 | 3 | 275 |
|