F486305
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 349 | 935 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10158380|Ga0070681_101583802 |
| Length | 367 |
| Sequence | MGRGSKVCLCPEANIDCDLWRQVRVSKAIYTDASRIGRRLDMLRREFIAGAATSALLVCPLRAHAQQSATRRMRIGILIYSTPQRDPNTQTLLEGFRQLGYVDGQNVTIEYRYAQGQPERLPELATDLVQSKPDVIFALGGDVTPHAAKATQAIPIVYVMSADPVQLGIAKSLAKPGGNSTGVTLLSDQLAAKRLEIFKEAAPLIARVALVRDPSHADNELPIAARAAKALKLELLPIGIHDPAELDRALETTKELGIDSVYVVSSRHTVANAQRIVGFANRQRLPLVAGWGAWVHAGGLISYGPNVTEMIRQASRFLDVILKGANPGDLPVQQPTQFELFVNLKTAKALGLDIPESFLLRADKVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 3 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 4 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 5 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 7 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 9 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 215 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 254 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 255 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0.32 |
| Rhizoplane | 11.7 |
| Rhizosphere | 86.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800759 | 2209111006 | Bacteria | 10903 |
| 2 | ARcpr5oldR_c000105 | 3300000041 | Bacteria | 15306 |
| 3 | ARSoilYngRDRAFT_c00092 | 3300000042 | Bacteria | 15326 |
| 4 | ARcpr5yngRDRAFT_c000085 | 3300000043 | Bacteria | 15310 |
| 5 | ARSoilOldRDRAFT_c000016 | 3300000044 | Bacteria | 39308 |
| 6 | ARCol0oldRDRAFT_c00328 | 3300000045 | Bacteria | 4603 |
| 7 | ARCol0yngRDRAFT_1000096 | 3300000652 | Bacteria | 16320 |
| 8 | JGI24737J22298_10013112 | 3300001990 | Bacteria | 2700 |
| 9 | JGI24737J22298_10032275 | 3300001990 | Bacteria | 1631 |
| 10 | JGI25404J52841_10002030 | 3300003659 | Bacteria | 3743 |
| 11 | JGI25404J52841_10003373 | 3300003659 | Bacteria | 3151 |
| 12 | JGI25404J52841_10006341 | 3300003659 | Bacteria | 2472 |
| 13 | JGI25404J52841_10013652 | 3300003659 | Bacteria | 1762 |
| 14 | JGI25404J52841_10017054 | 3300003659 | Bacteria | 1575 |
| 15 | JGI25404J52841_10017720 | 3300003659 | Bacteria | 1544 |
| 16 | Ga0065716_1001939 | 3300005277 | Bacteria | 2663 |
| 17 | Ga0065704_10090328 | 3300005289 | Bacteria | 2795 |
| 18 | Ga0065707_10100212 | 3300005295 | Bacteria | 2947 |
| 19 | Ga0070676_10001849 | 3300005328 | Bacteria | 10793 |
| 20 | Ga0070676_10119601 | 3300005328 | Bacteria | 1651 |
| 21 | Ga0070683_100089278 | 3300005329 | Bacteria | 2892 |
| 22 | Ga0070683_100253881 | 3300005329 | Bacteria | 1672 |
| 23 | Ga0070690_100006214 | 3300005330 | Bacteria | 6773 |
| 24 | Ga0070690_100339058 | 3300005330 | Unclassified | 1088 |
| 25 | Ga0070670_100275182 | 3300005331 | Unclassified | 1469 |
| 26 | Ga0070677_10141711 | 3300005333 | Bacteria | 1109 |
| 27 | Ga0068869_100014742 | 3300005334 | Bacteria | 5227 |
| 28 | Ga0068869_100036009 | 3300005334 | Bacteria | 3512 |
| 29 | Ga0068869_100135247 | 3300005334 | Unclassified | 1898 |
| 30 | Ga0068869_100287551 | 3300005334 | Unclassified | 1324 |
| 31 | Ga0070666_10016162 | 3300005335 | Bacteria | 4770 |
| 32 | Ga0070666_10020373 | 3300005335 | Bacteria | 4286 |
| 33 | Ga0070680_100081181 | 3300005336 | Bacteria | 2675 |
| 34 | Ga0070680_100187568 | 3300005336 | Bacteria | 1742 |
| 35 | Ga0070682_100073320 | 3300005337 | Bacteria | 2196 |
| 36 | Ga0068868_100057759 | 3300005338 | Bacteria | 3066 |
| 37 | Ga0070660_100009542 | 3300005339 | Bacteria | 6833 |
| 38 | Ga0070660_100286470 | 3300005339 | Bacteria | 1348 |
| 39 | Ga0070689_100014457 | 3300005340 | Bacteria | 5734 |
| 40 | Ga0070689_100045521 | 3300005340 | Bacteria | 3379 |
| 41 | Ga0070689_100356806 | 3300005340 | Unclassified | 1227 |
| 42 | Ga0070687_100042178 | 3300005343 | Bacteria | 2310 |
| 43 | Ga0070687_100120742 | 3300005343 | Bacteria | 1499 |
| 44 | Ga0070661_100014451 | 3300005344 | Bacteria | 5564 |
| 45 | Ga0070661_100402496 | 3300005344 | Bacteria | 1082 |
| 46 | Ga0070692_10117721 | 3300005345 | Unclassified | 1477 |
| 47 | Ga0070692_10139631 | 3300005345 | Bacteria | 1370 |
| 48 | Ga0070692_10231679 | 3300005345 | Unclassified | 1097 |
| 49 | Ga0070668_100013101 | 3300005347 | Bacteria | 6179 |
| 50 | Ga0070668_100032930 | 3300005347 | Bacteria | 3944 |
| 51 | Ga0070668_100033845 | 3300005347 | Unclassified | 3893 |
| 52 | Ga0070668_100376507 | 3300005347 | Bacteria | 1207 |
| 53 | Ga0070668_100393820 | 3300005347 | Bacteria | 1181 |
| 54 | Ga0070669_100006176 | 3300005353 | Bacteria | 8647 |
| 55 | Ga0070669_100084415 | 3300005353 | Unclassified | 2369 |
| 56 | Ga0070669_100149608 | 3300005353 | Bacteria | 1806 |
| 57 | Ga0070669_100191631 | 3300005353 | Bacteria | 1604 |
| 58 | Ga0070675_100018746 | 3300005354 | Bacteria | 5508 |
| 59 | Ga0070675_100039484 | 3300005354 | Bacteria | 3852 |
| 60 | Ga0070675_100187606 | 3300005354 | Bacteria | 1790 |
| 61 | Ga0070671_100041930 | 3300005355 | Bacteria | 3804 |
| 62 | Ga0070671_100053598 | 3300005355 | Bacteria | 3353 |
| 63 | Ga0070671_100229808 | 3300005355 | Unclassified | 1574 |
| 64 | Ga0070671_100270092 | 3300005355 | Bacteria | 1445 |
| 65 | Ga0070671_100387240 | 3300005355 | Bacteria | 1195 |
| 66 | Ga0070674_100002846 | 3300005356 | Bacteria | 9563 |
| 67 | Ga0070674_100096653 | 3300005356 | Bacteria | 2144 |
| 68 | Ga0070674_100179785 | 3300005356 | Bacteria | 1619 |
| 69 | Ga0070673_100021826 | 3300005364 | Bacteria | 4650 |
| 70 | Ga0070673_100032047 | 3300005364 | Bacteria | 3952 |
| 71 | Ga0070688_100052743 | 3300005365 | Bacteria | 2541 |
| 72 | Ga0070688_100121788 | 3300005365 | Bacteria | 1748 |
| 73 | Ga0070659_100179024 | 3300005366 | Bacteria | 1739 |
| 74 | Ga0070659_100294410 | 3300005366 | Unclassified | 1352 |
| 75 | Ga0070659_100296099 | 3300005366 | Bacteria | 1348 |
| 76 | Ga0070659_100327627 | 3300005366 | Unclassified | 1281 |
| 77 | Ga0070667_100020939 | 3300005367 | Bacteria | 5432 |
| 78 | Ga0070667_100061825 | 3300005367 | Bacteria | 3171 |
| 79 | Ga0070667_100216538 | 3300005367 | Bacteria | 1703 |
| 80 | Ga0070709_10023079 | 3300005434 | Bacteria | 3648 |
| 81 | Ga0070709_10196975 | 3300005434 | Unclassified | 1424 |
| 82 | Ga0070714_100016862 | 3300005435 | Bacteria | 5908 |
| 83 | Ga0070713_100004094 | 3300005436 | Bacteria | 9717 |
| 84 | Ga0070713_100007213 | 3300005436 | Bacteria | 7781 |
| 85 | Ga0070713_100011397 | 3300005436 | Bacteria | 6475 |
| 86 | Ga0070713_100327973 | 3300005436 | Unclassified | 1415 |
| 87 | Ga0070710_10001693 | 3300005437 | Bacteria | 10396 |
| 88 | Ga0070710_10047313 | 3300005437 | Bacteria | 2399 |
| 89 | Ga0070701_10007665 | 3300005438 | Bacteria | 4628 |
| 90 | Ga0070701_10092267 | 3300005438 | Unclassified | 1661 |
| 91 | Ga0070711_100007637 | 3300005439 | Bacteria | 6583 |
| 92 | Ga0070711_100013035 | 3300005439 | Bacteria | 5212 |
| 93 | Ga0070711_100209489 | 3300005439 | Bacteria | 1509 |
| 94 | Ga0070705_100013839 | 3300005440 | Bacteria | 4135 |
| 95 | Ga0070705_100065793 | 3300005440 | Unclassified | 2171 |
| 96 | Ga0070705_100184966 | 3300005440 | Bacteria | 1415 |
| 97 | Ga0070700_100012162 | 3300005441 | Bacteria | 4792 |
| 98 | Ga0070700_100045779 | 3300005441 | Bacteria | 2700 |
| 99 | Ga0070700_100139572 | 3300005441 | Bacteria | 1645 |
| 100 | Ga0070694_100049641 | 3300005444 | Bacteria | 2826 |
| 101 | Ga0070694_100233098 | 3300005444 | Unclassified | 1386 |
| 102 | Ga0070694_100236085 | 3300005444 | Bacteria | 1377 |
| 103 | Ga0070694_100253345 | 3300005444 | Unclassified | 1332 |
| 104 | Ga0070708_100077516 | 3300005445 | Bacteria | 3003 |
| 105 | Ga0070708_100092432 | 3300005445 | Bacteria | 2756 |
| 106 | Ga0070708_100325537 | 3300005445 | Bacteria | 1448 |
| 107 | Ga0070663_100082475 | 3300005455 | Bacteria | 2365 |
| 108 | Ga0070663_100357852 | 3300005455 | Unclassified | 1183 |
| 109 | Ga0070663_100427927 | 3300005455 | Bacteria | 1087 |
| 110 | Ga0070678_100035261 | 3300005456 | Bacteria | 3491 |
| 111 | Ga0070678_100242476 | 3300005456 | Unclassified | 1508 |
| 112 | Ga0070678_100464258 | 3300005456 | Unclassified | 1111 |
| 113 | Ga0070662_100002108 | 3300005457 | Bacteria | 12200 |
| 114 | Ga0070662_100022584 | 3300005457 | Bacteria | 4309 |
| 115 | Ga0070662_100349279 | 3300005457 | Bacteria | 1211 |
| 116 | Ga0070681_10027500 | 3300005458 | Bacteria | 5718 |
| 117 | Ga0070681_10158380 | 3300005458 | Bacteria | 2188 |
| 118 | Ga0070681_10238203 | 3300005458 | Bacteria | 1733 |
| 119 | Ga0068867_100015137 | 3300005459 | Bacteria | 5469 |
| 120 | Ga0070685_10009690 | 3300005466 | Bacteria | 4987 |
| 121 | Ga0070706_100041803 | 3300005467 | Bacteria | 4233 |
| 122 | Ga0070706_100166804 | 3300005467 | Bacteria | 2056 |
| 123 | Ga0070706_100254501 | 3300005467 | Bacteria | 1639 |
| 124 | Ga0070707_100012483 | 3300005468 | Bacteria | 7935 |
| 125 | Ga0070707_100224595 | 3300005468 | Bacteria | 1828 |
| 126 | Ga0070698_100059258 | 3300005471 | Bacteria | 3867 |
| 127 | Ga0070698_100124734 | 3300005471 | Bacteria | 2532 |
| 128 | Ga0070698_100213371 | 3300005471 | Bacteria | 1864 |
| 129 | Ga0070698_100231627 | 3300005471 | Bacteria | 1780 |
| 130 | Ga0070698_100352271 | 3300005471 | Bacteria | 1404 |
| 131 | Ga0070699_100004122 | 3300005518 | Bacteria | 12838 |
| 132 | Ga0070699_100177414 | 3300005518 | Bacteria | 1890 |
| 133 | Ga0070699_100250388 | 3300005518 | Bacteria | 1582 |
| 134 | Ga0070679_100063022 | 3300005530 | Bacteria | 3696 |
| 135 | Ga0070679_100125866 | 3300005530 | Bacteria | 2545 |
| 136 | Ga0070679_100272450 | 3300005530 | Unclassified | 1646 |
| 137 | Ga0070679_100383860 | 3300005530 | Bacteria | 1351 |
| 138 | Ga0070684_100521346 | 3300005535 | Bacteria | 1101 |
| 139 | Ga0070697_100018594 | 3300005536 | Bacteria | 5479 |
| 140 | Ga0070697_100062962 | 3300005536 | Bacteria | 3029 |
| 141 | Ga0070697_100258271 | 3300005536 | Bacteria | 1491 |
| 142 | Ga0068853_100377924 | 3300005539 | Bacteria | 1322 |
| 143 | Ga0070672_100001451 | 3300005543 | Bacteria | 14681 |
| 144 | Ga0070672_100034892 | 3300005543 | Bacteria | 3820 |
| 145 | Ga0070672_100041095 | 3300005543 | Bacteria | 3553 |
| 146 | Ga0070672_100201483 | 3300005543 | Bacteria | 1664 |
| 147 | Ga0070686_100087774 | 3300005544 | Bacteria | 2074 |
| 148 | Ga0070686_100101949 | 3300005544 | Bacteria | 1940 |
| 149 | Ga0070695_100011209 | 3300005545 | Bacteria | 5360 |
| 150 | Ga0070695_100012227 | 3300005545 | Bacteria | 5147 |
| 151 | Ga0070695_100017313 | 3300005545 | Bacteria | 4369 |
| 152 | Ga0070695_100029507 | 3300005545 | Bacteria | 3408 |
| 153 | Ga0070695_100051261 | 3300005545 | Bacteria | 2648 |
| 154 | Ga0070695_100354268 | 3300005545 | Bacteria | 1100 |
| 155 | Ga0070696_100012282 | 3300005546 | Bacteria | 5740 |
| 156 | Ga0070696_100018913 | 3300005546 | Bacteria | 4663 |
| 157 | Ga0070696_100137478 | 3300005546 | Unclassified | 1782 |
| 158 | Ga0070696_100150020 | 3300005546 | Bacteria | 1710 |
| 159 | Ga0070693_100055875 | 3300005547 | Bacteria | 2276 |
| 160 | Ga0070693_100106200 | 3300005547 | Unclassified | 1719 |
| 161 | Ga0070665_100078992 | 3300005548 | Bacteria | 3297 |
| 162 | Ga0070704_100032649 | 3300005549 | Bacteria | 3514 |
| 163 | Ga0070704_100072077 | 3300005549 | Unclassified | 2512 |
| 164 | Ga0070704_100204210 | 3300005549 | Unclassified | 1597 |
| 165 | Ga0068855_100144369 | 3300005563 | Bacteria | 2711 |
| 166 | Ga0070664_100076250 | 3300005564 | Bacteria | 2880 |
| 167 | Ga0070664_100317465 | 3300005564 | Unclassified | 1411 |
| 168 | Ga0070664_100373112 | 3300005564 | Bacteria | 1301 |
| 169 | Ga0070664_100482015 | 3300005564 | Bacteria | 1141 |
| 170 | Ga0068857_100021887 | 3300005577 | Bacteria | 5626 |
| 171 | Ga0068857_100126366 | 3300005577 | Bacteria | 2304 |
| 172 | Ga0068857_100459166 | 3300005577 | Bacteria | 1192 |
| 173 | Ga0068854_100036600 | 3300005578 | Bacteria | 3442 |
| 174 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 175 | Ga0070702_100013438 | 3300005615 | Bacteria | 4133 |
| 176 | Ga0070702_100210798 | 3300005615 | Unclassified | 1293 |
| 177 | Ga0068852_100043002 | 3300005616 | Bacteria | 3829 |
| 178 | Ga0068852_100050060 | 3300005616 | Bacteria | 3578 |
| 179 | Ga0068852_100147641 | 3300005616 | Bacteria | 2183 |
| 180 | Ga0068859_100096647 | 3300005617 | Bacteria | 3006 |
| 181 | Ga0068859_100342733 | 3300005617 | Bacteria | 1589 |
| 182 | Ga0068859_100355070 | 3300005617 | Bacteria | 1561 |
| 183 | Ga0068864_100003648 | 3300005618 | Bacteria | 12726 |
| 184 | Ga0068864_100073169 | 3300005618 | Bacteria | 2988 |
| 185 | Ga0068864_100095474 | 3300005618 | Bacteria | 2629 |
| 186 | Ga0068864_100220111 | 3300005618 | Bacteria | 1751 |
| 187 | Ga0068861_100080627 | 3300005719 | Bacteria | 2546 |
| 188 | Ga0068861_100143462 | 3300005719 | Unclassified | 1952 |
| 189 | Ga0068851_10138650 | 3300005834 | Bacteria | 1321 |
| 190 | Ga0068851_10191382 | 3300005834 | Bacteria | 1137 |
| 191 | Ga0068870_10027115 | 3300005840 | Bacteria | 2863 |
| 192 | Ga0068870_10107763 | 3300005840 | Unclassified | 1585 |
| 193 | Ga0068863_100010844 | 3300005841 | Bacteria | 8837 |
| 194 | Ga0068863_100014129 | 3300005841 | Bacteria | 7692 |
| 195 | Ga0068863_100190880 | 3300005841 | Bacteria | 1969 |
| 196 | Ga0068858_100039890 | 3300005842 | Bacteria | 4353 |
| 197 | Ga0068858_100093624 | 3300005842 | Unclassified | 2797 |
| 198 | Ga0068858_100361793 | 3300005842 | Unclassified | 1391 |
| 199 | Ga0068860_100001009 | 3300005843 | Bacteria | 31175 |
| 200 | Ga0068860_100002602 | 3300005843 | Bacteria | 18884 |
| 201 | Ga0068860_100025197 | 3300005843 | Bacteria | 5740 |
| 202 | Ga0068860_100062335 | 3300005843 | Bacteria | 3543 |
| 203 | Ga0068860_100171270 | 3300005843 | Bacteria | 2097 |
| 204 | Ga0068860_100267912 | 3300005843 | Bacteria | 1666 |
| 205 | Ga0068862_100019656 | 3300005844 | Bacteria | 5639 |
| 206 | Ga0068862_100048902 | 3300005844 | Bacteria | 3611 |
| 207 | Ga0068862_100073986 | 3300005844 | Bacteria | 2945 |
| 208 | Ga0068862_100121923 | 3300005844 | Unclassified | 2298 |
| 209 | Ga0068862_100252762 | 3300005844 | Unclassified | 1607 |
| 210 | Ga0068862_100610560 | 3300005844 | Bacteria | 1048 |
| 211 | Ga0081455_10003604 | 3300005937 | Bacteria | 17762 |
| 212 | Ga0081455_10004659 | 3300005937 | Bacteria | 15268 |
| 213 | Ga0081455_10008660 | 3300005937 | Bacteria | 10542 |
| 214 | Ga0081455_10031809 | 3300005937 | Bacteria | 4766 |
| 215 | Ga0081455_10034722 | 3300005937 | Bacteria | 4515 |
| 216 | Ga0081455_10039939 | 3300005937 | Bacteria | 4142 |
| 217 | Ga0081455_10063317 | 3300005937 | Bacteria | 3104 |
| 218 | Ga0081455_10082032 | 3300005937 | Bacteria | 2639 |
| 219 | Ga0081455_10088529 | 3300005937 | Bacteria | 2515 |
| 220 | Ga0081455_10092484 | 3300005937 | Bacteria | 2447 |
| 221 | Ga0081540_1001417 | 3300005983 | Bacteria | 20744 |
| 222 | Ga0081540_1003548 | 3300005983 | Bacteria | 12289 |
| 223 | Ga0081540_1003853 | 3300005983 | Bacteria | 11708 |
| 224 | Ga0081540_1003871 | 3300005983 | Bacteria | 11683 |
| 225 | Ga0081540_1005308 | 3300005983 | Bacteria | 9641 |
| 226 | Ga0081540_1005508 | 3300005983 | Bacteria | 9441 |
| 227 | Ga0081540_1042130 | 3300005983 | Bacteria | 2358 |
| 228 | Ga0081540_1054177 | 3300005983 | Bacteria | 1962 |
| 229 | Ga0081540_1070249 | 3300005983 | Bacteria | 1623 |
| 230 | Ga0081539_10000035 | 3300005985 | Bacteria | 302689 |
| 231 | Ga0081539_10035500 | 3300005985 | Bacteria | 2995 |
| 232 | Ga0070717_10003805 | 3300006028 | Bacteria | 10854 |
| 233 | Ga0070717_10023645 | 3300006028 | Unclassified | 4871 |
| 234 | Ga0070717_10081807 | 3300006028 | Bacteria | 2712 |
| 235 | Ga0070717_10339769 | 3300006028 | Bacteria | 1341 |
| 236 | Ga0075365_10024840 | 3300006038 | Bacteria | 3786 |
| 237 | Ga0075365_10039426 | 3300006038 | Unclassified | 3075 |
| 238 | Ga0070715_10004288 | 3300006163 | Bacteria | 4656 |
| 239 | Ga0070715_10080197 | 3300006163 | Bacteria | 1479 |
| 240 | Ga0070716_100002987 | 3300006173 | Bacteria | 7887 |
| 241 | Ga0070716_100003999 | 3300006173 | Bacteria | 7000 |
| 242 | Ga0070716_100283178 | 3300006173 | Bacteria | 1145 |
| 243 | Ga0070712_100006218 | 3300006175 | Bacteria | 7389 |
| 244 | Ga0070712_100014865 | 3300006175 | Bacteria | 5003 |
| 245 | Ga0070712_100204489 | 3300006175 | Bacteria | 1553 |
| 246 | Ga0075367_10151549 | 3300006178 | Bacteria | 1439 |
| 247 | Ga0075367_10232223 | 3300006178 | Bacteria | 1155 |
| 248 | Ga0075366_10021791 | 3300006195 | Bacteria | 3726 |
| 249 | Ga0097621_100005573 | 3300006237 | Bacteria | 8873 |
| 250 | Ga0075370_10140788 | 3300006353 | Bacteria | 1410 |
| 251 | Ga0068871_100065463 | 3300006358 | Bacteria | 2977 |
| 252 | Ga0068871_100489068 | 3300006358 | Unclassified | 1108 |
| 253 | Ga0075428_100022678 | 3300006844 | Bacteria | 6949 |
| 254 | Ga0075428_100325473 | 3300006844 | Unclassified | 1651 |
| 255 | Ga0075430_100001979 | 3300006846 | Bacteria | 16876 |
| 256 | Ga0075430_100111729 | 3300006846 | Bacteria | 2278 |
| 257 | Ga0075431_100008762 | 3300006847 | Bacteria | 10135 |
| 258 | Ga0075431_100023948 | 3300006847 | Bacteria | 6250 |
| 259 | Ga0075431_100448232 | 3300006847 | Bacteria | 1286 |
| 260 | Ga0075431_100524725 | 3300006847 | Unclassified | 1173 |
| 261 | Ga0075433_10046732 | 3300006852 | Bacteria | 3765 |
| 262 | Ga0075433_10051401 | 3300006852 | Bacteria | 3589 |
| 263 | Ga0075433_10091603 | 3300006852 | Bacteria | 2688 |
| 264 | Ga0075434_100036852 | 3300006871 | Bacteria | 4838 |
| 265 | Ga0075434_100086529 | 3300006871 | Bacteria | 3134 |
| 266 | Ga0075434_100120862 | 3300006871 | Bacteria | 2635 |
| 267 | Ga0075434_100124425 | 3300006871 | Plasmid | 2596 |
| 268 | Ga0075434_100174625 | 3300006871 | Bacteria | 2168 |
| 269 | Ga0075434_100407818 | 3300006871 | Bacteria | 1380 |
| 270 | Ga0075434_100436069 | 3300006871 | Unclassified | 1331 |
| 271 | Ga0075434_100550082 | 3300006871 | Bacteria | 1174 |
| 272 | Ga0075429_100070410 | 3300006880 | Bacteria | 3045 |
| 273 | Ga0075429_100265012 | 3300006880 | Bacteria | 1504 |
| 274 | Ga0075429_100270096 | 3300006880 | Unclassified | 1489 |
| 275 | Ga0068865_100004690 | 3300006881 | Bacteria | 8254 |
| 276 | Ga0068865_100028550 | 3300006881 | Bacteria | 3695 |
| 277 | Ga0068865_100032531 | 3300006881 | Bacteria | 3484 |
| 278 | Ga0068865_100069867 | 3300006881 | Unclassified | 2487 |
| 279 | Ga0068865_100099032 | 3300006881 | Bacteria | 2131 |
| 280 | Ga0068865_100132730 | 3300006881 | Bacteria | 1867 |
| 281 | Ga0075436_100048594 | 3300006914 | Bacteria | 2927 |
| 282 | Ga0075436_100249245 | 3300006914 | Bacteria | 1264 |
| 283 | Ga0097620_100096642 | 3300006931 | Bacteria | 3006 |
| 284 | Ga0097620_100342702 | 3300006931 | Bacteria | 1589 |
| 285 | Ga0097620_100355072 | 3300006931 | Bacteria | 1561 |
| 286 | Ga0075435_100003406 | 3300007076 | Bacteria | 10784 |
| 287 | Ga0075435_100249895 | 3300007076 | Unclassified | 1510 |
| 288 | Ga0075435_100420836 | 3300007076 | Bacteria | 1150 |
| 289 | Ga0099794_10013528 | 3300007265 | Bacteria | 3553 |
| 290 | Ga0099794_10036749 | 3300007265 | Unclassified | 2317 |
| 291 | Ga0099794_10101913 | 3300007265 | Bacteria | 1433 |
| 292 | Ga0099794_10147268 | 3300007265 | Bacteria | 1194 |
| 293 | Ga0099795_10012656 | 3300007788 | Bacteria | 2566 |
| 294 | Ga0099795_10033980 | 3300007788 | Bacteria | 1774 |
| 295 | Ga0099795_10042018 | 3300007788 | Bacteria | 1630 |
| 296 | Ga0105251_10073605 | 3300009011 | Bacteria | 1587 |
| 297 | Ga0105251_10080495 | 3300009011 | Bacteria | 1506 |
| 298 | Ga0105240_10172585 | 3300009093 | Bacteria | 2559 |
| 299 | Ga0105240_10711066 | 3300009093 | Bacteria | 1096 |
| 300 | Ga0111539_10004905 | 3300009094 | Bacteria | 17416 |
| 301 | Ga0111539_10097433 | 3300009094 | Bacteria | 3455 |
| 302 | Ga0111539_10157413 | 3300009094 | Bacteria | 2658 |
| 303 | Ga0111539_10276488 | 3300009094 | Bacteria | 1954 |
| 304 | Ga0111539_10404092 | 3300009094 | Bacteria | 1591 |
| 305 | Ga0111539_10536407 | 3300009094 | Bacteria | 1363 |
| 306 | Ga0105245_10019926 | 3300009098 | Bacteria | 5881 |
| 307 | Ga0105245_10031532 | 3300009098 | Unclassified | 4691 |
| 308 | Ga0105245_10149118 | 3300009098 | Unclassified | 2210 |
| 309 | Ga0105245_10327039 | 3300009098 | Bacteria | 1512 |
| 310 | Ga0105245_10354323 | 3300009098 | Unclassified | 1455 |
| 311 | Ga0114129_10001447 | 3300009147 | Bacteria | 32031 |
| 312 | Ga0114129_10007205 | 3300009147 | Bacteria | 15826 |
| 313 | Ga0114129_10074073 | 3300009147 | Bacteria | 4742 |
| 314 | Ga0114129_10091462 | 3300009147 | Bacteria | 4215 |
| 315 | Ga0114129_10152242 | 3300009147 | Bacteria | 3165 |
| 316 | Ga0114129_10231747 | 3300009147 | Bacteria | 2487 |
| 317 | Ga0114129_10421106 | 3300009147 | Unclassified | 1756 |
| 318 | Ga0114129_10554625 | 3300009147 | Bacteria | 1494 |
| 319 | Ga0105243_10013128 | 3300009148 | Bacteria | 6260 |
| 320 | Ga0105243_10160961 | 3300009148 | Unclassified | 1935 |
| 321 | Ga0105243_10212467 | 3300009148 | Bacteria | 1704 |
| 322 | Ga0105243_10256081 | 3300009148 | Bacteria | 1565 |
| 323 | Ga0105243_10258806 | 3300009148 | Bacteria | 1557 |
| 324 | Ga0105241_10076670 | 3300009174 | Bacteria | 2608 |
| 325 | Ga0105241_10326021 | 3300009174 | Unclassified | 1326 |
| 326 | Ga0105242_10028307 | 3300009176 | Bacteria | 4460 |
| 327 | Ga0105242_10028455 | 3300009176 | Bacteria | 4450 |
| 328 | Ga0105242_10193235 | 3300009176 | Bacteria | 1803 |
| 329 | Ga0105242_10240510 | 3300009176 | Bacteria | 1627 |
| 330 | Ga0105248_10082316 | 3300009177 | Bacteria | 3619 |
| 331 | Ga0105248_10099882 | 3300009177 | Bacteria | 3270 |
| 332 | Ga0105248_10115847 | 3300009177 | Bacteria | 3022 |
| 333 | Ga0105248_10275769 | 3300009177 | Bacteria | 1893 |
| 334 | Ga0105248_10323969 | 3300009177 | Bacteria | 1736 |
| 335 | Ga0105237_10429360 | 3300009545 | Unclassified | 1327 |
| 336 | Ga0105238_10047788 | 3300009551 | Bacteria | 4314 |
| 337 | Ga0105249_10071868 | 3300009553 | Bacteria | 3198 |
| 338 | Ga0105249_10078302 | 3300009553 | Bacteria | 3067 |
| 339 | Ga0105249_10165792 | 3300009553 | Bacteria | 2138 |
| 340 | Ga0105249_10181145 | 3300009553 | Unclassified | 2050 |
| 341 | Ga0105249_10225011 | 3300009553 | Bacteria | 1848 |
| 342 | Ga0105249_10315788 | 3300009553 | Unclassified | 1572 |
| 343 | Ga0099796_10017719 | 3300010159 | Bacteria | 2126 |
| 344 | Ga0105239_10076919 | 3300010375 | Bacteria | 3671 |
| 345 | Ga0105239_10154443 | 3300010375 | Bacteria | 2563 |
| 346 | Ga0105246_10015590 | 3300011119 | Bacteria | 4802 |
| 347 | Ga0105246_10177723 | 3300011119 | Bacteria | 1636 |
| 348 | Ga0105246_10208577 | 3300011119 | Bacteria | 1524 |
| 349 | Ga0157373_10108738 | 3300013100 | Bacteria | 1950 |
| 350 | Ga0157370_10170718 | 3300013104 | Bacteria | 2022 |
| 351 | Ga0157369_10033163 | 3300013105 | Bacteria | 5677 |
| 352 | Ga0157369_10052802 | 3300013105 | Bacteria | 4395 |
| 353 | Ga0157369_10094975 | 3300013105 | Bacteria | 3182 |
| 354 | Ga0157374_10001949 | 3300013296 | Bacteria | 17306 |
| 355 | Ga0157374_10020022 | 3300013296 | Bacteria | 5932 |
| 356 | Ga0157378_10047475 | 3300013297 | Bacteria | 3818 |
| 357 | Ga0157378_10309797 | 3300013297 | Unclassified | 1531 |
| 358 | Ga0157378_10588055 | 3300013297 | Bacteria | 1123 |
| 359 | Ga0163162_10025015 | 3300013306 | Bacteria | 5898 |
| 360 | Ga0163162_10227999 | 3300013306 | Unclassified | 1993 |
| 361 | Ga0163162_10414429 | 3300013306 | Unclassified | 1479 |
| 362 | Ga0163162_10591292 | 3300013306 | Bacteria | 1236 |
| 363 | Ga0157372_10095017 | 3300013307 | Bacteria | 3396 |
| 364 | Ga0157375_10004049 | 3300013308 | Bacteria | 12710 |
| 365 | Ga0157375_10009517 | 3300013308 | Bacteria | 8530 |
| 366 | Ga0157375_10065154 | 3300013308 | Bacteria | 3631 |
| 367 | Ga0157375_10126909 | 3300013308 | Unclassified | 2667 |
| 368 | Ga0157375_10383540 | 3300013308 | Bacteria | 1572 |
| 369 | Ga0157375_10701462 | 3300013308 | Unclassified | 1166 |
| 370 | Ga0163163_10108550 | 3300014325 | Bacteria | 2802 |
| 371 | Ga0163163_10123192 | 3300014325 | Bacteria | 2628 |
| 372 | Ga0157380_10004793 | 3300014326 | Bacteria | 9426 |
| 373 | Ga0157380_10043822 | 3300014326 | Unclassified | 3504 |
| 374 | Ga0157380_10119170 | 3300014326 | Unclassified | 2232 |
| 375 | Ga0157380_10328871 | 3300014326 | Bacteria | 1420 |
| 376 | Ga0157377_10134454 | 3300014745 | Unclassified | 1514 |
| 377 | Ga0157379_10008707 | 3300014968 | Bacteria | 8842 |
| 378 | Ga0157376_10012977 | 3300014969 | Bacteria | 6205 |
| 379 | Ga0157376_10055244 | 3300014969 | Bacteria | 3313 |
| 380 | Ga0157376_10520743 | 3300014969 | Unclassified | 1172 |
| 381 | Ga0163161_10014661 | 3300017792 | Bacteria | 5458 |
| 382 | Ga0163161_10019836 | 3300017792 | Bacteria | 4717 |
| 383 | Ga0163161_10092343 | 3300017792 | Bacteria | 2241 |
| 384 | Ga0163161_10109332 | 3300017792 | Bacteria | 2065 |
| 385 | Ga0163161_10118149 | 3300017792 | Bacteria | 1990 |
| 386 | Ga0163161_10156447 | 3300017792 | Unclassified | 1735 |
| 387 | Ga0207666_1001292 | 3300025271 | Unclassified | 2946 |
| 388 | Ga0207697_10052604 | 3300025315 | Bacteria | 1685 |
| 389 | Ga0207697_10084515 | 3300025315 | Unclassified | 1340 |
| 390 | Ga0207697_10122361 | 3300025315 | Unclassified | 1120 |
| 391 | Ga0207656_10056401 | 3300025321 | Bacteria | 1712 |
| 392 | Ga0207713_1060646 | 3300025735 | Unclassified | 1444 |
| 393 | Ga0207653_10009126 | 3300025885 | Bacteria | 3094 |
| 394 | Ga0207682_10031867 | 3300025893 | Unclassified | 2118 |
| 395 | Ga0207682_10072525 | 3300025893 | Bacteria | 1461 |
| 396 | Ga0207692_10052462 | 3300025898 | Bacteria | 2072 |
| 397 | Ga0207692_10153175 | 3300025898 | Bacteria | 1322 |
| 398 | Ga0207688_10081293 | 3300025901 | Bacteria | 1851 |
| 399 | Ga0207688_10267537 | 3300025901 | Bacteria | 1039 |
| 400 | Ga0207680_10002264 | 3300025903 | Bacteria | 8971 |
| 401 | Ga0207680_10080686 | 3300025903 | Bacteria | 2043 |
| 402 | Ga0207680_10186851 | 3300025903 | Bacteria | 1404 |
| 403 | Ga0207685_10012056 | 3300025905 | Bacteria | 2625 |
| 404 | Ga0207685_10097869 | 3300025905 | Bacteria | 1249 |
| 405 | Ga0207699_10003107 | 3300025906 | Bacteria | 7890 |
| 406 | Ga0207699_10008004 | 3300025906 | Bacteria | 5193 |
| 407 | Ga0207645_10140361 | 3300025907 | Bacteria | 1574 |
| 408 | Ga0207643_10100322 | 3300025908 | Bacteria | 1697 |
| 409 | Ga0207684_10120493 | 3300025910 | Bacteria | 2249 |
| 410 | Ga0207654_10037552 | 3300025911 | Bacteria | 2712 |
| 411 | Ga0207654_10041118 | 3300025911 | Bacteria | 2608 |
| 412 | Ga0207707_10001660 | 3300025912 | Bacteria | 20546 |
| 413 | Ga0207707_10183165 | 3300025912 | Bacteria | 1828 |
| 414 | Ga0207695_10075767 | 3300025913 | Bacteria | 3422 |
| 415 | Ga0207693_10005527 | 3300025915 | Bacteria | 10521 |
| 416 | Ga0207693_10013428 | 3300025915 | Bacteria | 6604 |
| 417 | Ga0207693_10021302 | 3300025915 | Bacteria | 5152 |
| 418 | Ga0207663_10005731 | 3300025916 | Bacteria | 6287 |
| 419 | Ga0207663_10148790 | 3300025916 | Viruses | 1640 |
| 420 | Ga0207663_10186214 | 3300025916 | Unclassified | 1487 |
| 421 | Ga0207660_10086337 | 3300025917 | Unclassified | 2317 |
| 422 | Ga0207660_10375453 | 3300025917 | Bacteria | 1142 |
| 423 | Ga0207662_10099506 | 3300025918 | Bacteria | 1800 |
| 424 | Ga0207662_10198042 | 3300025918 | Bacteria | 1299 |
| 425 | Ga0207657_10260069 | 3300025919 | Unclassified | 1381 |
| 426 | Ga0207649_10138253 | 3300025920 | Bacteria | 1663 |
| 427 | Ga0207652_10005062 | 3300025921 | Bacteria | 10693 |
| 428 | Ga0207652_10010980 | 3300025921 | Bacteria | 7302 |
| 429 | Ga0207652_10137290 | 3300025921 | Bacteria | 2184 |
| 430 | Ga0207646_10004205 | 3300025922 | Bacteria | 15761 |
| 431 | Ga0207646_10374453 | 3300025922 | Bacteria | 1286 |
| 432 | Ga0207681_10000795 | 3300025923 | Bacteria | 20798 |
| 433 | Ga0207681_10142052 | 3300025923 | Bacteria | 1789 |
| 434 | Ga0207681_10191708 | 3300025923 | Bacteria | 1564 |
| 435 | Ga0207681_10270574 | 3300025923 | Bacteria | 1333 |
| 436 | Ga0207650_10004622 | 3300025925 | Bacteria | 9415 |
| 437 | Ga0207650_10068310 | 3300025925 | Bacteria | 2668 |
| 438 | Ga0207650_10326526 | 3300025925 | Bacteria | 1258 |
| 439 | Ga0207659_10000948 | 3300025926 | Bacteria | 17347 |
| 440 | Ga0207659_10002548 | 3300025926 | Bacteria | 10844 |
| 441 | Ga0207687_10113835 | 3300025927 | Bacteria | 2013 |
| 442 | Ga0207687_10214473 | 3300025927 | Bacteria | 1512 |
| 443 | Ga0207687_10232769 | 3300025927 | Unclassified | 1456 |
| 444 | Ga0207700_10004740 | 3300025928 | Bacteria | 8067 |
| 445 | Ga0207700_10007138 | 3300025928 | Bacteria | 6808 |
| 446 | Ga0207700_10271502 | 3300025928 | Bacteria | 1456 |
| 447 | Ga0207664_10054849 | 3300025929 | Bacteria | 3160 |
| 448 | Ga0207644_10004844 | 3300025931 | Bacteria | 8761 |
| 449 | Ga0207644_10234458 | 3300025931 | Bacteria | 1459 |
| 450 | Ga0207644_10371429 | 3300025931 | Bacteria | 1165 |
| 451 | Ga0207644_10423167 | 3300025931 | Bacteria | 1091 |
| 452 | Ga0207690_10109456 | 3300025932 | Bacteria | 1988 |
| 453 | Ga0207690_10303672 | 3300025932 | Unclassified | 1250 |
| 454 | Ga0207706_10032604 | 3300025933 | Bacteria | 4639 |
| 455 | Ga0207706_10097040 | 3300025933 | Bacteria | 2592 |
| 456 | Ga0207706_10233144 | 3300025933 | Bacteria | 1610 |
| 457 | Ga0207706_10350063 | 3300025933 | Bacteria | 1285 |
| 458 | Ga0207706_10460198 | 3300025933 | Bacteria | 1100 |
| 459 | Ga0207686_10152970 | 3300025934 | Bacteria | 1608 |
| 460 | Ga0207709_10001091 | 3300025935 | Bacteria | 19875 |
| 461 | Ga0207709_10005754 | 3300025935 | Bacteria | 7003 |
| 462 | Ga0207709_10168919 | 3300025935 | Bacteria | 1533 |
| 463 | Ga0207709_10244784 | 3300025935 | Unclassified | 1306 |
| 464 | Ga0207670_10069356 | 3300025936 | Bacteria | 2432 |
| 465 | Ga0207670_10163130 | 3300025936 | Unclassified | 1665 |
| 466 | Ga0207669_10007648 | 3300025937 | Bacteria | 5017 |
| 467 | Ga0207669_10148493 | 3300025937 | Bacteria | 1638 |
| 468 | Ga0207669_10340792 | 3300025937 | Bacteria | 1154 |
| 469 | Ga0207704_10001128 | 3300025938 | Bacteria | 11880 |
| 470 | Ga0207704_10010907 | 3300025938 | Bacteria | 4454 |
| 471 | Ga0207704_10407472 | 3300025938 | Viruses | 1074 |
| 472 | Ga0207665_10006574 | 3300025939 | Bacteria | 7706 |
| 473 | Ga0207665_10009026 | 3300025939 | Bacteria | 6544 |
| 474 | Ga0207665_10135407 | 3300025939 | Bacteria | 1752 |
| 475 | Ga0207691_10013364 | 3300025940 | Bacteria | 7862 |
| 476 | Ga0207691_10218553 | 3300025940 | Bacteria | 1653 |
| 477 | Ga0207711_10058312 | 3300025941 | Unclassified | 3322 |
| 478 | Ga0207711_10381047 | 3300025941 | Bacteria | 1309 |
| 479 | Ga0207689_10003512 | 3300025942 | Bacteria | 14319 |
| 480 | Ga0207689_10010277 | 3300025942 | Bacteria | 8060 |
| 481 | Ga0207689_10145039 | 3300025942 | Unclassified | 1956 |
| 482 | Ga0207689_10321468 | 3300025942 | Bacteria | 1284 |
| 483 | Ga0207661_10083039 | 3300025944 | Bacteria | 2650 |
| 484 | Ga0207661_10176991 | 3300025944 | Bacteria | 1861 |
| 485 | Ga0207661_10324583 | 3300025944 | Bacteria | 1384 |
| 486 | Ga0207679_10037948 | 3300025945 | Bacteria | 3429 |
| 487 | Ga0207667_10176097 | 3300025949 | Bacteria | 2197 |
| 488 | Ga0207667_10260023 | 3300025949 | Bacteria | 1775 |
| 489 | Ga0207667_10547317 | 3300025949 | Unclassified | 1171 |
| 490 | Ga0207651_10076453 | 3300025960 | Bacteria | 2393 |
| 491 | Ga0207712_10016858 | 3300025961 | Bacteria | 4737 |
| 492 | Ga0207712_10097888 | 3300025961 | Unclassified | 2174 |
| 493 | Ga0207712_10340988 | 3300025961 | Unclassified | 1243 |
| 494 | Ga0207668_10004719 | 3300025972 | Bacteria | 8016 |
| 495 | Ga0207668_10032927 | 3300025972 | Unclassified | 3431 |
| 496 | Ga0207668_10053532 | 3300025972 | Unclassified | 2797 |
| 497 | Ga0207640_10428741 | 3300025981 | Bacteria | 1084 |
| 498 | Ga0207658_10012149 | 3300025986 | Bacteria | 5873 |
| 499 | Ga0207677_10301278 | 3300026023 | Unclassified | 1324 |
| 500 | Ga0207703_10001999 | 3300026035 | Bacteria | 17992 |
| 501 | Ga0207703_10054709 | 3300026035 | Bacteria | 3246 |
| 502 | Ga0207703_10086686 | 3300026035 | Unclassified | 2623 |
| 503 | Ga0207703_10406195 | 3300026035 | Unclassified | 1264 |
| 504 | Ga0207639_10336171 | 3300026041 | Bacteria | 1345 |
| 505 | Ga0207639_10369809 | 3300026041 | Unclassified | 1285 |
| 506 | Ga0207678_10016458 | 3300026067 | Bacteria | 6492 |
| 507 | Ga0207678_10049297 | 3300026067 | Unclassified | 3640 |
| 508 | Ga0207678_10056436 | 3300026067 | Bacteria | 3380 |
| 509 | Ga0207678_10111875 | 3300026067 | Bacteria | 2329 |
| 510 | Ga0207678_10157876 | 3300026067 | Bacteria | 1937 |
| 511 | Ga0207678_10378623 | 3300026067 | Bacteria | 1223 |
| 512 | Ga0207678_10465606 | 3300026067 | Bacteria | 1100 |
| 513 | Ga0207708_10019266 | 3300026075 | Bacteria | 5141 |
| 514 | Ga0207708_10023082 | 3300026075 | Bacteria | 4700 |
| 515 | Ga0207708_10028708 | 3300026075 | Bacteria | 4213 |
| 516 | Ga0207708_10279879 | 3300026075 | Bacteria | 1351 |
| 517 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 518 | Ga0207641_10045615 | 3300026088 | Bacteria | 3691 |
| 519 | Ga0207648_10009156 | 3300026089 | Bacteria | 9513 |
| 520 | Ga0207648_10061272 | 3300026089 | Bacteria | 3281 |
| 521 | Ga0207648_10170018 | 3300026089 | Bacteria | 1927 |
| 522 | Ga0207648_10250302 | 3300026089 | Bacteria | 1579 |
| 523 | Ga0207676_10003243 | 3300026095 | Bacteria | 11584 |
| 524 | Ga0207676_10017788 | 3300026095 | Bacteria | 5158 |
| 525 | Ga0207674_10063659 | 3300026116 | Bacteria | 3723 |
| 526 | Ga0207674_10135721 | 3300026116 | Bacteria | 2422 |
| 527 | Ga0207675_100003386 | 3300026118 | Bacteria | 15580 |
| 528 | Ga0207675_100269059 | 3300026118 | Bacteria | 1653 |
| 529 | Ga0207683_10028153 | 3300026121 | Bacteria | 4858 |
| 530 | Ga0207683_10032475 | 3300026121 | Bacteria | 4535 |
| 531 | Ga0207683_10047450 | 3300026121 | Unclassified | 3762 |
| 532 | Ga0207683_10118671 | 3300026121 | Bacteria | 2373 |
| 533 | Ga0207683_10247313 | 3300026121 | Unclassified | 1627 |
| 534 | Ga0207683_10250745 | 3300026121 | Bacteria | 1616 |
| 535 | Ga0207698_10128016 | 3300026142 | Bacteria | 2164 |
| 536 | Ga0207698_10182198 | 3300026142 | Bacteria | 1861 |
| 537 | Ga0207698_10235814 | 3300026142 | Unclassified | 1664 |
| 538 | Ga0209179_1001895 | 3300027512 | Bacteria | 2694 |
| 539 | Ga0209588_1006064 | 3300027671 | Bacteria | 3491 |
| 540 | Ga0209588_1011526 | 3300027671 | Bacteria | 2673 |
| 541 | Ga0207428_10000664 | 3300027907 | Bacteria | 40266 |
| 542 | Ga0207428_10011295 | 3300027907 | Bacteria | 7909 |
| 543 | Ga0207428_10072712 | 3300027907 | Bacteria | 2699 |
| 544 | Ga0268266_10056339 | 3300028379 | Bacteria | 3382 |
| 545 | Ga0268266_10143361 | 3300028379 | Bacteria | 2145 |
| 546 | Ga0268265_10009944 | 3300028380 | Bacteria | 6425 |
| 547 | Ga0268265_10164502 | 3300028380 | Unclassified | 1889 |
| 548 | Ga0268264_10015732 | 3300028381 | Bacteria | 6195 |
| 549 | Ga0268264_10237528 | 3300028381 | Bacteria | 1686 |
| 550 | Ga0268264_10279028 | 3300028381 | Unclassified | 1564 |
| 551 | Ga0268264_10287305 | 3300028381 | Bacteria | 1543 |
| 552 | Ga0268264_10335335 | 3300028381 | Bacteria | 1435 |
| 553 | Ga0373930_0000082 | 3300034816 | Bacteria | 9567 |
| 554 | Ga0373930_0026003 | 3300034816 | Bacteria | 1178 |
| 555 | Ga0373948_0001083 | 3300034817 | Bacteria | 3688 |
| 556 | Ga0373950_0001391 | 3300034818 | Bacteria | 3149 |
| 557 | Ga0373958_0000241 | 3300034819 | Bacteria | 6407 |
| 558 | Ga0373958_0004533 | 3300034819 | Bacteria | 2060 |
| 559 | Ga0373938_0000222 | 3300034957 | Bacteria | 8761 |
| 560 | Ga0373926_0082663 | 3300035083 | Bacteria | 1189 |
| 561 | Ga0373926_0083062 | 3300035083 | Bacteria | 1186 |
| 562 | Ga0373928_0000048 | 3300035084 | Bacteria | 20964 |
| 563 | Ga0373929_0000056 | 3300035085 | Bacteria | 20392 |
| 564 | Ga0373940_0005577 | 3300035088 | Bacteria | 2736 |
| 565 | Ga0373944_0048510 | 3300035089 | Bacteria | 1333 |
| 566 | Ga0373949_0000558 | 3300035090 | Bacteria | 12270 |
| 567 | Ga0373951_0000521 | 3300035091 | Bacteria | 10836 |
| 568 | Ga0373952_0001750 | 3300035092 | Bacteria | 3943 |
| 569 | Ga0373932_0000755 | 3300035112 | Bacteria | 9636 |
| 570 | Ga0373936_0029667 | 3300035113 | Bacteria | 2154 |
| 571 | Ga0373936_0067083 | 3300035113 | Bacteria | 1474 |
| 572 | Ga0373939_0004609 | 3300035114 | Bacteria | 3265 |
| 573 | Ga0373941_0000282 | 3300035115 | Bacteria | 9813 |
| 574 | Ga0373945_0004304 | 3300035116 | Bacteria | 4521 |
| 575 | Ga0373945_0015155 | 3300035116 | Bacteria | 2591 |
| 576 | Ga0373945_0043946 | 3300035116 | Bacteria | 1623 |
| 577 | Ga0373945_0118288 | 3300035116 | Bacteria | 1051 |
| 578 | Ga0373953_0096980 | 3300035117 | Unclassified | 1238 |
| 579 | Ga0373954_0045877 | 3300035118 | Bacteria | 2042 |
| 580 | Ga0373954_0048756 | 3300035118 | Unclassified | 1985 |
| 581 | Ga0373956_0040326 | 3300035119 | Bacteria | 2071 |
| 582 | Ga0373957_0093902 | 3300035120 | Unclassified | 1195 |
| 583 | Ga0373960_0000021 | 3300035121 | Bacteria | 20241 |
| 584 | Ga0373943_0005050 | 3300035170 | Bacteria | 5952 |
| 585 | Ga0373943_0139124 | 3300035170 | Bacteria | 1306 |
| 586 | Ga0373946_0002290 | 3300035171 | Bacteria | 6771 |
| 587 | Ga0373946_0015782 | 3300035171 | Bacteria | 2869 |
| 588 | Ga0373955_0199689 | 3300035172 | Unclassified | 1190 |
| 589 | Ga0373942_0014196 | 3300035207 | Bacteria | 1924 |
| 590 | Ga0373961_0000771 | 3300035241 | Bacteria | 10989 |
| 591 | Ga0373962_0005559 | 3300035242 | Bacteria | 3046 |
| 592 | Ga0373924_0060706 | 3300035410 | Bacteria | 1581 |
| 593 | Ga0373931_0002703 | 3300035691 | Bacteria | 7890 |
| 594 | Ga0373931_0004981 | 3300035691 | Bacteria | 6109 |
| 595 | Ga0373931_0034068 | 3300035691 | Bacteria | 2641 |
| 596 | Ga0373931_0101817 | 3300035691 | Unclassified | 1616 |
| 597 | Ga0373931_0151310 | 3300035691 | Bacteria | 1353 |
| 598 | Ga0373931_0155416 | 3300035691 | Bacteria | 1336 |
| 599 | Ga0373935_0008332 | 3300035692 | Bacteria | 6201 |
| 600 | Ga0373935_0087091 | 3300035692 | Bacteria | 2039 |
| 601 | Ga0373927_0033954 | 3300035695 | Bacteria | 3319 |
| 602 | Ga0373927_0037073 | 3300035695 | Bacteria | 3170 |
| 603 | Ga0373927_0051061 | 3300035695 | Bacteria | 2674 |
| 604 | Ga0373927_0241098 | 3300035695 | Bacteria | 1188 |
| 605 | Ga0373933_0133956 | 3300035724 | Bacteria | 1560 |
| 606 | Ga0373947_0002200 | 3300035725 | Bacteria | 11814 |
| 607 | Ga0373947_0028788 | 3300035725 | Bacteria | 3258 |
| 608 | Ga0373947_0120157 | 3300035725 | Unclassified | 1668 |
| 609 | Ga0373947_0169144 | 3300035725 | Unclassified | 1417 |
| 610 | Ga0373947_0185441 | 3300035725 | Bacteria | 1356 |
| 611 | Ga0373937_0011015 | 3300036401 | Bacteria | 7926 |
| 612 | Ga0373937_0064505 | 3300036401 | Bacteria | 3369 |
| 613 | Ga0373937_0095017 | 3300036401 | Bacteria | 2764 |
| 614 | Ga0373937_0265136 | 3300036401 | Bacteria | 1620 |
| 615 | Ga0373925_0040668 | 3300037068 | Bacteria | 3443 |
| 616 | Ga0373925_0105396 | 3300037068 | Bacteria | 2172 |
| 617 | Ga0373925_0343858 | 3300037068 | Bacteria | 1210 |
| 618 | Ga0373925_0454077 | 3300037068 | Unclassified | 1050 |
| 619 | Ga0395900_0121610 | 3300037418 | Bacteria | 2678 |
| 620 | Ga0395898_0013732 | 3300037466 | Bacteria | 8330 |
| 621 | Ga0395898_0542424 | 3300037466 | Bacteria | 1105 |
| 622 | Ga0395901_0010282 | 3300038443 | Bacteria | 9478 |
| 623 | Ga0395901_0482758 | 3300038443 | Bacteria | 1264 |
| 624 | Ga0436365_0717194 | 3300039437 | Bacteria | 1678 |
| 625 | Ga0451853_3533905 | 3300041512 | Unclassified | 1192 |
| 626 | Ga0439435_0011590 | 3300042436 | Bacteria | 2118 |
| 627 | Ga0439464_0014471 | 3300042439 | Bacteria | 2121 |
| 628 | Ga0439464_0037235 | 3300042439 | Bacteria | 1379 |
| 629 | Ga0439460_0002108 | 3300042461 | Bacteria | 4767 |
| 630 | Ga0453683_0006221 | 3300044673 | Bacteria | 8214 |
| 631 | Ga0453683_0138771 | 3300044673 | Bacteria | 1534 |
| 632 | Ga0466957_0037879 | 3300044842 | Bacteria | 2904 |
| 633 | Ga0466959_0052653 | 3300045049 | Bacteria | 2980 |
| 634 | Ga0451576_0022529 | 3300045051 | Bacteria | 6829 |
| 635 | Ga0451576_0037628 | 3300045051 | Bacteria | 5125 |
| 636 | Ga0495592_0132334 | 3300046454 | Bacteria | 1743 |
| 637 | Ga0495603_0000092 | 3300046455 | Bacteria | 40980 |
| 638 | Ga0495603_0023861 | 3300046455 | Bacteria | 3700 |
| 639 | Ga0495603_0031574 | 3300046455 | Bacteria | 3189 |
| 640 | Ga0495603_0032639 | 3300046455 | Bacteria | 3132 |
| 641 | Ga0495590_0025471 | 3300046457 | Bacteria | 2080 |
| 642 | Ga0495629_0003950 | 3300046459 | Bacteria | 11154 |
| 643 | Ga0495629_0012730 | 3300046459 | Bacteria | 6091 |
| 644 | Ga0495629_0024398 | 3300046459 | Bacteria | 4306 |
| 645 | Ga0495629_0080953 | 3300046459 | Bacteria | 2267 |
| 646 | Ga0495641_0022828 | 3300046461 | Bacteria | 3122 |
| 647 | Ga0495580_0000120 | 3300046472 | Bacteria | 53826 |
| 648 | Ga0495580_0035859 | 3300046472 | Bacteria | 3565 |
| 649 | Ga0495580_0037749 | 3300046472 | Unclassified | 3464 |
| 650 | Ga0495580_0106766 | 3300046472 | Unclassified | 1945 |
| 651 | Ga0495580_0249154 | 3300046472 | Bacteria | 1216 |
| 652 | Ga0495582_0000039 | 3300046473 | Bacteria | 66883 |
| 653 | Ga0495582_0018429 | 3300046473 | Bacteria | 3817 |
| 654 | Ga0495582_0063386 | 3300046473 | Bacteria | 2042 |
| 655 | Ga0495582_0161613 | 3300046473 | Bacteria | 1274 |
| 656 | Ga0495639_0000441 | 3300046475 | Bacteria | 19762 |
| 657 | Ga0495639_0030313 | 3300046475 | Bacteria | 2404 |
| 658 | Ga0495639_0073595 | 3300046475 | Bacteria | 1582 |
| 659 | Ga0495639_0128400 | 3300046475 | Bacteria | 1212 |
| 660 | Ga0495662_0017280 | 3300046476 | Bacteria | 3491 |
| 661 | Ga0495664_0034746 | 3300046477 | Bacteria | 2966 |
| 662 | Ga0495664_0116488 | 3300046477 | Bacteria | 1615 |
| 663 | Ga0495584_0090494 | 3300046491 | Bacteria | 1543 |
| 664 | Ga0495585_0139498 | 3300046492 | Bacteria | 1270 |
| 665 | Ga0495585_0160009 | 3300046492 | Bacteria | 1169 |
| 666 | Ga0495594_0003605 | 3300046499 | Bacteria | 7961 |
| 667 | Ga0495594_0027843 | 3300046499 | Bacteria | 3047 |
| 668 | Ga0495594_0049195 | 3300046499 | Bacteria | 2317 |
| 669 | Ga0495594_0067361 | 3300046499 | Bacteria | 1987 |
| 670 | Ga0495594_0086514 | 3300046499 | Unclassified | 1754 |
| 671 | Ga0495594_0176603 | 3300046499 | Bacteria | 1215 |
| 672 | Ga0495594_0204337 | 3300046499 | Bacteria | 1126 |
| 673 | Ga0495594_0222700 | 3300046499 | Bacteria | 1076 |
| 674 | Ga0495628_0018365 | 3300046516 | Bacteria | 5794 |
| 675 | Ga0495628_0159905 | 3300046516 | Bacteria | 1712 |
| 676 | Ga0495630_0061837 | 3300046517 | Bacteria | 2812 |
| 677 | Ga0495630_0249703 | 3300046517 | Bacteria | 1355 |
| 678 | Ga0495652_0062235 | 3300046529 | Bacteria | 3147 |
| 679 | Ga0495665_0027711 | 3300046531 | Bacteria | 3039 |
| 680 | Ga0495665_0072971 | 3300046531 | Bacteria | 1807 |
| 681 | Ga0495640_0046816 | 3300046533 | Bacteria | 2995 |
| 682 | Ga0495586_0031683 | 3300046535 | Bacteria | 2833 |
| 683 | Ga0495622_0021018 | 3300046557 | Bacteria | 3040 |
| 684 | Ga0495622_0047519 | 3300046557 | Bacteria | 1994 |
| 685 | Ga0495622_0051816 | 3300046557 | Bacteria | 1904 |
| 686 | Ga0495668_0156764 | 3300046616 | Bacteria | 1247 |
| 687 | Ga0495634_0008568 | 3300046642 | Bacteria | 7599 |
| 688 | Ga0495634_0051946 | 3300046642 | Bacteria | 2749 |
| 689 | Ga0495635_0035409 | 3300046663 | Bacteria | 3460 |
| 690 | Ga0495635_0062837 | 3300046663 | Bacteria | 2550 |
| 691 | Ga0495588_0007162 | 3300046674 | Bacteria | 5060 |
| 692 | Ga0495588_0014118 | 3300046674 | Bacteria | 3818 |
| 693 | Ga0495588_0173604 | 3300046674 | Bacteria | 1140 |
| 694 | Ga0495647_0007938 | 3300046681 | Bacteria | 3566 |
| 695 | Ga0495647_0057195 | 3300046681 | Bacteria | 1530 |
| 696 | Ga0495647_0105087 | 3300046681 | Bacteria | 1172 |
| 697 | Ga0495658_0003032 | 3300046683 | Bacteria | 8416 |
| 698 | Ga0495658_0006358 | 3300046683 | Bacteria | 5802 |
| 699 | Ga0495658_0016616 | 3300046683 | Bacteria | 3788 |
| 700 | Ga0495658_0019548 | 3300046683 | Bacteria | 3538 |
| 701 | Ga0495669_0104033 | 3300046684 | Bacteria | 1321 |
| 702 | Ga0495613_0053585 | 3300046689 | Unclassified | 2968 |
| 703 | Ga0495624_0011119 | 3300046690 | Bacteria | 6191 |
| 704 | Ga0495624_0036884 | 3300046690 | Bacteria | 3148 |
| 705 | Ga0495670_0164115 | 3300046691 | Bacteria | 1168 |
| 706 | Ga0495581_0018347 | 3300047315 | Bacteria | 4064 |
| 707 | Ga0495581_0032014 | 3300047315 | Bacteria | 3045 |
| 708 | Ga0495674_0068044 | 3300047319 | Bacteria | 3083 |
| 709 | Ga0495674_0263645 | 3300047319 | Bacteria | 1415 |
| 710 | Ga0495676_0022963 | 3300047321 | Bacteria | 5421 |
| 711 | Ga0495676_0082840 | 3300047321 | Bacteria | 2426 |
| 712 | Ga0495676_0143638 | 3300047321 | Bacteria | 1707 |
| 713 | Ga0495676_0221283 | 3300047321 | Bacteria | 1304 |
| 714 | Ga0495680_0133694 | 3300047322 | Bacteria | 1820 |
| 715 | Ga0495680_0146941 | 3300047322 | Unclassified | 1721 |
| 716 | Ga0495686_0098569 | 3300047472 | Bacteria | 1766 |
| 717 | Ga0495593_0002416 | 3300047673 | Bacteria | 11229 |
| 718 | Ga0495593_0041300 | 3300047673 | Unclassified | 2480 |
| 719 | Ga0495614_0018224 | 3300048089 | Bacteria | 3042 |
| 720 | Ga0496100_0009979 | 3300048903 | Bacteria | 5359 |
| 721 | Ga0496100_0046567 | 3300048903 | Unclassified | 2790 |
| 722 | Ga0496100_0103865 | 3300048903 | Bacteria | 1963 |
| 723 | Ga0496100_0206613 | 3300048903 | Bacteria | 1434 |
| 724 | Ga0496101_0004178 | 3300048904 | Bacteria | 9044 |
| 725 | Ga0496101_0039623 | 3300048904 | Bacteria | 3352 |
| 726 | Ga0496101_0043583 | 3300048904 | Bacteria | 3207 |
| 727 | Ga0496101_0073963 | 3300048904 | Bacteria | 2504 |
| 728 | Ga0496101_0117328 | 3300048904 | Bacteria | 2009 |
| 729 | Ga0496101_0153956 | 3300048904 | Bacteria | 1760 |
| 730 | Ga0496102_0021943 | 3300048905 | Bacteria | 5653 |
| 731 | Ga0496102_0040849 | 3300048905 | Bacteria | 4198 |
| 732 | Ga0496102_0071149 | 3300048905 | Bacteria | 3193 |
| 733 | Ga0496102_0109817 | 3300048905 | Unclassified | 2570 |
| 734 | Ga0496102_0165310 | 3300048905 | Bacteria | 2082 |
| 735 | Ga0496102_0620121 | 3300048905 | Bacteria | 1005 |
| 736 | Ga0496103_0017950 | 3300048906 | Bacteria | 4240 |
| 737 | Ga0496103_0093415 | 3300048906 | Bacteria | 1899 |
| 738 | Ga0496104_0000220 | 3300048907 | Bacteria | 50041 |
| 739 | Ga0496104_0003887 | 3300048907 | Bacteria | 12930 |
| 740 | Ga0496104_0004734 | 3300048907 | Bacteria | 11842 |
| 741 | Ga0496104_0007480 | 3300048907 | Bacteria | 9654 |
| 742 | Ga0496104_0008349 | 3300048907 | Bacteria | 9201 |
| 743 | Ga0496104_0010878 | 3300048907 | Bacteria | 8138 |
| 744 | Ga0496104_0012907 | 3300048907 | Bacteria | 7523 |
| 745 | Ga0496104_0046618 | 3300048907 | Bacteria | 4082 |
| 746 | Ga0496104_0053745 | 3300048907 | Bacteria | 3806 |
| 747 | Ga0496104_0075970 | 3300048907 | Bacteria | 3199 |
| 748 | Ga0496104_0256665 | 3300048907 | Bacteria | 1661 |
| 749 | Ga0496104_0421894 | 3300048907 | Unclassified | 1246 |
| 750 | Ga0496105_0004150 | 3300048908 | Bacteria | 10870 |
| 751 | Ga0496105_0006955 | 3300048908 | Bacteria | 8715 |
| 752 | Ga0496105_0016540 | 3300048908 | Bacteria | 5890 |
| 753 | Ga0496105_0020393 | 3300048908 | Bacteria | 5356 |
| 754 | Ga0496105_0121836 | 3300048908 | Bacteria | 2150 |
| 755 | Ga0496105_0133563 | 3300048908 | Bacteria | 2045 |
| 756 | Ga0496105_0149728 | 3300048908 | Bacteria | 1918 |
| 757 | Ga0496105_0367608 | 3300048908 | Unclassified | 1146 |
| 758 | Ga0496105_0373245 | 3300048908 | Bacteria | 1136 |
| 759 | Ga0496106_0017445 | 3300048909 | Bacteria | 5312 |
| 760 | Ga0496106_0085006 | 3300048909 | Bacteria | 2435 |
| 761 | Ga0496106_0108375 | 3300048909 | Bacteria | 2160 |
| 762 | Ga0496106_0128664 | 3300048909 | Bacteria | 1984 |
| 763 | Ga0496106_0251702 | 3300048909 | Bacteria | 1412 |
| 764 | Ga0496106_0273233 | 3300048909 | Unclassified | 1353 |
| 765 | Ga0496107_0011412 | 3300048910 | Bacteria | 6188 |
| 766 | Ga0496107_0012044 | 3300048910 | Bacteria | 6031 |
| 767 | Ga0496107_0015801 | 3300048910 | Bacteria | 5295 |
| 768 | Ga0496107_0041209 | 3300048910 | Bacteria | 3315 |
| 769 | Ga0496107_0266313 | 3300048910 | Bacteria | 1275 |
| 770 | Ga0496108_0011929 | 3300048911 | Bacteria | 7070 |
| 771 | Ga0496108_0031311 | 3300048911 | Bacteria | 4413 |
| 772 | Ga0496108_0045049 | 3300048911 | Plasmid | 3683 |
| 773 | Ga0496108_0054146 | 3300048911 | Unclassified | 3367 |
| 774 | Ga0496108_0106508 | 3300048911 | Bacteria | 2394 |
| 775 | Ga0496108_0186850 | 3300048911 | Bacteria | 1795 |
| 776 | Ga0496108_0465102 | 3300048911 | Bacteria | 1105 |
| 777 | Ga0496109_0028866 | 3300048912 | Bacteria | 4966 |
| 778 | Ga0496109_0040542 | 3300048912 | Bacteria | 4218 |
| 779 | Ga0496109_0044904 | 3300048912 | Bacteria | 4009 |
| 780 | Ga0496109_0094894 | 3300048912 | Bacteria | 2761 |
| 781 | Ga0496109_0232837 | 3300048912 | Bacteria | 1733 |
| 782 | Ga0496109_0253200 | 3300048912 | Unclassified | 1658 |
| 783 | Ga0496109_0492716 | 3300048912 | Bacteria | 1157 |
| 784 | Ga0496109_0535515 | 3300048912 | Unclassified | 1105 |
| 785 | Ga0496110_0003153 | 3300048913 | Bacteria | 12538 |
| 786 | Ga0496110_0019053 | 3300048913 | Bacteria | 5768 |
| 787 | Ga0496110_0032469 | 3300048913 | Bacteria | 4509 |
| 788 | Ga0496110_0039560 | 3300048913 | Bacteria | 4106 |
| 789 | Ga0496110_0065499 | 3300048913 | Bacteria | 3212 |
| 790 | Ga0496110_0131805 | 3300048913 | Bacteria | 2258 |
| 791 | Ga0496110_0170830 | 3300048913 | Unclassified | 1972 |
| 792 | Ga0496110_0209791 | 3300048913 | Bacteria | 1771 |
| 793 | Ga0496110_0298015 | 3300048913 | Unclassified | 1469 |
| 794 | Ga0496111_0007249 | 3300048914 | Bacteria | 7255 |
| 795 | Ga0496111_0033542 | 3300048914 | Bacteria | 3662 |
| 796 | Ga0496111_0134173 | 3300048914 | Bacteria | 1833 |
| 797 | Ga0496111_0136910 | 3300048914 | Unclassified | 1814 |
| 798 | Ga0496111_0155948 | 3300048914 | Bacteria | 1694 |
| 799 | Ga0496111_0215348 | 3300048914 | Bacteria | 1427 |
| 800 | Ga0496112_0008064 | 3300048915 | Bacteria | 9400 |
| 801 | Ga0496112_0020083 | 3300048915 | Bacteria | 6324 |
| 802 | Ga0496112_0030287 | 3300048915 | Bacteria | 5235 |
| 803 | Ga0496112_0049135 | 3300048915 | Bacteria | 4134 |
| 804 | Ga0496112_0075854 | 3300048915 | Bacteria | 3325 |
| 805 | Ga0496112_0165021 | 3300048915 | Bacteria | 2181 |
| 806 | Ga0496112_0166453 | 3300048915 | Bacteria | 2170 |
| 807 | Ga0496112_0190692 | 3300048915 | Bacteria | 2012 |
| 808 | Ga0496112_0254599 | 3300048915 | Bacteria | 1706 |
| 809 | Ga0496112_0462512 | 3300048915 | Unclassified | 1206 |
| 810 | Ga0496113_0029631 | 3300048916 | Bacteria | 3956 |
| 811 | Ga0496113_0032558 | 3300048916 | Unclassified | 3789 |
| 812 | Ga0496113_0043101 | 3300048916 | Plasmid | 3337 |
| 813 | Ga0496113_0050085 | 3300048916 | Bacteria | 3112 |
| 814 | Ga0496113_0058782 | 3300048916 | Bacteria | 2894 |
| 815 | Ga0496113_0149378 | 3300048916 | Unclassified | 1842 |
| 816 | Ga0496114_0027018 | 3300048917 | Bacteria | 4701 |
| 817 | Ga0496114_0033103 | 3300048917 | Bacteria | 4257 |
| 818 | Ga0496114_0043578 | 3300048917 | Bacteria | 3721 |
| 819 | Ga0496114_0139501 | 3300048917 | Bacteria | 2098 |
| 820 | Ga0496114_0205618 | 3300048917 | Bacteria | 1726 |
| 821 | Ga0496114_0319677 | 3300048917 | Unclassified | 1371 |
| 822 | Ga0496114_0506075 | 3300048917 | Unclassified | 1068 |
| 823 | Ga0496115_0002974 | 3300048918 | Bacteria | 12180 |
| 824 | Ga0496115_0025751 | 3300048918 | Bacteria | 4584 |
| 825 | Ga0496115_0053058 | 3300048918 | Bacteria | 3253 |
| 826 | Ga0496115_0055835 | 3300048918 | Bacteria | 3173 |
| 827 | Ga0496115_0097583 | 3300048918 | Unclassified | 2406 |
| 828 | Ga0496115_0099223 | 3300048918 | Bacteria | 2386 |
| 829 | Ga0496115_0132194 | 3300048918 | Bacteria | 2057 |
| 830 | Ga0496125_0263707 | 3300048928 | Bacteria | 1078 |
| 831 | Ga0501032_0108400 | 3300049569 | Unclassified | 1839 |
| 832 | Ga0501033_0231081 | 3300049570 | Bacteria | 1314 |
| 833 | Ga0501036_0039309 | 3300049572 | Bacteria | 4004 |
| 834 | Ga0501036_0061575 | 3300049572 | Bacteria | 3179 |
| 835 | Ga0501038_0001763 | 3300049574 | Bacteria | 20122 |
| 836 | Ga0501040_0009053 | 3300049576 | Bacteria | 6478 |
| 837 | Ga0501040_0022067 | 3300049576 | Bacteria | 4258 |
| 838 | Ga0501041_0152971 | 3300049577 | Bacteria | 1441 |
| 839 | Ga0501046_0010851 | 3300049580 | Bacteria | 7809 |
| 840 | Ga0501046_0274874 | 3300049580 | Bacteria | 1235 |
| 841 | Ga0501048_0001087 | 3300049582 | Bacteria | 20390 |
| 842 | Ga0501048_0060186 | 3300049582 | Bacteria | 2691 |
| 843 | Ga0501048_0285421 | 3300049582 | Bacteria | 1174 |
| 844 | Ga0501068_0005846 | 3300049584 | Bacteria | 6749 |
| 845 | Ga0501069_0160933 | 3300049585 | Bacteria | 1293 |
| 846 | Ga0501071_0050022 | 3300049587 | Bacteria | 3010 |
| 847 | Ga0501071_0172749 | 3300049587 | Bacteria | 1618 |
| 848 | Ga0501072_0006517 | 3300049588 | Bacteria | 8891 |
| 849 | Ga0501072_0010608 | 3300049588 | Bacteria | 7016 |
| 850 | Ga0501072_0084127 | 3300049588 | Bacteria | 2522 |
| 851 | Ga0501072_0386669 | 3300049588 | Unclassified | 1110 |
| 852 | Ga0501075_0023006 | 3300049591 | Bacteria | 4558 |
| 853 | Ga0501075_0045600 | 3300049591 | Bacteria | 3291 |
| 854 | Ga0501075_0344453 | 3300049591 | Bacteria | 1136 |
| 855 | Ga0501075_0408781 | 3300049591 | Unclassified | 1035 |
| 856 | Ga0501076_0000166 | 3300049592 | Bacteria | 38261 |
| 857 | Ga0501076_0000941 | 3300049592 | Bacteria | 18993 |
| 858 | Ga0501076_0030156 | 3300049592 | Bacteria | 4224 |
| 859 | Ga0501076_0240845 | 3300049592 | Unclassified | 1480 |
| 860 | Ga0501076_0538091 | 3300049592 | Unclassified | 963 |
| 861 | Ga0501077_0000059 | 3300049593 | Bacteria | 55812 |
| 862 | Ga0501079_0001697 | 3300049741 | Bacteria | 15680 |
| 863 | Ga0501080_0000357 | 3300049742 | Bacteria | 35204 |
| 864 | Ga0501080_0022167 | 3300049742 | Bacteria | 5883 |
| 865 | Ga0501081_0016967 | 3300049743 | Bacteria | 4812 |
| 866 | Ga0501083_0297311 | 3300049744 | Bacteria | 1050 |
| 867 | Ga0501045_0006400 | 3300049824 | Bacteria | 8152 |
| 868 | Ga0501045_0026363 | 3300049824 | Bacteria | 4180 |
| 869 | nmdc:mga0yw44_89662_c1 | 3300050492 | Bacteria | 1941 |
| 870 | nmdc:mga0k408_18287_c1 | 3300050493 | Bacteria | 3911 |
| 871 | nmdc:mga07m45_141959_c1 | 3300050496 | Bacteria | 1391 |
| 872 | nmdc:mga07m45_179417_c1 | 3300050496 | Bacteria | 1231 |
| 873 | nmdc:mga05p37_100784_c1 | 3300050507 | Bacteria | 3557 |
| 874 | nmdc:mga05p37_130378_c1 | 3300050507 | Bacteria | 3085 |
| 875 | nmdc:mga05p37_140194_c1 | 3300050507 | Bacteria | 2963 |
| 876 | nmdc:mga05p37_367185_c1 | 3300050507 | Unclassified | 1690 |
| 877 | nmdc:mga05p37_53636_c1 | 3300050507 | Unclassified | 4959 |
| 878 | nmdc:mga05p37_6539_c1 | 3300050507 | Bacteria | 13747 |
| 879 | nmdc:mga05p37_9213_c1 | 3300050507 | Bacteria | 11667 |
| 880 | nmdc:mga05p37_96170_c1 | 3300050507 | Bacteria | 3649 |
| 881 | nmdc:mga05p37_9798_c1 | 3300050507 | Bacteria | 11369 |
| 882 | nmdc:mga09592_250671_c1 | 3300050508 | Unclassified | 1535 |
| 883 | nmdc:mga09592_265770_c1 | 3300050508 | Unclassified | 1488 |
| 884 | nmdc:mga09592_3912_c1 | 3300050508 | Bacteria | 11998 |
| 885 | nmdc:mga09592_40166_c1 | 3300050508 | Bacteria | 3930 |
| 886 | nmdc:mga09592_45933_c1 | 3300050508 | Unclassified | 3678 |
| 887 | nmdc:mga0qj67_16709_c1 | 3300050509 | Bacteria | 5571 |
| 888 | nmdc:mga0qj67_354073_c1 | 3300050509 | Bacteria | 1187 |
| 889 | nmdc:mga06r32_15651_c1 | 3300050510 | Bacteria | 6891 |
| 890 | nmdc:mga06r32_276146_c1 | 3300050510 | Unclassified | 1668 |
| 891 | nmdc:mga06r32_453457_c1 | 3300050510 | Bacteria | 1262 |
| 892 | nmdc:mga06r32_59509_c1 | 3300050510 | Bacteria | 3674 |
| 893 | nmdc:mga08y16_3102_c1 | 3300050511 | Bacteria | 17196 |
| 894 | nmdc:mga08y16_341406_c1 | 3300050511 | Bacteria | 1539 |
| 895 | nmdc:mga08y16_352603_c1 | 3300050511 | Bacteria | 1511 |
| 896 | nmdc:mga08y16_362972_c1 | 3300050511 | Bacteria | 1487 |
| 897 | nmdc:mga08y16_561165_c1 | 3300050511 | Unclassified | 1155 |
| 898 | nmdc:mga08y16_5778_c1 | 3300050511 | Bacteria | 12957 |
| 899 | nmdc:mga0n895_116446_c1 | 3300050512 | Bacteria | 2691 |
| 900 | nmdc:mga0n895_11965_c1 | 3300050512 | Bacteria | 7763 |
| 901 | nmdc:mga0n895_132992_c1 | 3300050512 | Unclassified | 2513 |
| 902 | nmdc:mga0n895_1477_c1 | 3300050512 | Bacteria | 17626 |
| 903 | nmdc:mga0n895_26132_c1 | 3300050512 | Bacteria | 5525 |
| 904 | nmdc:mga0n895_261734_c1 | 3300050512 | Bacteria | 1755 |
| 905 | nmdc:mga0n895_310990_c1 | 3300050512 | Bacteria | 1597 |
| 906 | nmdc:mga0n895_453175_c1 | 3300050512 | Bacteria | 1295 |
| 907 | nmdc:mga0n895_497188_c1 | 3300050512 | Bacteria | 1229 |
| 908 | nmdc:mga0n895_501953_c1 | 3300050512 | Bacteria | 1222 |
| 909 | nmdc:mga0n895_549369_c1 | 3300050512 | Bacteria | 1161 |
| 910 | nmdc:mga0n895_73171_c1 | 3300050512 | Bacteria | 3402 |
| 911 | nmdc:mga0rr50_283006_c1 | 3300050513 | Unclassified | 1384 |
| 912 | nmdc:mga0rr50_450458_c1 | 3300050513 | Unclassified | 1091 |
| 913 | nmdc:mga0rr50_451599_c1 | 3300050513 | Bacteria | 1090 |
| 914 | nmdc:mga0rr50_51843_c1 | 3300050513 | Bacteria | 3046 |
| 915 | nmdc:mga0rr50_9853_c1 | 3300050513 | Bacteria | 6036 |
| 916 | nmdc:mga08x19_198266_c1 | 3300050514 | Unclassified | 1375 |
| 917 | nmdc:mga08x19_268742_c1 | 3300050514 | Unclassified | 1180 |
| 918 | nmdc:mga0a205_12697_c1 | 3300050515 | Bacteria | 7805 |
| 919 | nmdc:mga0a205_182871_c1 | 3300050515 | Bacteria | 1990 |
| 920 | nmdc:mga0a205_28033_c1 | 3300050515 | Bacteria | 5381 |
| 921 | nmdc:mga0a205_323168_c1 | 3300050515 | Bacteria | 1414 |
| 922 | nmdc:mga0a205_39114_c1 | 3300050515 | Bacteria | 4564 |
| 923 | Ga0495612_0099432 | 3300053078 | Bacteria | 1238 |
| 924 | Ga0495619_0001420 | 3300053085 | Bacteria | 15740 |
| 925 | Ga0495619_0003302 | 3300053085 | Bacteria | 10425 |
| 926 | Ga0495619_0032510 | 3300053085 | Bacteria | 3386 |
| 927 | Ga0495619_0408536 | 3300053085 | Bacteria | 937 |
| 928 | Ga0501082_0003064 | 3300060353 | Bacteria | 14587 |
| 929 | Ga0501082_0004974 | 3300060353 | Bacteria | 11604 |
| 930 | Ga0501082_0339982 | 3300060353 | Bacteria | 1308 |
| 931 | Ga0530510_0000148 | 3300061734 | Bacteria | 41757 |
| 932 | Ga0530510_0000710 | 3300061734 | Bacteria | 21611 |
| 933 | Ga0530510_0165216 | 3300061734 | Bacteria | 1638 |
| 934 | Ga0530510_0178359 | 3300061734 | Bacteria | 1575 |
| 935 | Ga0530510_0303670 | 3300061734 | Bacteria | 1195 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100011397 | Ga0070713_10001139714 | 249 |
| 2 | 3300025938 | Ga0207704_10407472 | Ga0207704_104074722 | 250 |
| 3 | 3300035725 | Ga0373947_0120157 | Ga0373947_0120157_20_844 | 254 |
| 4 | 3300050512 | nmdc:mga0n895_73171_c1 | nmdc:mga0n895_73171_c1_2332_3183 | 262 |
| 5 | 3300050514 | nmdc:mga08x19_268742_c1 | nmdc:mga08x19_268742_c1_11_862 | 262 |
| 6 | 3300005471 | Ga0070698_100213371 | Ga0070698_1002133711 | 265 |
| 7 | 3300047322 | Ga0495680_0146941 | Ga0495680_0146941_54_875 | 265 |
| 8 | 3300038443 | Ga0395901_0010282 | Ga0395901_0010282_127_936 | 268 |
| 9 | 3300005435 | Ga0070714_100016862 | Ga0070714_1000168626 | 271 |
| 10 | 3300005439 | Ga0070711_100013035 | Ga0070711_1000130356 | 271 |
| 11 | 3300048928 | Ga0496125_0263707 | Ga0496125_0263707_104_925 | 271 |
| 12 | 3300050512 | nmdc:mga0n895_497188_c1 | nmdc:mga0n895_497188_c1_300_1121 | 271 |
| 13 | 3300053085 | Ga0495619_0408536 | Ga0495619_0408536_59_892 | 276 |
| 14 | 3300005440 | Ga0070705_100184966 | Ga0070705_1001849662 | 278 |
| 15 | 3300013306 | Ga0163162_10227999 | Ga0163162_102279993 | 278 |
| 16 | 3300048907 | Ga0496104_0421894 | Ga0496104_0421894_218_1120 | 278 |
| 17 | 3300048908 | Ga0496105_0367608 | Ga0496105_0367608_120_1022 | 278 |
| 18 | 3300050513 | nmdc:mga0rr50_283006_c1 | nmdc:mga0rr50_283006_c1_231_1133 | 278 |
| 19 | 3300050515 | nmdc:mga0a205_12697_c1 | nmdc:mga0a205_12697_c1_2456_3307 | 278 |
| 20 | 3300013297 | Ga0157378_10047475 | Ga0157378_100474753 | 279 |
| 21 | 3300048918 | Ga0496115_0099223 | Ga0496115_0099223_723_1628 | 279 |
| 22 | 3300050515 | nmdc:mga0a205_182871_c1 | nmdc:mga0a205_182871_c1_1052_1969 | 285 |
| 23 | 3300048904 | Ga0496101_0153956 | Ga0496101_0153956_94_960 | 286 |
| 24 | 3300048907 | Ga0496104_0007480 | Ga0496104_0007480_4147_5013 | 286 |
| 25 | 3300048911 | Ga0496108_0186850 | Ga0496108_0186850_861_1727 | 286 |
| 26 | 3300048915 | Ga0496112_0254599 | Ga0496112_0254599_26_892 | 286 |
| 27 | 3300048917 | Ga0496114_0205618 | Ga0496114_0205618_101_967 | 286 |
| 28 | 3300046477 | Ga0495664_0116488 | Ga0495664_0116488_24_953 | 288 |
| 29 | 3300034816 | Ga0373930_0026003 | Ga0373930_0026003_198_1139 | 289 |
| 30 | 3300046499 | Ga0495594_0086514 | Ga0495594_0086514_449_1387 | 289 |
| 31 | 3300005468 | Ga0070707_100224595 | Ga0070707_1002245952 | 290 |
| 32 | 3300006871 | Ga0075434_100120862 | Ga0075434_1001208622 | 290 |
| 33 | 3300048907 | Ga0496104_0012907 | Ga0496104_0012907_4309_5190 | 290 |
| 34 | 3300048909 | Ga0496106_0251702 | Ga0496106_0251702_395_1276 | 290 |
| 35 | 3300048912 | Ga0496109_0492716 | Ga0496109_0492716_242_1144 | 290 |
| 36 | 3300048916 | Ga0496113_0029631 | Ga0496113_0029631_1636_2517 | 290 |
| 37 | 3300050512 | nmdc:mga0n895_261734_c1 | nmdc:mga0n895_261734_c1_453_1451 | 290 |
| 38 | 3300048907 | Ga0496104_0000220 | Ga0496104_0000220_44033_44920 | 291 |
| 39 | 3300048907 | Ga0496104_0075970 | Ga0496104_0075970_340_1224 | 291 |
| 40 | 3300048908 | Ga0496105_0004150 | Ga0496105_0004150_7599_8486 | 291 |
| 41 | 3300048911 | Ga0496108_0031311 | Ga0496108_0031311_2778_3662 | 291 |
| 42 | 3300048912 | Ga0496109_0028866 | Ga0496109_0028866_1278_2162 | 291 |
| 43 | 3300048913 | Ga0496110_0032469 | Ga0496110_0032469_2738_3622 | 291 |
| 44 | 3300048913 | Ga0496110_0298015 | Ga0496110_0298015_408_1295 | 291 |
| 45 | 3300048914 | Ga0496111_0033542 | Ga0496111_0033542_1294_2178 | 291 |
| 46 | 3300048915 | Ga0496112_0166453 | Ga0496112_0166453_778_1662 | 291 |
| 47 | 3300009147 | Ga0114129_10554625 | Ga0114129_105546252 | 293 |
| 48 | 3300035120 | Ga0373957_0093902 | Ga0373957_0093902_291_1178 | 293 |
| 49 | 3300037068 | Ga0373925_0343858 | Ga0373925_0343858_65_952 | 293 |
| 50 | 3300005937 | Ga0081455_10004659 | Ga0081455_100046597 | 297 |
| 51 | 3300009147 | Ga0114129_10421106 | Ga0114129_104211062 | 297 |
| 52 | 3300048917 | Ga0496114_0506075 | Ga0496114_0506075_105_1007 | 297 |
| 53 | 3300049592 | Ga0501076_0538091 | Ga0501076_0538091_17_919 | 297 |
| 54 | 3300050507 | nmdc:mga05p37_367185_c1 | nmdc:mga05p37_367185_c1_469_1371 | 297 |
| 55 | 3300037068 | Ga0373925_0454077 | Ga0373925_0454077_19_990 | 300 |
| 56 | 3300046459 | Ga0495629_0080953 | Ga0495629_0080953_1166_2137 | 300 |
| 57 | 3300046473 | Ga0495582_0063386 | Ga0495582_0063386_581_1552 | 300 |
| 58 | 3300046475 | Ga0495639_0073595 | Ga0495639_0073595_319_1290 | 300 |
| 59 | 3300046499 | Ga0495594_0222700 | Ga0495594_0222700_17_988 | 300 |
| 60 | 3300046517 | Ga0495630_0249703 | Ga0495630_0249703_264_1235 | 300 |
| 61 | 3300047315 | Ga0495581_0018347 | Ga0495581_0018347_2565_3536 | 300 |
| 62 | 3300047321 | Ga0495676_0221283 | Ga0495676_0221283_93_1064 | 300 |
| 63 | 3300046557 | Ga0495622_0051816 | Ga0495622_0051816_237_1154 | 301 |
| 64 | 3300046681 | Ga0495647_0105087 | Ga0495647_0105087_69_1040 | 301 |
| 65 | 3300005983 | Ga0081540_1054177 | Ga0081540_10541773 | 302 |
| 66 | 3300046459 | Ga0495629_0024398 | Ga0495629_0024398_1922_2896 | 302 |
| 67 | 3300046473 | Ga0495582_0018429 | Ga0495582_0018429_1066_2040 | 302 |
| 68 | 3300046499 | Ga0495594_0049195 | Ga0495594_0049195_1266_2240 | 302 |
| 69 | 3300046683 | Ga0495658_0019548 | Ga0495658_0019548_1275_2249 | 302 |
| 70 | 3300046684 | Ga0495669_0104033 | Ga0495669_0104033_37_954 | 302 |
| 71 | 3300047322 | Ga0495680_0133694 | Ga0495680_0133694_774_1748 | 302 |
| 72 | 3300047673 | Ga0495593_0041300 | Ga0495593_0041300_363_1337 | 302 |
| 73 | 3300053085 | Ga0495619_0001420 | Ga0495619_0001420_13356_14330 | 302 |
| 74 | 3300005355 | Ga0070671_100229808 | Ga0070671_1002298081 | 303 |
| 75 | 3300005937 | Ga0081455_10031809 | Ga0081455_100318094 | 303 |
| 76 | 3300009148 | Ga0105243_10256081 | Ga0105243_102560812 | 303 |
| 77 | 3300009174 | Ga0105241_10076670 | Ga0105241_100766702 | 303 |
| 78 | 3300009177 | Ga0105248_10115847 | Ga0105248_101158472 | 303 |
| 79 | 3300010375 | Ga0105239_10076919 | Ga0105239_100769191 | 303 |
| 80 | 3300025911 | Ga0207654_10041118 | Ga0207654_100411182 | 303 |
| 81 | 3300035691 | Ga0373931_0002703 | Ga0373931_0002703_2943_3929 | 303 |
| 82 | 3300035695 | Ga0373927_0037073 | Ga0373927_0037073_316_1302 | 303 |
| 83 | 3300048904 | Ga0496101_0117328 | Ga0496101_0117328_338_1324 | 303 |
| 84 | 3300048905 | Ga0496102_0109817 | Ga0496102_0109817_76_1062 | 303 |
| 85 | 3300048906 | Ga0496103_0017950 | Ga0496103_0017950_1453_2439 | 303 |
| 86 | 3300048907 | Ga0496104_0053745 | Ga0496104_0053745_245_1231 | 303 |
| 87 | 3300048908 | Ga0496105_0020393 | Ga0496105_0020393_432_1418 | 303 |
| 88 | 3300048910 | Ga0496107_0012044 | Ga0496107_0012044_1866_2852 | 303 |
| 89 | 3300048912 | Ga0496109_0040542 | Ga0496109_0040542_2995_3981 | 303 |
| 90 | 3300048913 | Ga0496110_0065499 | Ga0496110_0065499_1998_2984 | 303 |
| 91 | 3300048914 | Ga0496111_0134173 | Ga0496111_0134173_223_1209 | 303 |
| 92 | 3300048915 | Ga0496112_0030287 | Ga0496112_0030287_340_1326 | 303 |
| 93 | 3300048917 | Ga0496114_0033103 | Ga0496114_0033103_304_1290 | 303 |
| 94 | 3300003659 | JGI25404J52841_10017054 | JGI25404J52841_100170542 | 304 |
| 95 | 3300005439 | Ga0070711_100007637 | Ga0070711_1000076372 | 304 |
| 96 | 3300005983 | Ga0081540_1003548 | Ga0081540_10035485 | 304 |
| 97 | 3300006846 | Ga0075430_100111729 | Ga0075430_1001117294 | 304 |
| 98 | 3300006847 | Ga0075431_100524725 | Ga0075431_1005247251 | 304 |
| 99 | 3300006871 | Ga0075434_100436069 | Ga0075434_1004360692 | 304 |
| 100 | 3300009094 | Ga0111539_10157413 | Ga0111539_101574132 | 304 |
| 101 | 3300009147 | Ga0114129_10152242 | Ga0114129_101522422 | 304 |
| 102 | 3300009147 | Ga0114129_10231747 | Ga0114129_102317473 | 304 |
| 103 | 3300025916 | Ga0207663_10005731 | Ga0207663_1000573111 | 304 |
| 104 | 3300025928 | Ga0207700_10007138 | Ga0207700_1000713812 | 304 |
| 105 | 3300027907 | Ga0207428_10072712 | Ga0207428_100727121 | 304 |
| 106 | 3300050508 | nmdc:mga09592_250671_c1 | nmdc:mga09592_250671_c1_216_1190 | 304 |
| 107 | 3300050509 | nmdc:mga0qj67_354073_c1 | nmdc:mga0qj67_354073_c1_40_1014 | 304 |
| 108 | 3300050510 | nmdc:mga06r32_276146_c1 | nmdc:mga06r32_276146_c1_110_1084 | 304 |
| 109 | 3300050511 | nmdc:mga08y16_341406_c1 | nmdc:mga08y16_341406_c1_157_1128 | 304 |
| 110 | 3300050511 | nmdc:mga08y16_561165_c1 | nmdc:mga08y16_561165_c1_115_1089 | 304 |
| 111 | 3300050512 | nmdc:mga0n895_116446_c1 | nmdc:mga0n895_116446_c1_1636_2610 | 304 |
| 112 | 3300050513 | nmdc:mga0rr50_450458_c1 | nmdc:mga0rr50_450458_c1_24_998 | 304 |
| 113 | 3300003659 | JGI25404J52841_10003373 | JGI25404J52841_100033731 | 305 |
| 114 | 3300003659 | JGI25404J52841_10017720 | JGI25404J52841_100177202 | 305 |
| 115 | 3300005983 | Ga0081540_1003853 | Ga0081540_100385316 | 305 |
| 116 | 3300007076 | Ga0075435_100249895 | Ga0075435_1002498952 | 305 |
| 117 | 3300048915 | Ga0496112_0165021 | Ga0496112_0165021_371_1351 | 305 |
| 118 | 3300005366 | Ga0070659_100296099 | Ga0070659_1002960991 | 306 |
| 119 | 3300005455 | Ga0070663_100427927 | Ga0070663_1004279271 | 306 |
| 120 | 3300005458 | Ga0070681_10027500 | Ga0070681_100275006 | 306 |
| 121 | 3300005545 | Ga0070695_100029507 | Ga0070695_1000295071 | 306 |
| 122 | 3300005546 | Ga0070696_100012282 | Ga0070696_1000122825 | 306 |
| 123 | 3300026067 | Ga0207678_10049297 | Ga0207678_100492972 | 306 |
| 124 | 3300026067 | Ga0207678_10378623 | Ga0207678_103786231 | 306 |
| 125 | 3300026121 | Ga0207683_10118671 | Ga0207683_101186712 | 306 |
| 126 | 3300035692 | Ga0373935_0087091 | Ga0373935_0087091_47_1027 | 306 |
| 127 | 3300036401 | Ga0373937_0064505 | Ga0373937_0064505_2043_3026 | 306 |
| 128 | 3300047321 | Ga0495676_0082840 | Ga0495676_0082840_36_1028 | 306 |
| 129 | 3300048903 | Ga0496100_0103865 | Ga0496100_0103865_421_1413 | 306 |
| 130 | 3300048905 | Ga0496102_0620121 | Ga0496102_0620121_46_975 | 306 |
| 131 | 3300048913 | Ga0496110_0131805 | Ga0496110_0131805_1212_2204 | 306 |
| 132 | 3300035083 | Ga0373926_0082663 | Ga0373926_0082663_30_998 | 307 |
| 133 | 3300035116 | Ga0373945_0004304 | Ga0373945_0004304_542_1510 | 307 |
| 134 | 3300035691 | Ga0373931_0151310 | Ga0373931_0151310_22_1002 | 307 |
| 135 | 3300046531 | Ga0495665_0072971 | Ga0495665_0072971_102_1070 | 307 |
| 136 | 3300046642 | Ga0495634_0051946 | Ga0495634_0051946_827_1795 | 307 |
| 137 | 3300047315 | Ga0495581_0032014 | Ga0495581_0032014_75_1043 | 307 |
| 138 | 3300047321 | Ga0495676_0143638 | Ga0495676_0143638_117_1085 | 307 |
| 139 | 3300006844 | Ga0075428_100325473 | Ga0075428_1003254732 | 308 |
| 140 | 3300006847 | Ga0075431_100448232 | Ga0075431_1004482321 | 308 |
| 141 | 3300006880 | Ga0075429_100270096 | Ga0075429_1002700961 | 308 |
| 142 | 3300050507 | nmdc:mga05p37_140194_c1 | nmdc:mga05p37_140194_c1_150_1133 | 308 |
| 143 | 3300050508 | nmdc:mga09592_265770_c1 | nmdc:mga09592_265770_c1_227_1210 | 308 |
| 144 | 3300050510 | nmdc:mga06r32_453457_c1 | nmdc:mga06r32_453457_c1_185_1168 | 308 |
| 145 | 3300005330 | Ga0070690_100006214 | Ga0070690_1000062146 | 309 |
| 146 | 3300005334 | Ga0068869_100036009 | Ga0068869_1000360091 | 309 |
| 147 | 3300005335 | Ga0070666_10020373 | Ga0070666_100203732 | 309 |
| 148 | 3300005347 | Ga0070668_100013101 | Ga0070668_1000131012 | 309 |
| 149 | 3300005353 | Ga0070669_100006176 | Ga0070669_10000617610 | 309 |
| 150 | 3300005354 | Ga0070675_100018746 | Ga0070675_1000187465 | 309 |
| 151 | 3300005356 | Ga0070674_100002846 | Ga0070674_1000028468 | 309 |
| 152 | 3300005367 | Ga0070667_100020939 | Ga0070667_1000209394 | 309 |
| 153 | 3300005441 | Ga0070700_100012162 | Ga0070700_1000121622 | 309 |
| 154 | 3300005457 | Ga0070662_100002108 | Ga0070662_10000210813 | 309 |
| 155 | 3300005459 | Ga0068867_100015137 | Ga0068867_1000151375 | 309 |
| 156 | 3300005543 | Ga0070672_100001451 | Ga0070672_1000014516 | 309 |
| 157 | 3300005564 | Ga0070664_100373112 | Ga0070664_1003731122 | 309 |
| 158 | 3300005616 | Ga0068852_100147641 | Ga0068852_1001476412 | 309 |
| 159 | 3300005617 | Ga0068859_100096647 | Ga0068859_1000966472 | 309 |
| 160 | 3300005618 | Ga0068864_100073169 | Ga0068864_1000731695 | 309 |
| 161 | 3300005841 | Ga0068863_100014129 | Ga0068863_1000141297 | 309 |
| 162 | 3300005843 | Ga0068860_100001009 | Ga0068860_1000010098 | 309 |
| 163 | 3300006881 | Ga0068865_100004690 | Ga0068865_1000046904 | 309 |
| 164 | 3300006931 | Ga0097620_100096642 | Ga0097620_1000966422 | 309 |
| 165 | 3300009098 | Ga0105245_10327039 | Ga0105245_103270392 | 309 |
| 166 | 3300009148 | Ga0105243_10013128 | Ga0105243_100131286 | 309 |
| 167 | 3300009177 | Ga0105248_10082316 | Ga0105248_100823162 | 309 |
| 168 | 3300009553 | Ga0105249_10071868 | Ga0105249_100718683 | 309 |
| 169 | 3300017792 | Ga0163161_10019836 | Ga0163161_100198364 | 309 |
| 170 | 3300025903 | Ga0207680_10002264 | Ga0207680_100022648 | 309 |
| 171 | 3300025923 | Ga0207681_10000795 | Ga0207681_1000079520 | 309 |
| 172 | 3300025927 | Ga0207687_10113835 | Ga0207687_101138352 | 309 |
| 173 | 3300025933 | Ga0207706_10032604 | Ga0207706_100326046 | 309 |
| 174 | 3300025935 | Ga0207709_10005754 | Ga0207709_100057546 | 309 |
| 175 | 3300025938 | Ga0207704_10010907 | Ga0207704_100109074 | 309 |
| 176 | 3300025940 | Ga0207691_10013364 | Ga0207691_100133648 | 309 |
| 177 | 3300025942 | Ga0207689_10003512 | Ga0207689_100035128 | 309 |
| 178 | 3300025961 | Ga0207712_10016858 | Ga0207712_100168583 | 309 |
| 179 | 3300025986 | Ga0207658_10012149 | Ga0207658_100121497 | 309 |
| 180 | 3300026035 | Ga0207703_10001999 | Ga0207703_1000199914 | 309 |
| 181 | 3300026075 | Ga0207708_10019266 | Ga0207708_100192668 | 309 |
| 182 | 3300026088 | Ga0207641_10045615 | Ga0207641_100456156 | 309 |
| 183 | 3300026089 | Ga0207648_10009156 | Ga0207648_100091568 | 309 |
| 184 | 3300026095 | Ga0207676_10017788 | Ga0207676_100177887 | 309 |
| 185 | 3300026118 | Ga0207675_100003386 | Ga0207675_10000338616 | 309 |
| 186 | 3300026142 | Ga0207698_10128016 | Ga0207698_101280163 | 309 |
| 187 | 3300028381 | Ga0268264_10015732 | Ga0268264_100157328 | 309 |
| 188 | 3300048910 | Ga0496107_0266313 | Ga0496107_0266313_29_967 | 309 |
| 189 | 3300050512 | nmdc:mga0n895_132992_c1 | nmdc:mga0n895_132992_c1_1208_2146 | 309 |
| 190 | 3300050512 | nmdc:mga0n895_453175_c1 | nmdc:mga0n895_453175_c1_347_1285 | 309 |
| 191 | 3300005356 | Ga0070674_100096653 | Ga0070674_1000966532 | 311 |
| 192 | 3300009545 | Ga0105237_10429360 | Ga0105237_104293601 | 311 |
| 193 | 3300025937 | Ga0207669_10340792 | Ga0207669_103407921 | 311 |
| 194 | 3300006880 | Ga0075429_100070410 | Ga0075429_1000704103 | 312 |
| 195 | 3300013308 | Ga0157375_10009517 | Ga0157375_100095174 | 312 |
| 196 | 3300013308 | Ga0157375_10065154 | Ga0157375_100651542 | 312 |
| 197 | 3300014969 | Ga0157376_10012977 | Ga0157376_100129774 | 312 |
| 198 | 3300005335 | Ga0070666_10016162 | Ga0070666_100161623 | 313 |
| 199 | 3300005355 | Ga0070671_100053598 | Ga0070671_1000535982 | 313 |
| 200 | 3300005355 | Ga0070671_100387240 | Ga0070671_1003872401 | 313 |
| 201 | 3300005564 | Ga0070664_100317465 | Ga0070664_1003174652 | 313 |
| 202 | 3300006358 | Ga0068871_100065463 | Ga0068871_1000654632 | 313 |
| 203 | 3300009177 | Ga0105248_10323969 | Ga0105248_103239691 | 313 |
| 204 | 3300025903 | Ga0207680_10080686 | Ga0207680_100806862 | 313 |
| 205 | 3300025931 | Ga0207644_10371429 | Ga0207644_103714291 | 313 |
| 206 | 3300025941 | Ga0207711_10381047 | Ga0207711_103810472 | 313 |
| 207 | 3300035083 | Ga0373926_0083062 | Ga0373926_0083062_147_1097 | 313 |
| 208 | 3300044673 | Ga0453683_0138771 | Ga0453683_0138771_574_1515 | 313 |
| 209 | 3300048912 | Ga0496109_0535515 | Ga0496109_0535515_94_1077 | 313 |
| 210 | 3300049574 | Ga0501038_0001763 | Ga0501038_0001763_4376_5434 | 313 |
| 211 | 3300049584 | Ga0501068_0005846 | Ga0501068_0005846_864_1922 | 313 |
| 212 | 3300049593 | Ga0501077_0000059 | Ga0501077_0000059_17010_18068 | 313 |
| 213 | 3300049741 | Ga0501079_0001697 | Ga0501079_0001697_13368_14426 | 313 |
| 214 | 3300049824 | Ga0501045_0006400 | Ga0501045_0006400_210_1268 | 313 |
| 215 | 3300050493 | nmdc:mga0k408_18287_c1 | nmdc:mga0k408_18287_c1_558_1508 | 313 |
| 216 | 3300050496 | nmdc:mga07m45_141959_c1 | nmdc:mga07m45_141959_c1_216_1166 | 313 |
| 217 | 3300005983 | Ga0081540_1070249 | Ga0081540_10702492 | 314 |
| 218 | 3300035116 | Ga0373945_0118288 | Ga0373945_0118288_11_1006 | 314 |
| 219 | 3300035170 | Ga0373943_0139124 | Ga0373943_0139124_243_1238 | 314 |
| 220 | 3300035171 | Ga0373946_0015782 | Ga0373946_0015782_285_1403 | 314 |
| 221 | 3300035695 | Ga0373927_0033954 | Ga0373927_0033954_1249_2367 | 314 |
| 222 | 3300035725 | Ga0373947_0002200 | Ga0373947_0002200_8207_9325 | 314 |
| 223 | 3300037068 | Ga0373925_0105396 | Ga0373925_0105396_1039_2034 | 314 |
| 224 | 3300046455 | Ga0495603_0031574 | Ga0495603_0031574_341_1336 | 314 |
| 225 | 3300046472 | Ga0495580_0037749 | Ga0495580_0037749_1442_2425 | 314 |
| 226 | 3300046472 | Ga0495580_0106766 | Ga0495580_0106766_97_1215 | 314 |
| 227 | 3300046499 | Ga0495594_0027843 | Ga0495594_0027843_1378_2496 | 314 |
| 228 | 3300046557 | Ga0495622_0047519 | Ga0495622_0047519_530_1513 | 314 |
| 229 | 3300046674 | Ga0495588_0007162 | Ga0495588_0007162_2446_3429 | 314 |
| 230 | 3300046674 | Ga0495588_0014118 | Ga0495588_0014118_202_1329 | 314 |
| 231 | 3300046681 | Ga0495647_0007938 | Ga0495647_0007938_871_1989 | 314 |
| 232 | 3300046683 | Ga0495658_0006358 | Ga0495658_0006358_3063_4181 | 314 |
| 233 | 3300046690 | Ga0495624_0036884 | Ga0495624_0036884_366_1361 | 314 |
| 234 | 3300047321 | Ga0495676_0022963 | Ga0495676_0022963_1199_2317 | 314 |
| 235 | 3300049572 | Ga0501036_0061575 | Ga0501036_0061575_1095_2051 | 314 |
| 236 | 3300049576 | Ga0501040_0022067 | Ga0501040_0022067_1157_2113 | 314 |
| 237 | 3300049582 | Ga0501048_0060186 | Ga0501048_0060186_255_1211 | 314 |
| 238 | 3300049582 | Ga0501048_0285421 | Ga0501048_0285421_77_1024 | 314 |
| 239 | 3300049587 | Ga0501071_0050022 | Ga0501071_0050022_113_1069 | 314 |
| 240 | 3300049588 | Ga0501072_0084127 | Ga0501072_0084127_1005_1961 | 314 |
| 241 | 3300049592 | Ga0501076_0000166 | Ga0501076_0000166_29116_30072 | 314 |
| 242 | 3300049742 | Ga0501080_0022167 | Ga0501080_0022167_4460_5416 | 314 |
| 243 | 3300060353 | Ga0501082_0004974 | Ga0501082_0004974_2150_3106 | 314 |
| 244 | 3300006038 | Ga0075365_10024840 | Ga0075365_100248403 | 315 |
| 245 | 3300006844 | Ga0075428_100022678 | Ga0075428_1000226787 | 315 |
| 246 | 3300006847 | Ga0075431_100008762 | Ga0075431_1000087622 | 315 |
| 247 | 3300006852 | Ga0075433_10091603 | Ga0075433_100916032 | 315 |
| 248 | 3300009147 | Ga0114129_10001447 | Ga0114129_1000144717 | 315 |
| 249 | 3300046459 | Ga0495629_0012730 | Ga0495629_0012730_3181_4158 | 315 |
| 250 | 3300046472 | Ga0495580_0000120 | Ga0495580_0000120_27615_28583 | 315 |
| 251 | 3300046499 | Ga0495594_0204337 | Ga0495594_0204337_37_1014 | 315 |
| 252 | 3300046683 | Ga0495658_0003032 | Ga0495658_0003032_5892_6869 | 315 |
| 253 | 3300046689 | Ga0495613_0053585 | Ga0495613_0053585_1548_2525 | 315 |
| 254 | 3300050507 | nmdc:mga05p37_6539_c1 | nmdc:mga05p37_6539_c1_2744_3781 | 315 |
| 255 | 3300050510 | nmdc:mga06r32_59509_c1 | nmdc:mga06r32_59509_c1_1709_2746 | 315 |
| 256 | 3300053085 | Ga0495619_0003302 | Ga0495619_0003302_201_1178 | 315 |
| 257 | 3300053085 | Ga0495619_0032510 | Ga0495619_0032510_1780_2748 | 315 |
| 258 | 3300005331 | Ga0070670_100275182 | Ga0070670_1002751821 | 316 |
| 259 | 3300005339 | Ga0070660_100286470 | Ga0070660_1002864701 | 316 |
| 260 | 3300005340 | Ga0070689_100356806 | Ga0070689_1003568061 | 316 |
| 261 | 3300005355 | Ga0070671_100041930 | Ga0070671_1000419305 | 316 |
| 262 | 3300005365 | Ga0070688_100052743 | Ga0070688_1000527432 | 316 |
| 263 | 3300005434 | Ga0070709_10196975 | Ga0070709_101969751 | 316 |
| 264 | 3300005436 | Ga0070713_100004094 | Ga0070713_1000040949 | 316 |
| 265 | 3300005437 | Ga0070710_10001693 | Ga0070710_100016936 | 316 |
| 266 | 3300005455 | Ga0070663_100082475 | Ga0070663_1000824754 | 316 |
| 267 | 3300005456 | Ga0070678_100242476 | Ga0070678_1002424761 | 316 |
| 268 | 3300005466 | Ga0070685_10009690 | Ga0070685_100096904 | 316 |
| 269 | 3300005467 | Ga0070706_100254501 | Ga0070706_1002545012 | 316 |
| 270 | 3300005564 | Ga0070664_100076250 | Ga0070664_1000762502 | 316 |
| 271 | 3300005842 | Ga0068858_100039890 | Ga0068858_1000398904 | 316 |
| 272 | 3300006028 | Ga0070717_10003805 | Ga0070717_100038053 | 316 |
| 273 | 3300006163 | Ga0070715_10080197 | Ga0070715_100801972 | 316 |
| 274 | 3300006173 | Ga0070716_100002987 | Ga0070716_1000029876 | 316 |
| 275 | 3300006175 | Ga0070712_100006218 | Ga0070712_1000062184 | 316 |
| 276 | 3300006237 | Ga0097621_100005573 | Ga0097621_1000055732 | 316 |
| 277 | 3300006881 | Ga0068865_100028550 | Ga0068865_1000285506 | 316 |
| 278 | 3300009011 | Ga0105251_10073605 | Ga0105251_100736052 | 316 |
| 279 | 3300009176 | Ga0105242_10028455 | Ga0105242_100284554 | 316 |
| 280 | 3300009551 | Ga0105238_10047788 | Ga0105238_100477882 | 316 |
| 281 | 3300009553 | Ga0105249_10315788 | Ga0105249_103157881 | 316 |
| 282 | 3300011119 | Ga0105246_10208577 | Ga0105246_102085772 | 316 |
| 283 | 3300017792 | Ga0163161_10014661 | Ga0163161_100146611 | 316 |
| 284 | 3300025735 | Ga0207713_1060646 | Ga0207713_10606461 | 316 |
| 285 | 3300025905 | Ga0207685_10012056 | Ga0207685_100120561 | 316 |
| 286 | 3300025906 | Ga0207699_10003107 | Ga0207699_100031078 | 316 |
| 287 | 3300025915 | Ga0207693_10005527 | Ga0207693_100055274 | 316 |
| 288 | 3300025928 | Ga0207700_10004740 | Ga0207700_100047405 | 316 |
| 289 | 3300025929 | Ga0207664_10054849 | Ga0207664_100548491 | 316 |
| 290 | 3300025931 | Ga0207644_10004844 | Ga0207644_100048448 | 316 |
| 291 | 3300025936 | Ga0207670_10163130 | Ga0207670_101631302 | 316 |
| 292 | 3300025937 | Ga0207669_10007648 | Ga0207669_100076484 | 316 |
| 293 | 3300025939 | Ga0207665_10009026 | Ga0207665_100090265 | 316 |
| 294 | 3300026035 | Ga0207703_10054709 | Ga0207703_100547093 | 316 |
| 295 | 3300026067 | Ga0207678_10157876 | Ga0207678_101578762 | 316 |
| 296 | 3300026121 | Ga0207683_10247313 | Ga0207683_102473131 | 316 |
| 297 | 3300028379 | Ga0268266_10143361 | Ga0268266_101433612 | 316 |
| 298 | 3300046492 | Ga0495585_0160009 | Ga0495585_0160009_113_1093 | 316 |
| 299 | 3300048903 | Ga0496100_0009979 | Ga0496100_0009979_2659_3621 | 316 |
| 300 | 3300048904 | Ga0496101_0039623 | Ga0496101_0039623_324_1286 | 316 |
| 301 | 3300048905 | Ga0496102_0021943 | Ga0496102_0021943_317_1279 | 316 |
| 302 | 3300048905 | Ga0496102_0071149 | Ga0496102_0071149_1405_2367 | 316 |
| 303 | 3300048907 | Ga0496104_0008349 | Ga0496104_0008349_444_1406 | 316 |
| 304 | 3300048908 | Ga0496105_0121836 | Ga0496105_0121836_375_1337 | 316 |
| 305 | 3300048909 | Ga0496106_0108375 | Ga0496106_0108375_887_1849 | 316 |
| 306 | 3300048910 | Ga0496107_0015801 | Ga0496107_0015801_882_1844 | 316 |
| 307 | 3300048911 | Ga0496108_0045049 | Ga0496108_0045049_834_1796 | 316 |
| 308 | 3300048913 | Ga0496110_0170830 | Ga0496110_0170830_437_1399 | 316 |
| 309 | 3300048914 | Ga0496111_0007249 | Ga0496111_0007249_150_1112 | 316 |
| 310 | 3300048916 | Ga0496113_0043101 | Ga0496113_0043101_1534_2496 | 316 |
| 311 | 3300048916 | Ga0496113_0050085 | Ga0496113_0050085_846_1808 | 316 |
| 312 | 3300048916 | Ga0496113_0149378 | Ga0496113_0149378_461_1423 | 316 |
| 313 | 3300048917 | Ga0496114_0027018 | Ga0496114_0027018_2218_3180 | 316 |
| 314 | 3300048918 | Ga0496115_0053058 | Ga0496115_0053058_1405_2367 | 316 |
| 315 | 3300005328 | Ga0070676_10001849 | Ga0070676_100018498 | 317 |
| 316 | 3300005353 | Ga0070669_100084415 | Ga0070669_1000844152 | 317 |
| 317 | 3300005355 | Ga0070671_100270092 | Ga0070671_1002700922 | 317 |
| 318 | 3300005441 | Ga0070700_100045779 | Ga0070700_1000457792 | 317 |
| 319 | 3300005618 | Ga0068864_100220111 | Ga0068864_1002201112 | 317 |
| 320 | 3300005844 | Ga0068862_100073986 | Ga0068862_1000739862 | 317 |
| 321 | 3300006881 | Ga0068865_100032531 | Ga0068865_1000325312 | 317 |
| 322 | 3300014326 | Ga0157380_10004793 | Ga0157380_100047935 | 317 |
| 323 | 3300014968 | Ga0157379_10008707 | Ga0157379_100087078 | 317 |
| 324 | 3300025931 | Ga0207644_10234458 | Ga0207644_102344581 | 317 |
| 325 | 3300026067 | Ga0207678_10111875 | Ga0207678_101118752 | 317 |
| 326 | 3300026075 | Ga0207708_10028708 | Ga0207708_100287083 | 317 |
| 327 | 3300026121 | Ga0207683_10047450 | Ga0207683_100474502 | 317 |
| 328 | 3300028380 | Ga0268265_10009944 | Ga0268265_100099444 | 317 |
| 329 | 3300045051 | Ga0451576_0037628 | Ga0451576_0037628_540_1508 | 317 |
| 330 | 3300048915 | Ga0496112_0462512 | Ga0496112_0462512_95_1057 | 317 |
| 331 | 3300053078 | Ga0495612_0099432 | Ga0495612_0099432_170_1138 | 318 |
| 332 | 3300025933 | Ga0207706_10097040 | Ga0207706_100970401 | 319 |
| 333 | 3300042439 | Ga0439464_0014471 | Ga0439464_0014471_477_1451 | 319 |
| 334 | 3300042461 | Ga0439460_0002108 | Ga0439460_0002108_1184_2158 | 319 |
| 335 | 3300046681 | Ga0495647_0057195 | Ga0495647_0057195_142_1149 | 319 |
| 336 | 3300048915 | Ga0496112_0190692 | Ga0496112_0190692_884_1855 | 319 |
| 337 | 3300049587 | Ga0501071_0172749 | Ga0501071_0172749_100_1074 | 319 |
| 338 | 3300049588 | Ga0501072_0386669 | Ga0501072_0386669_112_1086 | 319 |
| 339 | 3300049592 | Ga0501076_0240845 | Ga0501076_0240845_476_1450 | 319 |
| 340 | 3300061734 | Ga0530510_0165216 | Ga0530510_0165216_552_1526 | 319 |
| 341 | 3300005353 | Ga0070669_100191631 | Ga0070669_1001916311 | 320 |
| 342 | 3300005536 | Ga0070697_100258271 | Ga0070697_1002582712 | 320 |
| 343 | 3300005577 | Ga0068857_100459166 | Ga0068857_1004591662 | 320 |
| 344 | 3300005843 | Ga0068860_100002602 | Ga0068860_1000026022 | 320 |
| 345 | 3300005985 | Ga0081539_10000035 | Ga0081539_10000035179 | 320 |
| 346 | 3300025923 | Ga0207681_10191708 | Ga0207681_101917082 | 320 |
| 347 | 3300046516 | Ga0495628_0018365 | Ga0495628_0018365_2890_3864 | 320 |
| 348 | 3300049570 | Ga0501033_0231081 | Ga0501033_0231081_342_1304 | 320 |
| 349 | 3300049572 | Ga0501036_0039309 | Ga0501036_0039309_1611_2573 | 320 |
| 350 | 3300049580 | Ga0501046_0274874 | Ga0501046_0274874_220_1182 | 320 |
| 351 | 3300049591 | Ga0501075_0408781 | Ga0501075_0408781_14_982 | 320 |
| 352 | 3300049743 | Ga0501081_0016967 | Ga0501081_0016967_1830_2792 | 320 |
| 353 | 3300049824 | Ga0501045_0026363 | Ga0501045_0026363_682_1644 | 320 |
| 354 | iso_pu_bacteria | 2513237161 | 2514016786 | 320 |
| 355 | 3300005347 | Ga0070668_100376507 | Ga0070668_1003765071 | 321 |
| 356 | 3300005545 | Ga0070695_100011209 | Ga0070695_1000112092 | 321 |
| 357 | 3300005614 | Ga0068856_100000505 | Ga0068856_10000050513 | 321 |
| 358 | 3300006871 | Ga0075434_100124425 | Ga0075434_1001244253 | 321 |
| 359 | 3300007076 | Ga0075435_100003406 | Ga0075435_10000340612 | 321 |
| 360 | 3300009093 | Ga0105240_10172585 | Ga0105240_101725853 | 321 |
| 361 | 3300013105 | Ga0157369_10052802 | Ga0157369_100528021 | 321 |
| 362 | 3300017792 | Ga0163161_10118149 | Ga0163161_101181492 | 321 |
| 363 | 3300025913 | Ga0207695_10075767 | Ga0207695_100757673 | 321 |
| 364 | 3300025949 | Ga0207667_10260023 | Ga0207667_102600233 | 321 |
| 365 | 3300026078 | Ga0207702_10000127 | Ga0207702_1000012765 | 321 |
| 366 | 3300037466 | Ga0395898_0542424 | Ga0395898_0542424_66_1040 | 321 |
| 367 | 3300038443 | Ga0395901_0482758 | Ga0395901_0482758_94_1068 | 321 |
| 368 | 3300050512 | nmdc:mga0n895_26132_c1 | nmdc:mga0n895_26132_c1_3824_4804 | 321 |
| 369 | 3300050513 | nmdc:mga0rr50_9853_c1 | nmdc:mga0rr50_9853_c1_4852_5832 | 321 |
| 370 | 3300050514 | nmdc:mga08x19_198266_c1 | nmdc:mga08x19_198266_c1_179_1159 | 321 |
| 371 | 3300061734 | Ga0530510_0000148 | Ga0530510_0000148_6081_7055 | 321 |
| 372 | 3300003659 | JGI25404J52841_10002030 | JGI25404J52841_100020303 | 322 |
| 373 | 3300003659 | JGI25404J52841_10006341 | JGI25404J52841_100063412 | 322 |
| 374 | 3300003659 | JGI25404J52841_10013652 | JGI25404J52841_100136522 | 322 |
| 375 | 3300005329 | Ga0070683_100089278 | Ga0070683_1000892782 | 322 |
| 376 | 3300005330 | Ga0070690_100339058 | Ga0070690_1003390581 | 322 |
| 377 | 3300005334 | Ga0068869_100287551 | Ga0068869_1002875511 | 322 |
| 378 | 3300005337 | Ga0070682_100073320 | Ga0070682_1000733202 | 322 |
| 379 | 3300005338 | Ga0068868_100057759 | Ga0068868_1000577594 | 322 |
| 380 | 3300005366 | Ga0070659_100327627 | Ga0070659_1003276271 | 322 |
| 381 | 3300005444 | Ga0070694_100236085 | Ga0070694_1002360851 | 322 |
| 382 | 3300005456 | Ga0070678_100035261 | Ga0070678_1000352612 | 322 |
| 383 | 3300005458 | Ga0070681_10158380 | Ga0070681_101583802 | 322 |
| 384 | 3300005530 | Ga0070679_100063022 | Ga0070679_1000630221 | 322 |
| 385 | 3300005548 | Ga0070665_100078992 | Ga0070665_1000789924 | 322 |
| 386 | 3300005616 | Ga0068852_100050060 | Ga0068852_1000500603 | 322 |
| 387 | 3300005842 | Ga0068858_100093624 | Ga0068858_1000936243 | 322 |
| 388 | 3300005842 | Ga0068858_100361793 | Ga0068858_1003617932 | 322 |
| 389 | 3300005937 | Ga0081455_10082032 | Ga0081455_100820321 | 322 |
| 390 | 3300005983 | Ga0081540_1003871 | Ga0081540_10038715 | 322 |
| 391 | 3300005983 | Ga0081540_1005308 | Ga0081540_10053087 | 322 |
| 392 | 3300005983 | Ga0081540_1005508 | Ga0081540_10055088 | 322 |
| 393 | 3300006178 | Ga0075367_10232223 | Ga0075367_102322231 | 322 |
| 394 | 3300006195 | Ga0075366_10021791 | Ga0075366_100217914 | 322 |
| 395 | 3300006353 | Ga0075370_10140788 | Ga0075370_101407881 | 322 |
| 396 | 3300006358 | Ga0068871_100489068 | Ga0068871_1004890681 | 322 |
| 397 | 3300006871 | Ga0075434_100174625 | Ga0075434_1001746251 | 322 |
| 398 | 3300006881 | Ga0068865_100069867 | Ga0068865_1000698671 | 322 |
| 399 | 3300006881 | Ga0068865_100099032 | Ga0068865_1000990321 | 322 |
| 400 | 3300007265 | Ga0099794_10036749 | Ga0099794_100367494 | 322 |
| 401 | 3300007265 | Ga0099794_10101913 | Ga0099794_101019131 | 322 |
| 402 | 3300009094 | Ga0111539_10276488 | Ga0111539_102764883 | 322 |
| 403 | 3300009098 | Ga0105245_10019926 | Ga0105245_100199263 | 322 |
| 404 | 3300009147 | Ga0114129_10074073 | Ga0114129_100740734 | 322 |
| 405 | 3300009176 | Ga0105242_10028307 | Ga0105242_100283075 | 322 |
| 406 | 3300009177 | Ga0105248_10099882 | Ga0105248_100998821 | 322 |
| 407 | 3300011119 | Ga0105246_10015590 | Ga0105246_100155902 | 322 |
| 408 | 3300013296 | Ga0157374_10001949 | Ga0157374_100019493 | 322 |
| 409 | 3300013297 | Ga0157378_10309797 | Ga0157378_103097971 | 322 |
| 410 | 3300013308 | Ga0157375_10004049 | Ga0157375_100040492 | 322 |
| 411 | 3300014325 | Ga0163163_10123192 | Ga0163163_101231921 | 322 |
| 412 | 3300014745 | Ga0157377_10134454 | Ga0157377_101344542 | 322 |
| 413 | 3300014969 | Ga0157376_10055244 | Ga0157376_100552441 | 322 |
| 414 | 3300017792 | Ga0163161_10092343 | Ga0163161_100923432 | 322 |
| 415 | 3300025315 | Ga0207697_10084515 | Ga0207697_100845152 | 322 |
| 416 | 3300025315 | Ga0207697_10122361 | Ga0207697_101223611 | 322 |
| 417 | 3300025901 | Ga0207688_10081293 | Ga0207688_100812932 | 322 |
| 418 | 3300025912 | Ga0207707_10001660 | Ga0207707_1000166010 | 322 |
| 419 | 3300025916 | Ga0207663_10186214 | Ga0207663_101862141 | 322 |
| 420 | 3300025919 | Ga0207657_10260069 | Ga0207657_102600691 | 322 |
| 421 | 3300025921 | Ga0207652_10010980 | Ga0207652_100109802 | 322 |
| 422 | 3300025927 | Ga0207687_10214473 | Ga0207687_102144731 | 322 |
| 423 | 3300025932 | Ga0207690_10303672 | Ga0207690_103036721 | 322 |
| 424 | 3300025939 | Ga0207665_10135407 | Ga0207665_101354073 | 322 |
| 425 | 3300025941 | Ga0207711_10058312 | Ga0207711_100583122 | 322 |
| 426 | 3300025942 | Ga0207689_10321468 | Ga0207689_103214681 | 322 |
| 427 | 3300025944 | Ga0207661_10083039 | Ga0207661_100830392 | 322 |
| 428 | 3300025949 | Ga0207667_10547317 | Ga0207667_105473171 | 322 |
| 429 | 3300026023 | Ga0207677_10301278 | Ga0207677_103012781 | 322 |
| 430 | 3300026035 | Ga0207703_10086686 | Ga0207703_100866862 | 322 |
| 431 | 3300026035 | Ga0207703_10406195 | Ga0207703_104061951 | 322 |
| 432 | 3300026041 | Ga0207639_10336171 | Ga0207639_103361712 | 322 |
| 433 | 3300026041 | Ga0207639_10369809 | Ga0207639_103698091 | 322 |
| 434 | 3300026067 | Ga0207678_10056436 | Ga0207678_100564364 | 322 |
| 435 | 3300026121 | Ga0207683_10028153 | Ga0207683_100281533 | 322 |
| 436 | 3300026121 | Ga0207683_10032475 | Ga0207683_100324754 | 322 |
| 437 | 3300026142 | Ga0207698_10235814 | Ga0207698_102358142 | 322 |
| 438 | 3300027671 | Ga0209588_1011526 | Ga0209588_10115261 | 322 |
| 439 | 3300028379 | Ga0268266_10056339 | Ga0268266_100563392 | 322 |
| 440 | 3300035089 | Ga0373944_0048510 | Ga0373944_0048510_125_1105 | 322 |
| 441 | 3300035113 | Ga0373936_0029667 | Ga0373936_0029667_720_1700 | 322 |
| 442 | 3300035113 | Ga0373936_0067083 | Ga0373936_0067083_155_1135 | 322 |
| 443 | 3300035116 | Ga0373945_0015155 | Ga0373945_0015155_175_1155 | 322 |
| 444 | 3300035117 | Ga0373953_0096980 | Ga0373953_0096980_42_1022 | 322 |
| 445 | 3300035118 | Ga0373954_0045877 | Ga0373954_0045877_412_1392 | 322 |
| 446 | 3300035118 | Ga0373954_0048756 | Ga0373954_0048756_865_1845 | 322 |
| 447 | 3300035171 | Ga0373946_0002290 | Ga0373946_0002290_3694_4674 | 322 |
| 448 | 3300035172 | Ga0373955_0199689 | Ga0373955_0199689_62_1042 | 322 |
| 449 | 3300035410 | Ga0373924_0060706 | Ga0373924_0060706_125_1105 | 322 |
| 450 | 3300035691 | Ga0373931_0004981 | Ga0373931_0004981_4381_5361 | 322 |
| 451 | 3300035692 | Ga0373935_0008332 | Ga0373935_0008332_132_1112 | 322 |
| 452 | 3300035695 | Ga0373927_0051061 | Ga0373927_0051061_330_1310 | 322 |
| 453 | 3300035725 | Ga0373947_0028788 | Ga0373947_0028788_194_1174 | 322 |
| 454 | 3300035725 | Ga0373947_0169144 | Ga0373947_0169144_353_1333 | 322 |
| 455 | 3300036401 | Ga0373937_0095017 | Ga0373937_0095017_822_1802 | 322 |
| 456 | 3300036401 | Ga0373937_0265136 | Ga0373937_0265136_168_1148 | 322 |
| 457 | 3300037068 | Ga0373925_0040668 | Ga0373925_0040668_129_1109 | 322 |
| 458 | 3300041512 | Ga0451853_3533905 | Ga0451853_3533905_129_1109 | 322 |
| 459 | 3300042439 | Ga0439464_0037235 | Ga0439464_0037235_99_1076 | 322 |
| 460 | 3300046454 | Ga0495592_0132334 | Ga0495592_0132334_127_1107 | 322 |
| 461 | 3300046455 | Ga0495603_0000092 | Ga0495603_0000092_39833_40813 | 322 |
| 462 | 3300046455 | Ga0495603_0032639 | Ga0495603_0032639_1103_2083 | 322 |
| 463 | 3300046459 | Ga0495629_0003950 | Ga0495629_0003950_10007_10987 | 322 |
| 464 | 3300046461 | Ga0495641_0022828 | Ga0495641_0022828_168_1148 | 322 |
| 465 | 3300046472 | Ga0495580_0035859 | Ga0495580_0035859_193_1173 | 322 |
| 466 | 3300046472 | Ga0495580_0249154 | Ga0495580_0249154_151_1131 | 322 |
| 467 | 3300046473 | Ga0495582_0000039 | Ga0495582_0000039_63668_64648 | 322 |
| 468 | 3300046475 | Ga0495639_0000441 | Ga0495639_0000441_786_1766 | 322 |
| 469 | 3300046476 | Ga0495662_0017280 | Ga0495662_0017280_2389_3369 | 322 |
| 470 | 3300046477 | Ga0495664_0034746 | Ga0495664_0034746_159_1139 | 322 |
| 471 | 3300046491 | Ga0495584_0090494 | Ga0495584_0090494_171_1151 | 322 |
| 472 | 3300046492 | Ga0495585_0139498 | Ga0495585_0139498_197_1177 | 322 |
| 473 | 3300046499 | Ga0495594_0003605 | Ga0495594_0003605_6802_7782 | 322 |
| 474 | 3300046516 | Ga0495628_0159905 | Ga0495628_0159905_565_1545 | 322 |
| 475 | 3300046517 | Ga0495630_0061837 | Ga0495630_0061837_165_1145 | 322 |
| 476 | 3300046529 | Ga0495652_0062235 | Ga0495652_0062235_1981_2961 | 322 |
| 477 | 3300046531 | Ga0495665_0027711 | Ga0495665_0027711_1915_2895 | 322 |
| 478 | 3300046533 | Ga0495640_0046816 | Ga0495640_0046816_1848_2828 | 322 |
| 479 | 3300046557 | Ga0495622_0021018 | Ga0495622_0021018_1894_2874 | 322 |
| 480 | 3300046642 | Ga0495634_0008568 | Ga0495634_0008568_196_1176 | 322 |
| 481 | 3300046663 | Ga0495635_0035409 | Ga0495635_0035409_183_1163 | 322 |
| 482 | 3300046663 | Ga0495635_0062837 | Ga0495635_0062837_10_990 | 322 |
| 483 | 3300046683 | Ga0495658_0016616 | Ga0495658_0016616_2317_3297 | 322 |
| 484 | 3300046690 | Ga0495624_0011119 | Ga0495624_0011119_4440_5420 | 322 |
| 485 | 3300046691 | Ga0495670_0164115 | Ga0495670_0164115_101_1081 | 322 |
| 486 | 3300047319 | Ga0495674_0068044 | Ga0495674_0068044_1908_2888 | 322 |
| 487 | 3300047319 | Ga0495674_0263645 | Ga0495674_0263645_219_1199 | 322 |
| 488 | 3300047472 | Ga0495686_0098569 | Ga0495686_0098569_263_1243 | 322 |
| 489 | 3300047673 | Ga0495593_0002416 | Ga0495593_0002416_172_1152 | 322 |
| 490 | 3300048089 | Ga0495614_0018224 | Ga0495614_0018224_184_1164 | 322 |
| 491 | 3300048903 | Ga0496100_0046567 | Ga0496100_0046567_1147_2127 | 322 |
| 492 | 3300048904 | Ga0496101_0043583 | Ga0496101_0043583_85_1065 | 322 |
| 493 | 3300048904 | Ga0496101_0073963 | Ga0496101_0073963_703_1683 | 322 |
| 494 | 3300048905 | Ga0496102_0040849 | Ga0496102_0040849_1614_2594 | 322 |
| 495 | 3300048905 | Ga0496102_0165310 | Ga0496102_0165310_119_1099 | 322 |
| 496 | 3300048907 | Ga0496104_0010878 | Ga0496104_0010878_2644_3624 | 322 |
| 497 | 3300048908 | Ga0496105_0006955 | Ga0496105_0006955_556_1536 | 322 |
| 498 | 3300048908 | Ga0496105_0149728 | Ga0496105_0149728_57_1037 | 322 |
| 499 | 3300048909 | Ga0496106_0017445 | Ga0496106_0017445_3958_4938 | 322 |
| 500 | 3300048909 | Ga0496106_0273233 | Ga0496106_0273233_122_1102 | 322 |
| 501 | 3300048910 | Ga0496107_0011412 | Ga0496107_0011412_4392_5372 | 322 |
| 502 | 3300048911 | Ga0496108_0011929 | Ga0496108_0011929_3624_4604 | 322 |
| 503 | 3300048911 | Ga0496108_0106508 | Ga0496108_0106508_1394_2374 | 322 |
| 504 | 3300048912 | Ga0496109_0044904 | Ga0496109_0044904_2364_3344 | 322 |
| 505 | 3300048912 | Ga0496109_0253200 | Ga0496109_0253200_464_1444 | 322 |
| 506 | 3300048913 | Ga0496110_0019053 | Ga0496110_0019053_3904_4884 | 322 |
| 507 | 3300048913 | Ga0496110_0039560 | Ga0496110_0039560_2190_3170 | 322 |
| 508 | 3300048913 | Ga0496110_0209791 | Ga0496110_0209791_468_1448 | 322 |
| 509 | 3300048914 | Ga0496111_0136910 | Ga0496111_0136910_203_1183 | 322 |
| 510 | 3300048915 | Ga0496112_0049135 | Ga0496112_0049135_817_1797 | 322 |
| 511 | 3300048916 | Ga0496113_0058782 | Ga0496113_0058782_995_1975 | 322 |
| 512 | 3300048917 | Ga0496114_0319677 | Ga0496114_0319677_370_1350 | 322 |
| 513 | 3300048918 | Ga0496115_0002974 | Ga0496115_0002974_8516_9496 | 322 |
| 514 | 3300048918 | Ga0496115_0097583 | Ga0496115_0097583_1267_2247 | 322 |
| 515 | 3300049744 | Ga0501083_0297311 | Ga0501083_0297311_12_992 | 322 |
| 516 | 3300050507 | nmdc:mga05p37_100784_c1 | nmdc:mga05p37_100784_c1_186_1157 | 322 |
| 517 | 3300050511 | nmdc:mga08y16_352603_c1 | nmdc:mga08y16_352603_c1_507_1490 | 322 |
| 518 | 3300005347 | Ga0070668_100032930 | Ga0070668_1000329304 | 323 |
| 519 | 3300005347 | Ga0070668_100033845 | Ga0070668_1000338452 | 323 |
| 520 | 3300005549 | Ga0070704_100204210 | Ga0070704_1002042102 | 323 |
| 521 | 3300005719 | Ga0068861_100143462 | Ga0068861_1001434622 | 323 |
| 522 | 3300005841 | Ga0068863_100190880 | Ga0068863_1001908802 | 323 |
| 523 | 3300005843 | Ga0068860_100025197 | Ga0068860_1000251976 | 323 |
| 524 | 3300005844 | Ga0068862_100121923 | Ga0068862_1001219232 | 323 |
| 525 | 3300005937 | Ga0081455_10003604 | Ga0081455_1000360427 | 323 |
| 526 | 3300005937 | Ga0081455_10008660 | Ga0081455_1000866011 | 323 |
| 527 | 3300005937 | Ga0081455_10034722 | Ga0081455_100347225 | 323 |
| 528 | 3300006038 | Ga0075365_10039426 | Ga0075365_100394262 | 323 |
| 529 | 3300006914 | Ga0075436_100249245 | Ga0075436_1002492452 | 323 |
| 530 | 3300007265 | Ga0099794_10013528 | Ga0099794_100135281 | 323 |
| 531 | 3300007788 | Ga0099795_10033980 | Ga0099795_100339802 | 323 |
| 532 | 3300013308 | Ga0157375_10126909 | Ga0157375_101269093 | 323 |
| 533 | 3300014326 | Ga0157380_10119170 | Ga0157380_101191702 | 323 |
| 534 | 3300025898 | Ga0207692_10153175 | Ga0207692_101531751 | 323 |
| 535 | 3300025923 | Ga0207681_10142052 | Ga0207681_101420521 | 323 |
| 536 | 3300025925 | Ga0207650_10068310 | Ga0207650_100683102 | 323 |
| 537 | 3300025972 | Ga0207668_10004719 | Ga0207668_100047194 | 323 |
| 538 | 3300025972 | Ga0207668_10032927 | Ga0207668_100329272 | 323 |
| 539 | 3300027671 | Ga0209588_1006064 | Ga0209588_10060643 | 323 |
| 540 | 3300035170 | Ga0373943_0005050 | Ga0373943_0005050_2747_3730 | 323 |
| 541 | 3300035724 | Ga0373933_0133956 | Ga0373933_0133956_69_1274 | 323 |
| 542 | 3300044673 | Ga0453683_0006221 | Ga0453683_0006221_324_1295 | 323 |
| 543 | 3300046616 | Ga0495668_0156764 | Ga0495668_0156764_125_1105 | 323 |
| 544 | 3300048903 | Ga0496100_0206613 | Ga0496100_0206613_87_1085 | 323 |
| 545 | 3300048912 | Ga0496109_0232837 | Ga0496109_0232837_425_1405 | 323 |
| 546 | 3300048915 | Ga0496112_0075854 | Ga0496112_0075854_1451_2431 | 323 |
| 547 | 3300048917 | Ga0496114_0139501 | Ga0496114_0139501_660_1640 | 323 |
| 548 | 3300050492 | nmdc:mga0yw44_89662_c1 | nmdc:mga0yw44_89662_c1_410_1399 | 323 |
| 549 | 3300061734 | Ga0530510_0303670 | Ga0530510_0303670_13_993 | 323 |
| 550 | 3300005334 | Ga0068869_100014742 | Ga0068869_1000147427 | 324 |
| 551 | 3300005344 | Ga0070661_100014451 | Ga0070661_1000144517 | 324 |
| 552 | 3300005364 | Ga0070673_100032047 | Ga0070673_1000320477 | 324 |
| 553 | 3300005434 | Ga0070709_10023079 | Ga0070709_100230793 | 324 |
| 554 | 3300005436 | Ga0070713_100007213 | Ga0070713_1000072137 | 324 |
| 555 | 3300005436 | Ga0070713_100327973 | Ga0070713_1003279731 | 324 |
| 556 | 3300005437 | Ga0070710_10047313 | Ga0070710_100473133 | 324 |
| 557 | 3300005439 | Ga0070711_100209489 | Ga0070711_1002094892 | 324 |
| 558 | 3300005444 | Ga0070694_100253345 | Ga0070694_1002533451 | 324 |
| 559 | 3300005445 | Ga0070708_100092432 | Ga0070708_1000924322 | 324 |
| 560 | 3300005467 | Ga0070706_100166804 | Ga0070706_1001668042 | 324 |
| 561 | 3300005471 | Ga0070698_100059258 | Ga0070698_1000592583 | 324 |
| 562 | 3300005471 | Ga0070698_100352271 | Ga0070698_1003522712 | 324 |
| 563 | 3300005518 | Ga0070699_100177414 | Ga0070699_1001774142 | 324 |
| 564 | 3300005530 | Ga0070679_100125866 | Ga0070679_1001258662 | 324 |
| 565 | 3300005543 | Ga0070672_100034892 | Ga0070672_1000348923 | 324 |
| 566 | 3300005545 | Ga0070695_100012227 | Ga0070695_1000122274 | 324 |
| 567 | 3300005547 | Ga0070693_100106200 | Ga0070693_1001062001 | 324 |
| 568 | 3300005549 | Ga0070704_100032649 | Ga0070704_1000326493 | 324 |
| 569 | 3300005834 | Ga0068851_10191382 | Ga0068851_101913821 | 324 |
| 570 | 3300005844 | Ga0068862_100019656 | Ga0068862_1000196566 | 324 |
| 571 | 3300005937 | Ga0081455_10039939 | Ga0081455_100399393 | 324 |
| 572 | 3300005937 | Ga0081455_10088529 | Ga0081455_100885292 | 324 |
| 573 | 3300005937 | Ga0081455_10092484 | Ga0081455_100924842 | 324 |
| 574 | 3300005983 | Ga0081540_1001417 | Ga0081540_10014178 | 324 |
| 575 | 3300005983 | Ga0081540_1042130 | Ga0081540_10421301 | 324 |
| 576 | 3300006028 | Ga0070717_10023645 | Ga0070717_100236455 | 324 |
| 577 | 3300006028 | Ga0070717_10339769 | Ga0070717_103397691 | 324 |
| 578 | 3300006163 | Ga0070715_10004288 | Ga0070715_100042884 | 324 |
| 579 | 3300006173 | Ga0070716_100003999 | Ga0070716_1000039992 | 324 |
| 580 | 3300006175 | Ga0070712_100204489 | Ga0070712_1002044892 | 324 |
| 581 | 3300006847 | Ga0075431_100023948 | Ga0075431_1000239485 | 324 |
| 582 | 3300006852 | Ga0075433_10046732 | Ga0075433_100467326 | 324 |
| 583 | 3300006871 | Ga0075434_100036852 | Ga0075434_1000368527 | 324 |
| 584 | 3300006880 | Ga0075429_100265012 | Ga0075429_1002650122 | 324 |
| 585 | 3300006914 | Ga0075436_100048594 | Ga0075436_1000485943 | 324 |
| 586 | 3300007265 | Ga0099794_10147268 | Ga0099794_101472681 | 324 |
| 587 | 3300007788 | Ga0099795_10012656 | Ga0099795_100126562 | 324 |
| 588 | 3300007788 | Ga0099795_10042018 | Ga0099795_100420182 | 324 |
| 589 | 3300009094 | Ga0111539_10536407 | Ga0111539_105364071 | 324 |
| 590 | 3300009098 | Ga0105245_10031532 | Ga0105245_100315322 | 324 |
| 591 | 3300009147 | Ga0114129_10007205 | Ga0114129_1000720513 | 324 |
| 592 | 3300009147 | Ga0114129_10091462 | Ga0114129_100914622 | 324 |
| 593 | 3300009553 | Ga0105249_10181145 | Ga0105249_101811451 | 324 |
| 594 | 3300010159 | Ga0099796_10017719 | Ga0099796_100177192 | 324 |
| 595 | 3300013105 | Ga0157369_10033163 | Ga0157369_100331634 | 324 |
| 596 | 3300025898 | Ga0207692_10052462 | Ga0207692_100524621 | 324 |
| 597 | 3300025905 | Ga0207685_10097869 | Ga0207685_100978691 | 324 |
| 598 | 3300025906 | Ga0207699_10008004 | Ga0207699_100080043 | 324 |
| 599 | 3300025915 | Ga0207693_10013428 | Ga0207693_100134283 | 324 |
| 600 | 3300025916 | Ga0207663_10148790 | Ga0207663_101487901 | 324 |
| 601 | 3300025921 | Ga0207652_10137290 | Ga0207652_101372902 | 324 |
| 602 | 3300025928 | Ga0207700_10271502 | Ga0207700_102715021 | 324 |
| 603 | 3300025935 | Ga0207709_10244784 | Ga0207709_102447841 | 324 |
| 604 | 3300025939 | Ga0207665_10006574 | Ga0207665_100065744 | 324 |
| 605 | 3300025942 | Ga0207689_10010277 | Ga0207689_100102777 | 324 |
| 606 | 3300025944 | Ga0207661_10176991 | Ga0207661_101769912 | 324 |
| 607 | 3300025961 | Ga0207712_10097888 | Ga0207712_100978882 | 324 |
| 608 | 3300027512 | Ga0209179_1001895 | Ga0209179_10018952 | 324 |
| 609 | 3300035116 | Ga0373945_0043946 | Ga0373945_0043946_352_1338 | 324 |
| 610 | 3300035119 | Ga0373956_0040326 | Ga0373956_0040326_851_1834 | 324 |
| 611 | 3300036401 | Ga0373937_0011015 | Ga0373937_0011015_6370_7368 | 324 |
| 612 | 3300042436 | Ga0439435_0011590 | Ga0439435_0011590_141_1118 | 324 |
| 613 | 3300046455 | Ga0495603_0023861 | Ga0495603_0023861_2544_3527 | 324 |
| 614 | 3300046457 | Ga0495590_0025471 | Ga0495590_0025471_1034_2029 | 324 |
| 615 | 3300046473 | Ga0495582_0161613 | Ga0495582_0161613_172_1155 | 324 |
| 616 | 3300046475 | Ga0495639_0030313 | Ga0495639_0030313_407_1390 | 324 |
| 617 | 3300046499 | Ga0495594_0067361 | Ga0495594_0067361_573_1556 | 324 |
| 618 | 3300048907 | Ga0496104_0003887 | Ga0496104_0003887_9688_10740 | 324 |
| 619 | 3300048907 | Ga0496104_0004734 | Ga0496104_0004734_3142_4134 | 324 |
| 620 | 3300048907 | Ga0496104_0256665 | Ga0496104_0256665_390_1367 | 324 |
| 621 | 3300048908 | Ga0496105_0016540 | Ga0496105_0016540_2691_3743 | 324 |
| 622 | 3300048908 | Ga0496105_0133563 | Ga0496105_0133563_267_1250 | 324 |
| 623 | 3300048911 | Ga0496108_0054146 | Ga0496108_0054146_10_1062 | 324 |
| 624 | 3300048912 | Ga0496109_0094894 | Ga0496109_0094894_307_1290 | 324 |
| 625 | 3300048913 | Ga0496110_0003153 | Ga0496110_0003153_140_1123 | 324 |
| 626 | 3300048914 | Ga0496111_0215348 | Ga0496111_0215348_136_1119 | 324 |
| 627 | 3300048915 | Ga0496112_0020083 | Ga0496112_0020083_1451_2434 | 324 |
| 628 | 3300048916 | Ga0496113_0032558 | Ga0496113_0032558_1747_2730 | 324 |
| 629 | 3300048918 | Ga0496115_0025751 | Ga0496115_0025751_30_1022 | 324 |
| 630 | 3300048918 | Ga0496115_0055835 | Ga0496115_0055835_708_1760 | 324 |
| 631 | 3300049585 | Ga0501069_0160933 | Ga0501069_0160933_275_1267 | 324 |
| 632 | 3300050507 | nmdc:mga05p37_9213_c1 | nmdc:mga05p37_9213_c1_7591_8583 | 324 |
| 633 | 3300050507 | nmdc:mga05p37_96170_c1 | nmdc:mga05p37_96170_c1_1639_2634 | 324 |
| 634 | 3300050507 | nmdc:mga05p37_9798_c1 | nmdc:mga05p37_9798_c1_8478_9461 | 324 |
| 635 | 3300050508 | nmdc:mga09592_40166_c1 | nmdc:mga09592_40166_c1_1214_2209 | 324 |
| 636 | 3300050508 | nmdc:mga09592_45933_c1 | nmdc:mga09592_45933_c1_312_1304 | 324 |
| 637 | 3300050510 | nmdc:mga06r32_15651_c1 | nmdc:mga06r32_15651_c1_5794_6789 | 324 |
| 638 | 3300050511 | nmdc:mga08y16_362972_c1 | nmdc:mga08y16_362972_c1_333_1328 | 324 |
| 639 | 3300050512 | nmdc:mga0n895_11965_c1 | nmdc:mga0n895_11965_c1_118_1113 | 324 |
| 640 | 3300050513 | nmdc:mga0rr50_51843_c1 | nmdc:mga0rr50_51843_c1_1201_2196 | 324 |
| 641 | 3300050515 | nmdc:mga0a205_28033_c1 | nmdc:mga0a205_28033_c1_1294_2289 | 324 |
| 642 | 3300061734 | Ga0530510_0178359 | Ga0530510_0178359_88_1071 | 324 |
| 643 | iso_pu_bacteria | 2838122688 | 2838128593 | 324 |
| 644 | iso_pu_bacteria | 2841983080 | 2841984466 | 324 |
| 645 | 3300005336 | Ga0070680_100187568 | Ga0070680_1001875681 | 325 |
| 646 | 3300005345 | Ga0070692_10139631 | Ga0070692_101396312 | 325 |
| 647 | 3300005366 | Ga0070659_100294410 | Ga0070659_1002944102 | 325 |
| 648 | 3300005440 | Ga0070705_100013839 | Ga0070705_1000138394 | 325 |
| 649 | 3300005530 | Ga0070679_100383860 | Ga0070679_1003838601 | 325 |
| 650 | 3300005546 | Ga0070696_100018913 | Ga0070696_1000189137 | 325 |
| 651 | 3300005549 | Ga0070704_100072077 | Ga0070704_1000720773 | 325 |
| 652 | 3300005937 | Ga0081455_10063317 | Ga0081455_100633173 | 325 |
| 653 | 3300005985 | Ga0081539_10035500 | Ga0081539_100355002 | 325 |
| 654 | 3300006028 | Ga0070717_10081807 | Ga0070717_100818072 | 325 |
| 655 | 3300006175 | Ga0070712_100014865 | Ga0070712_1000148654 | 325 |
| 656 | 3300006871 | Ga0075434_100407818 | Ga0075434_1004078182 | 325 |
| 657 | 3300006871 | Ga0075434_100550082 | Ga0075434_1005500821 | 325 |
| 658 | 3300007076 | Ga0075435_100420836 | Ga0075435_1004208361 | 325 |
| 659 | 3300009094 | Ga0111539_10157413 | Ga0111539_101574133 | 325 |
| 660 | 3300009094 | Ga0111539_10404092 | Ga0111539_104040922 | 325 |
| 661 | 3300009147 | Ga0114129_10152242 | Ga0114129_101522421 | 325 |
| 662 | 3300013104 | Ga0157370_10170718 | Ga0157370_101707182 | 325 |
| 663 | 3300013105 | Ga0157369_10094975 | Ga0157369_100949753 | 325 |
| 664 | 3300013307 | Ga0157372_10095017 | Ga0157372_100950171 | 325 |
| 665 | 3300025915 | Ga0207693_10021302 | Ga0207693_100213022 | 325 |
| 666 | 3300025921 | Ga0207652_10005062 | Ga0207652_100050623 | 325 |
| 667 | 3300025922 | Ga0207646_10374453 | Ga0207646_103744532 | 325 |
| 668 | 3300025949 | Ga0207667_10176097 | Ga0207667_101760971 | 325 |
| 669 | 3300035691 | Ga0373931_0155416 | Ga0373931_0155416_81_1058 | 325 |
| 670 | 3300035695 | Ga0373927_0241098 | Ga0373927_0241098_126_1118 | 325 |
| 671 | 3300037418 | Ga0395900_0121610 | Ga0395900_0121610_1664_2647 | 325 |
| 672 | 3300037466 | Ga0395898_0013732 | Ga0395898_0013732_6252_7235 | 325 |
| 673 | 3300048907 | Ga0496104_0046618 | Ga0496104_0046618_2623_3606 | 325 |
| 674 | 3300050507 | nmdc:mga05p37_53636_c1 | nmdc:mga05p37_53636_c1_2350_3345 | 325 |
| 675 | 3300050512 | nmdc:mga0n895_501953_c1 | nmdc:mga0n895_501953_c1_95_1078 | 325 |
| 676 | 3300050512 | nmdc:mga0n895_549369_c1 | nmdc:mga0n895_549369_c1_76_1053 | 325 |
| 677 | 3300050513 | nmdc:mga0rr50_451599_c1 | nmdc:mga0rr50_451599_c1_92_1069 | 325 |
| 678 | 2209111006 | 2214800759 | 2213830100 | 326 |
| 679 | 3300000041 | ARcpr5oldR_c000105 | ARcpr5oldR_0001059 | 326 |
| 680 | 3300000042 | ARSoilYngRDRAFT_c00092 | ARSoilYngRDRAFT_000926 | 326 |
| 681 | 3300000043 | ARcpr5yngRDRAFT_c000085 | ARcpr5yngRDRAFT_0000859 | 326 |
| 682 | 3300000044 | ARSoilOldRDRAFT_c000016 | ARSoilOldRDRAFT_0000169 | 326 |
| 683 | 3300000045 | ARCol0oldRDRAFT_c00328 | ARCol0oldRDRAFT_003283 | 326 |
| 684 | 3300000652 | ARCol0yngRDRAFT_1000096 | ARCol0yngRDRAFT_10000969 | 326 |
| 685 | 3300001990 | JGI24737J22298_10013112 | JGI24737J22298_100131122 | 326 |
| 686 | 3300001990 | JGI24737J22298_10032275 | JGI24737J22298_100322751 | 326 |
| 687 | 3300005277 | Ga0065716_1001939 | Ga0065716_10019392 | 326 |
| 688 | 3300005289 | Ga0065704_10090328 | Ga0065704_100903281 | 326 |
| 689 | 3300005295 | Ga0065707_10100212 | Ga0065707_101002123 | 326 |
| 690 | 3300005328 | Ga0070676_10119601 | Ga0070676_101196013 | 326 |
| 691 | 3300005329 | Ga0070683_100253881 | Ga0070683_1002538811 | 326 |
| 692 | 3300005333 | Ga0070677_10141711 | Ga0070677_101417111 | 326 |
| 693 | 3300005334 | Ga0068869_100135247 | Ga0068869_1001352472 | 326 |
| 694 | 3300005336 | Ga0070680_100081181 | Ga0070680_1000811811 | 326 |
| 695 | 3300005339 | Ga0070660_100009542 | Ga0070660_1000095429 | 326 |
| 696 | 3300005340 | Ga0070689_100014457 | Ga0070689_1000144573 | 326 |
| 697 | 3300005340 | Ga0070689_100045521 | Ga0070689_1000455213 | 326 |
| 698 | 3300005343 | Ga0070687_100042178 | Ga0070687_1000421782 | 326 |
| 699 | 3300005343 | Ga0070687_100120742 | Ga0070687_1001207421 | 326 |
| 700 | 3300005344 | Ga0070661_100402496 | Ga0070661_1004024961 | 326 |
| 701 | 3300005345 | Ga0070692_10117721 | Ga0070692_101177211 | 326 |
| 702 | 3300005345 | Ga0070692_10231679 | Ga0070692_102316791 | 326 |
| 703 | 3300005347 | Ga0070668_100393820 | Ga0070668_1003938201 | 326 |
| 704 | 3300005353 | Ga0070669_100149608 | Ga0070669_1001496082 | 326 |
| 705 | 3300005354 | Ga0070675_100039484 | Ga0070675_1000394844 | 326 |
| 706 | 3300005354 | Ga0070675_100187606 | Ga0070675_1001876062 | 326 |
| 707 | 3300005356 | Ga0070674_100179785 | Ga0070674_1001797851 | 326 |
| 708 | 3300005364 | Ga0070673_100021826 | Ga0070673_1000218264 | 326 |
| 709 | 3300005365 | Ga0070688_100121788 | Ga0070688_1001217881 | 326 |
| 710 | 3300005366 | Ga0070659_100179024 | Ga0070659_1001790242 | 326 |
| 711 | 3300005367 | Ga0070667_100061825 | Ga0070667_1000618254 | 326 |
| 712 | 3300005367 | Ga0070667_100216538 | Ga0070667_1002165382 | 326 |
| 713 | 3300005438 | Ga0070701_10007665 | Ga0070701_100076652 | 326 |
| 714 | 3300005438 | Ga0070701_10092267 | Ga0070701_100922673 | 326 |
| 715 | 3300005440 | Ga0070705_100065793 | Ga0070705_1000657931 | 326 |
| 716 | 3300005441 | Ga0070700_100139572 | Ga0070700_1001395722 | 326 |
| 717 | 3300005444 | Ga0070694_100049641 | Ga0070694_1000496414 | 326 |
| 718 | 3300005444 | Ga0070694_100233098 | Ga0070694_1002330981 | 326 |
| 719 | 3300005445 | Ga0070708_100077516 | Ga0070708_1000775164 | 326 |
| 720 | 3300005445 | Ga0070708_100325537 | Ga0070708_1003255371 | 326 |
| 721 | 3300005455 | Ga0070663_100357852 | Ga0070663_1003578521 | 326 |
| 722 | 3300005456 | Ga0070678_100464258 | Ga0070678_1004642581 | 326 |
| 723 | 3300005457 | Ga0070662_100022584 | Ga0070662_1000225844 | 326 |
| 724 | 3300005457 | Ga0070662_100349279 | Ga0070662_1003492791 | 326 |
| 725 | 3300005458 | Ga0070681_10238203 | Ga0070681_102382031 | 326 |
| 726 | 3300005467 | Ga0070706_100041803 | Ga0070706_1000418034 | 326 |
| 727 | 3300005468 | Ga0070707_100012483 | Ga0070707_1000124835 | 326 |
| 728 | 3300005471 | Ga0070698_100124734 | Ga0070698_1001247343 | 326 |
| 729 | 3300005471 | Ga0070698_100231627 | Ga0070698_1002316271 | 326 |
| 730 | 3300005518 | Ga0070699_100004122 | Ga0070699_1000041221 | 326 |
| 731 | 3300005518 | Ga0070699_100250388 | Ga0070699_1002503882 | 326 |
| 732 | 3300005530 | Ga0070679_100272450 | Ga0070679_1002724501 | 326 |
| 733 | 3300005535 | Ga0070684_100521346 | Ga0070684_1005213461 | 326 |
| 734 | 3300005536 | Ga0070697_100018594 | Ga0070697_1000185946 | 326 |
| 735 | 3300005536 | Ga0070697_100062962 | Ga0070697_1000629624 | 326 |
| 736 | 3300005539 | Ga0068853_100377924 | Ga0068853_1003779241 | 326 |
| 737 | 3300005543 | Ga0070672_100041095 | Ga0070672_1000410952 | 326 |
| 738 | 3300005543 | Ga0070672_100201483 | Ga0070672_1002014831 | 326 |
| 739 | 3300005544 | Ga0070686_100087774 | Ga0070686_1000877742 | 326 |
| 740 | 3300005544 | Ga0070686_100101949 | Ga0070686_1001019491 | 326 |
| 741 | 3300005545 | Ga0070695_100017313 | Ga0070695_1000173132 | 326 |
| 742 | 3300005545 | Ga0070695_100051261 | Ga0070695_1000512612 | 326 |
| 743 | 3300005545 | Ga0070695_100354268 | Ga0070695_1003542681 | 326 |
| 744 | 3300005546 | Ga0070696_100137478 | Ga0070696_1001374782 | 326 |
| 745 | 3300005546 | Ga0070696_100150020 | Ga0070696_1001500202 | 326 |
| 746 | 3300005547 | Ga0070693_100055875 | Ga0070693_1000558752 | 326 |
| 747 | 3300005563 | Ga0068855_100144369 | Ga0068855_1001443694 | 326 |
| 748 | 3300005564 | Ga0070664_100482015 | Ga0070664_1004820151 | 326 |
| 749 | 3300005577 | Ga0068857_100021887 | Ga0068857_1000218875 | 326 |
| 750 | 3300005577 | Ga0068857_100126366 | Ga0068857_1001263662 | 326 |
| 751 | 3300005578 | Ga0068854_100036600 | Ga0068854_1000366004 | 326 |
| 752 | 3300005615 | Ga0070702_100013438 | Ga0070702_1000134382 | 326 |
| 753 | 3300005615 | Ga0070702_100210798 | Ga0070702_1002107981 | 326 |
| 754 | 3300005616 | Ga0068852_100043002 | Ga0068852_1000430024 | 326 |
| 755 | 3300005617 | Ga0068859_100342733 | Ga0068859_1003427332 | 326 |
| 756 | 3300005617 | Ga0068859_100355070 | Ga0068859_1003550703 | 326 |
| 757 | 3300005618 | Ga0068864_100003648 | Ga0068864_1000036484 | 326 |
| 758 | 3300005618 | Ga0068864_100095474 | Ga0068864_1000954742 | 326 |
| 759 | 3300005719 | Ga0068861_100080627 | Ga0068861_1000806274 | 326 |
| 760 | 3300005834 | Ga0068851_10138650 | Ga0068851_101386501 | 326 |
| 761 | 3300005840 | Ga0068870_10027115 | Ga0068870_100271154 | 326 |
| 762 | 3300005840 | Ga0068870_10107763 | Ga0068870_101077632 | 326 |
| 763 | 3300005841 | Ga0068863_100010844 | Ga0068863_1000108447 | 326 |
| 764 | 3300005843 | Ga0068860_100062335 | Ga0068860_1000623352 | 326 |
| 765 | 3300005843 | Ga0068860_100171270 | Ga0068860_1001712702 | 326 |
| 766 | 3300005843 | Ga0068860_100267912 | Ga0068860_1002679122 | 326 |
| 767 | 3300005844 | Ga0068862_100048902 | Ga0068862_1000489025 | 326 |
| 768 | 3300005844 | Ga0068862_100252762 | Ga0068862_1002527622 | 326 |
| 769 | 3300005844 | Ga0068862_100610560 | Ga0068862_1006105601 | 326 |
| 770 | 3300006173 | Ga0070716_100283178 | Ga0070716_1002831781 | 326 |
| 771 | 3300006178 | Ga0075367_10151549 | Ga0075367_101515491 | 326 |
| 772 | 3300006846 | Ga0075430_100001979 | Ga0075430_1000019792 | 326 |
| 773 | 3300006852 | Ga0075433_10051401 | Ga0075433_100514014 | 326 |
| 774 | 3300006871 | Ga0075434_100086529 | Ga0075434_1000865293 | 326 |
| 775 | 3300006881 | Ga0068865_100132730 | Ga0068865_1001327301 | 326 |
| 776 | 3300006931 | Ga0097620_100342702 | Ga0097620_1003427022 | 326 |
| 777 | 3300006931 | Ga0097620_100355072 | Ga0097620_1003550721 | 326 |
| 778 | 3300009011 | Ga0105251_10080495 | Ga0105251_100804951 | 326 |
| 779 | 3300009093 | Ga0105240_10711066 | Ga0105240_107110661 | 326 |
| 780 | 3300009094 | Ga0111539_10004905 | Ga0111539_100049053 | 326 |
| 781 | 3300009094 | Ga0111539_10097433 | Ga0111539_100974331 | 326 |
| 782 | 3300009098 | Ga0105245_10149118 | Ga0105245_101491181 | 326 |
| 783 | 3300009098 | Ga0105245_10354323 | Ga0105245_103543232 | 326 |
| 784 | 3300009148 | Ga0105243_10160961 | Ga0105243_101609612 | 326 |
| 785 | 3300009148 | Ga0105243_10212467 | Ga0105243_102124672 | 326 |
| 786 | 3300009148 | Ga0105243_10258806 | Ga0105243_102588061 | 326 |
| 787 | 3300009174 | Ga0105241_10326021 | Ga0105241_103260212 | 326 |
| 788 | 3300009176 | Ga0105242_10193235 | Ga0105242_101932351 | 326 |
| 789 | 3300009176 | Ga0105242_10240510 | Ga0105242_102405101 | 326 |
| 790 | 3300009177 | Ga0105248_10275769 | Ga0105248_102757691 | 326 |
| 791 | 3300009553 | Ga0105249_10078302 | Ga0105249_100783024 | 326 |
| 792 | 3300009553 | Ga0105249_10165792 | Ga0105249_101657921 | 326 |
| 793 | 3300009553 | Ga0105249_10225011 | Ga0105249_102250112 | 326 |
| 794 | 3300010375 | Ga0105239_10154443 | Ga0105239_101544432 | 326 |
| 795 | 3300011119 | Ga0105246_10177723 | Ga0105246_101777232 | 326 |
| 796 | 3300013100 | Ga0157373_10108738 | Ga0157373_101087382 | 326 |
| 797 | 3300013296 | Ga0157374_10020022 | Ga0157374_100200221 | 326 |
| 798 | 3300013297 | Ga0157378_10588055 | Ga0157378_105880551 | 326 |
| 799 | 3300013306 | Ga0163162_10025015 | Ga0163162_100250154 | 326 |
| 800 | 3300013306 | Ga0163162_10414429 | Ga0163162_104144291 | 326 |
| 801 | 3300013306 | Ga0163162_10591292 | Ga0163162_105912921 | 326 |
| 802 | 3300013308 | Ga0157375_10383540 | Ga0157375_103835401 | 326 |
| 803 | 3300013308 | Ga0157375_10701462 | Ga0157375_107014621 | 326 |
| 804 | 3300014325 | Ga0163163_10108550 | Ga0163163_101085502 | 326 |
| 805 | 3300014326 | Ga0157380_10043822 | Ga0157380_100438221 | 326 |
| 806 | 3300014326 | Ga0157380_10328871 | Ga0157380_103288712 | 326 |
| 807 | 3300014969 | Ga0157376_10520743 | Ga0157376_105207431 | 326 |
| 808 | 3300017792 | Ga0163161_10109332 | Ga0163161_101093322 | 326 |
| 809 | 3300017792 | Ga0163161_10156447 | Ga0163161_101564471 | 326 |
| 810 | 3300025271 | Ga0207666_1001292 | Ga0207666_10012922 | 326 |
| 811 | 3300025315 | Ga0207697_10052604 | Ga0207697_100526041 | 326 |
| 812 | 3300025321 | Ga0207656_10056401 | Ga0207656_100564011 | 326 |
| 813 | 3300025885 | Ga0207653_10009126 | Ga0207653_100091262 | 326 |
| 814 | 3300025893 | Ga0207682_10031867 | Ga0207682_100318672 | 326 |
| 815 | 3300025893 | Ga0207682_10072525 | Ga0207682_100725251 | 326 |
| 816 | 3300025901 | Ga0207688_10267537 | Ga0207688_102675371 | 326 |
| 817 | 3300025903 | Ga0207680_10186851 | Ga0207680_101868511 | 326 |
| 818 | 3300025907 | Ga0207645_10140361 | Ga0207645_101403611 | 326 |
| 819 | 3300025908 | Ga0207643_10100322 | Ga0207643_101003222 | 326 |
| 820 | 3300025910 | Ga0207684_10120493 | Ga0207684_101204933 | 326 |
| 821 | 3300025911 | Ga0207654_10037552 | Ga0207654_100375522 | 326 |
| 822 | 3300025912 | Ga0207707_10183165 | Ga0207707_101831651 | 326 |
| 823 | 3300025917 | Ga0207660_10086337 | Ga0207660_100863372 | 326 |
| 824 | 3300025917 | Ga0207660_10375453 | Ga0207660_103754531 | 326 |
| 825 | 3300025918 | Ga0207662_10099506 | Ga0207662_100995061 | 326 |
| 826 | 3300025918 | Ga0207662_10198042 | Ga0207662_101980421 | 326 |
| 827 | 3300025920 | Ga0207649_10138253 | Ga0207649_101382531 | 326 |
| 828 | 3300025922 | Ga0207646_10004205 | Ga0207646_100042056 | 326 |
| 829 | 3300025923 | Ga0207681_10270574 | Ga0207681_102705741 | 326 |
| 830 | 3300025925 | Ga0207650_10004622 | Ga0207650_100046229 | 326 |
| 831 | 3300025925 | Ga0207650_10326526 | Ga0207650_103265261 | 326 |
| 832 | 3300025926 | Ga0207659_10000948 | Ga0207659_100009481 | 326 |
| 833 | 3300025926 | Ga0207659_10002548 | Ga0207659_100025488 | 326 |
| 834 | 3300025927 | Ga0207687_10232769 | Ga0207687_102327692 | 326 |
| 835 | 3300025931 | Ga0207644_10423167 | Ga0207644_104231671 | 326 |
| 836 | 3300025932 | Ga0207690_10109456 | Ga0207690_101094561 | 326 |
| 837 | 3300025933 | Ga0207706_10233144 | Ga0207706_102331441 | 326 |
| 838 | 3300025933 | Ga0207706_10350063 | Ga0207706_103500631 | 326 |
| 839 | 3300025933 | Ga0207706_10460198 | Ga0207706_104601981 | 326 |
| 840 | 3300025934 | Ga0207686_10152970 | Ga0207686_101529701 | 326 |
| 841 | 3300025935 | Ga0207709_10001091 | Ga0207709_1000109118 | 326 |
| 842 | 3300025935 | Ga0207709_10168919 | Ga0207709_101689192 | 326 |
| 843 | 3300025936 | Ga0207670_10069356 | Ga0207670_100693562 | 326 |
| 844 | 3300025937 | Ga0207669_10148493 | Ga0207669_101484931 | 326 |
| 845 | 3300025938 | Ga0207704_10001128 | Ga0207704_100011282 | 326 |
| 846 | 3300025940 | Ga0207691_10218553 | Ga0207691_102185531 | 326 |
| 847 | 3300025942 | Ga0207689_10145039 | Ga0207689_101450391 | 326 |
| 848 | 3300025944 | Ga0207661_10324583 | Ga0207661_103245831 | 326 |
| 849 | 3300025945 | Ga0207679_10037948 | Ga0207679_100379483 | 326 |
| 850 | 3300025960 | Ga0207651_10076453 | Ga0207651_100764532 | 326 |
| 851 | 3300025961 | Ga0207712_10340988 | Ga0207712_103409882 | 326 |
| 852 | 3300025972 | Ga0207668_10053532 | Ga0207668_100535321 | 326 |
| 853 | 3300025981 | Ga0207640_10428741 | Ga0207640_104287411 | 326 |
| 854 | 3300026067 | Ga0207678_10016458 | Ga0207678_100164582 | 326 |
| 855 | 3300026067 | Ga0207678_10465606 | Ga0207678_104656061 | 326 |
| 856 | 3300026075 | Ga0207708_10023082 | Ga0207708_100230821 | 326 |
| 857 | 3300026075 | Ga0207708_10279879 | Ga0207708_102798791 | 326 |
| 858 | 3300026089 | Ga0207648_10061272 | Ga0207648_100612723 | 326 |
| 859 | 3300026089 | Ga0207648_10170018 | Ga0207648_101700182 | 326 |
| 860 | 3300026089 | Ga0207648_10250302 | Ga0207648_102503021 | 326 |
| 861 | 3300026095 | Ga0207676_10003243 | Ga0207676_100032439 | 326 |
| 862 | 3300026116 | Ga0207674_10063659 | Ga0207674_100636592 | 326 |
| 863 | 3300026116 | Ga0207674_10135721 | Ga0207674_101357211 | 326 |
| 864 | 3300026118 | Ga0207675_100269059 | Ga0207675_1002690591 | 326 |
| 865 | 3300026121 | Ga0207683_10250745 | Ga0207683_102507451 | 326 |
| 866 | 3300026142 | Ga0207698_10182198 | Ga0207698_101821981 | 326 |
| 867 | 3300027907 | Ga0207428_10000664 | Ga0207428_1000066425 | 326 |
| 868 | 3300027907 | Ga0207428_10011295 | Ga0207428_100112958 | 326 |
| 869 | 3300028380 | Ga0268265_10164502 | Ga0268265_101645022 | 326 |
| 870 | 3300028381 | Ga0268264_10237528 | Ga0268264_102375281 | 326 |
| 871 | 3300028381 | Ga0268264_10279028 | Ga0268264_102790282 | 326 |
| 872 | 3300028381 | Ga0268264_10287305 | Ga0268264_102873051 | 326 |
| 873 | 3300028381 | Ga0268264_10335335 | Ga0268264_103353352 | 326 |
| 874 | 3300034816 | Ga0373930_0000082 | Ga0373930_0000082_5095_6075 | 326 |
| 875 | 3300034817 | Ga0373948_0001083 | Ga0373948_0001083_1318_2298 | 326 |
| 876 | 3300034818 | Ga0373950_0001391 | Ga0373950_0001391_506_1486 | 326 |
| 877 | 3300034819 | Ga0373958_0000241 | Ga0373958_0000241_5116_6096 | 326 |
| 878 | 3300034819 | Ga0373958_0004533 | Ga0373958_0004533_945_1925 | 326 |
| 879 | 3300034957 | Ga0373938_0000222 | Ga0373938_0000222_1226_2206 | 326 |
| 880 | 3300035084 | Ga0373928_0000048 | Ga0373928_0000048_5549_6529 | 326 |
| 881 | 3300035085 | Ga0373929_0000056 | Ga0373929_0000056_3586_4566 | 326 |
| 882 | 3300035088 | Ga0373940_0005577 | Ga0373940_0005577_1443_2423 | 326 |
| 883 | 3300035090 | Ga0373949_0000558 | Ga0373949_0000558_6609_7589 | 326 |
| 884 | 3300035091 | Ga0373951_0000521 | Ga0373951_0000521_4761_5741 | 326 |
| 885 | 3300035092 | Ga0373952_0001750 | Ga0373952_0001750_1533_2513 | 326 |
| 886 | 3300035112 | Ga0373932_0000755 | Ga0373932_0000755_1650_2630 | 326 |
| 887 | 3300035114 | Ga0373939_0004609 | Ga0373939_0004609_1246_2226 | 326 |
| 888 | 3300035115 | Ga0373941_0000282 | Ga0373941_0000282_4512_5492 | 326 |
| 889 | 3300035121 | Ga0373960_0000021 | Ga0373960_0000021_9083_10063 | 326 |
| 890 | 3300035207 | Ga0373942_0014196 | Ga0373942_0014196_712_1692 | 326 |
| 891 | 3300035241 | Ga0373961_0000771 | Ga0373961_0000771_6688_7668 | 326 |
| 892 | 3300035242 | Ga0373962_0005559 | Ga0373962_0005559_1543_2523 | 326 |
| 893 | 3300035691 | Ga0373931_0034068 | Ga0373931_0034068_314_1294 | 326 |
| 894 | 3300035691 | Ga0373931_0101817 | Ga0373931_0101817_182_1162 | 326 |
| 895 | 3300035725 | Ga0373947_0185441 | Ga0373947_0185441_95_1084 | 326 |
| 896 | 3300039437 | Ga0436365_0717194 | Ga0436365_0717194_199_1188 | 326 |
| 897 | 3300044842 | Ga0466957_0037879 | Ga0466957_0037879_886_1878 | 326 |
| 898 | 3300045049 | Ga0466959_0052653 | Ga0466959_0052653_149_1141 | 326 |
| 899 | 3300045051 | Ga0451576_0022529 | Ga0451576_0022529_1276_2256 | 326 |
| 900 | 3300046475 | Ga0495639_0128400 | Ga0495639_0128400_125_1114 | 326 |
| 901 | 3300046499 | Ga0495594_0176603 | Ga0495594_0176603_64_1053 | 326 |
| 902 | 3300046535 | Ga0495586_0031683 | Ga0495586_0031683_50_1033 | 326 |
| 903 | 3300046674 | Ga0495588_0173604 | Ga0495588_0173604_23_1018 | 326 |
| 904 | 3300048904 | Ga0496101_0004178 | Ga0496101_0004178_6873_7853 | 326 |
| 905 | 3300048906 | Ga0496103_0093415 | Ga0496103_0093415_422_1402 | 326 |
| 906 | 3300048908 | Ga0496105_0373245 | Ga0496105_0373245_69_1049 | 326 |
| 907 | 3300048909 | Ga0496106_0085006 | Ga0496106_0085006_1245_2225 | 326 |
| 908 | 3300048909 | Ga0496106_0128664 | Ga0496106_0128664_610_1590 | 326 |
| 909 | 3300048910 | Ga0496107_0041209 | Ga0496107_0041209_265_1245 | 326 |
| 910 | 3300048911 | Ga0496108_0465102 | Ga0496108_0465102_70_1059 | 326 |
| 911 | 3300048914 | Ga0496111_0155948 | Ga0496111_0155948_71_1051 | 326 |
| 912 | 3300048915 | Ga0496112_0008064 | Ga0496112_0008064_6063_7043 | 326 |
| 913 | 3300048917 | Ga0496114_0043578 | Ga0496114_0043578_164_1144 | 326 |
| 914 | 3300048918 | Ga0496115_0132194 | Ga0496115_0132194_232_1212 | 326 |
| 915 | 3300049569 | Ga0501032_0108400 | Ga0501032_0108400_331_1389 | 326 |
| 916 | 3300049576 | Ga0501040_0009053 | Ga0501040_0009053_4150_5163 | 326 |
| 917 | 3300049577 | Ga0501041_0152971 | Ga0501041_0152971_374_1387 | 326 |
| 918 | 3300049580 | Ga0501046_0010851 | Ga0501046_0010851_5119_6177 | 326 |
| 919 | 3300049582 | Ga0501048_0001087 | Ga0501048_0001087_764_1822 | 326 |
| 920 | 3300049588 | Ga0501072_0006517 | Ga0501072_0006517_192_1250 | 326 |
| 921 | 3300049588 | Ga0501072_0010608 | Ga0501072_0010608_2079_3065 | 326 |
| 922 | 3300049591 | Ga0501075_0023006 | Ga0501075_0023006_398_1384 | 326 |
| 923 | 3300049591 | Ga0501075_0045600 | Ga0501075_0045600_1174_2178 | 326 |
| 924 | 3300049591 | Ga0501075_0344453 | Ga0501075_0344453_36_1049 | 326 |
| 925 | 3300049592 | Ga0501076_0000941 | Ga0501076_0000941_13674_14660 | 326 |
| 926 | 3300049592 | Ga0501076_0030156 | Ga0501076_0030156_1839_2843 | 326 |
| 927 | 3300049742 | Ga0501080_0000357 | Ga0501080_0000357_12580_13638 | 326 |
| 928 | 3300050496 | nmdc:mga07m45_179417_c1 | nmdc:mga07m45_179417_c1_217_1197 | 326 |
| 929 | 3300050507 | nmdc:mga05p37_130378_c1 | nmdc:mga05p37_130378_c1_2066_3055 | 326 |
| 930 | 3300050508 | nmdc:mga09592_3912_c1 | nmdc:mga09592_3912_c1_171_1160 | 326 |
| 931 | 3300050509 | nmdc:mga0qj67_16709_c1 | nmdc:mga0qj67_16709_c1_398_1387 | 326 |
| 932 | 3300050511 | nmdc:mga08y16_3102_c1 | nmdc:mga08y16_3102_c1_7007_7987 | 326 |
| 933 | 3300050511 | nmdc:mga08y16_5778_c1 | nmdc:mga08y16_5778_c1_11620_12600 | 326 |
| 934 | 3300050512 | nmdc:mga0n895_1477_c1 | nmdc:mga0n895_1477_c1_1875_2864 | 326 |
| 935 | 3300050512 | nmdc:mga0n895_310990_c1 | nmdc:mga0n895_310990_c1_371_1351 | 326 |
| 936 | 3300050515 | nmdc:mga0a205_323168_c1 | nmdc:mga0a205_323168_c1_369_1349 | 326 |
| 937 | 3300050515 | nmdc:mga0a205_39114_c1 | nmdc:mga0a205_39114_c1_2168_3148 | 326 |
| 938 | 3300060353 | Ga0501082_0003064 | Ga0501082_0003064_12123_13109 | 326 |
| 939 | 3300060353 | Ga0501082_0339982 | Ga0501082_0339982_157_1143 | 326 |
| 940 | 3300061734 | Ga0530510_0000710 | Ga0530510_0000710_9831_10817 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9355 | 29 | 325 |
| 3lft-assembly2.cif.gz_B | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9294 | 32 | 325 |
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9294 | 29 | 325 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9267 | 28 | 324 |
| 3lft-assembly2.cif.gz_B | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9232 | 32 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lkvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9019 | 28 | 295 | 3.40.50.2300 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9018 | 149 | 324 | 3.40.50.2300 |
| 3lftB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9017 | 31 | 141 | 3.40.50.2300 |
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.894 | 143 | 325 | 3.40.50.2300 |
| 3lkvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8904 | 28 | 295 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7D4C4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9891 | 228 | 326 |
|
| AF-A0A2V8BD40-F1-model_v4 | ABC transporter substrate-binding protein | 0.9806 | 218 | 309 |
|
| AF-A0A1F3YG64-F1-model_v4 | ABC transporter substrate-binding protein | 0.9802 | 29 | 326 |
|
| AF-A0A536UEY7-F1-model_v4 | ABC transporter substrate-binding protein | 0.9772 | 156 | 326 |
|
| AF-A0A023XKA0-F1-model_v4 | deleted | 0.9766 | 166 | 326 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar