F486305

General Info

Members Datasets Scaffolds Average Seq Length
940 349 935 322

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10158380|Ga0070681_101583802
Length 367
Sequence MGRGSKVCLCPEANIDCDLWRQVRVSKAIYTDASRIGRRLDMLRREFIAGAATSALLVCPLRAHAQQSATRRMRIGILIYSTPQRDPNTQTLLEGFRQLGYVDGQNVTIEYRYAQGQPERLPELATDLVQSKPDVIFALGGDVTPHAAKATQAIPIVYVMSADPVQLGIAKSLAKPGGNSTGVTLLSDQLAAKRLEIFKEAAPLIARVALVRDPSHADNELPIAARAAKALKLELLPIGIHDPAELDRALETTKELGIDSVYVVSSRHTVANAQRIVGFANRQRLPLVAGWGAWVHAGGLISYGPNVTEMIRQASRFLDVILKGANPGDLPVQQPTQFELFVNLKTAKALGLDIPESFLLRADKVIE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
3 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
4 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
213 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
214 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
215 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
218 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
255 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0.32
Rhizoplane 11.7
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800759 2209111006 Bacteria 10903
2 ARcpr5oldR_c000105 3300000041 Bacteria 15306
3 ARSoilYngRDRAFT_c00092 3300000042 Bacteria 15326
4 ARcpr5yngRDRAFT_c000085 3300000043 Bacteria 15310
5 ARSoilOldRDRAFT_c000016 3300000044 Bacteria 39308
6 ARCol0oldRDRAFT_c00328 3300000045 Bacteria 4603
7 ARCol0yngRDRAFT_1000096 3300000652 Bacteria 16320
8 JGI24737J22298_10013112 3300001990 Bacteria 2700
9 JGI24737J22298_10032275 3300001990 Bacteria 1631
10 JGI25404J52841_10002030 3300003659 Bacteria 3743
11 JGI25404J52841_10003373 3300003659 Bacteria 3151
12 JGI25404J52841_10006341 3300003659 Bacteria 2472
13 JGI25404J52841_10013652 3300003659 Bacteria 1762
14 JGI25404J52841_10017054 3300003659 Bacteria 1575
15 JGI25404J52841_10017720 3300003659 Bacteria 1544
16 Ga0065716_1001939 3300005277 Bacteria 2663
17 Ga0065704_10090328 3300005289 Bacteria 2795
18 Ga0065707_10100212 3300005295 Bacteria 2947
19 Ga0070676_10001849 3300005328 Bacteria 10793
20 Ga0070676_10119601 3300005328 Bacteria 1651
21 Ga0070683_100089278 3300005329 Bacteria 2892
22 Ga0070683_100253881 3300005329 Bacteria 1672
23 Ga0070690_100006214 3300005330 Bacteria 6773
24 Ga0070690_100339058 3300005330 Unclassified 1088
25 Ga0070670_100275182 3300005331 Unclassified 1469
26 Ga0070677_10141711 3300005333 Bacteria 1109
27 Ga0068869_100014742 3300005334 Bacteria 5227
28 Ga0068869_100036009 3300005334 Bacteria 3512
29 Ga0068869_100135247 3300005334 Unclassified 1898
30 Ga0068869_100287551 3300005334 Unclassified 1324
31 Ga0070666_10016162 3300005335 Bacteria 4770
32 Ga0070666_10020373 3300005335 Bacteria 4286
33 Ga0070680_100081181 3300005336 Bacteria 2675
34 Ga0070680_100187568 3300005336 Bacteria 1742
35 Ga0070682_100073320 3300005337 Bacteria 2196
36 Ga0068868_100057759 3300005338 Bacteria 3066
37 Ga0070660_100009542 3300005339 Bacteria 6833
38 Ga0070660_100286470 3300005339 Bacteria 1348
39 Ga0070689_100014457 3300005340 Bacteria 5734
40 Ga0070689_100045521 3300005340 Bacteria 3379
41 Ga0070689_100356806 3300005340 Unclassified 1227
42 Ga0070687_100042178 3300005343 Bacteria 2310
43 Ga0070687_100120742 3300005343 Bacteria 1499
44 Ga0070661_100014451 3300005344 Bacteria 5564
45 Ga0070661_100402496 3300005344 Bacteria 1082
46 Ga0070692_10117721 3300005345 Unclassified 1477
47 Ga0070692_10139631 3300005345 Bacteria 1370
48 Ga0070692_10231679 3300005345 Unclassified 1097
49 Ga0070668_100013101 3300005347 Bacteria 6179
50 Ga0070668_100032930 3300005347 Bacteria 3944
51 Ga0070668_100033845 3300005347 Unclassified 3893
52 Ga0070668_100376507 3300005347 Bacteria 1207
53 Ga0070668_100393820 3300005347 Bacteria 1181
54 Ga0070669_100006176 3300005353 Bacteria 8647
55 Ga0070669_100084415 3300005353 Unclassified 2369
56 Ga0070669_100149608 3300005353 Bacteria 1806
57 Ga0070669_100191631 3300005353 Bacteria 1604
58 Ga0070675_100018746 3300005354 Bacteria 5508
59 Ga0070675_100039484 3300005354 Bacteria 3852
60 Ga0070675_100187606 3300005354 Bacteria 1790
61 Ga0070671_100041930 3300005355 Bacteria 3804
62 Ga0070671_100053598 3300005355 Bacteria 3353
63 Ga0070671_100229808 3300005355 Unclassified 1574
64 Ga0070671_100270092 3300005355 Bacteria 1445
65 Ga0070671_100387240 3300005355 Bacteria 1195
66 Ga0070674_100002846 3300005356 Bacteria 9563
67 Ga0070674_100096653 3300005356 Bacteria 2144
68 Ga0070674_100179785 3300005356 Bacteria 1619
69 Ga0070673_100021826 3300005364 Bacteria 4650
70 Ga0070673_100032047 3300005364 Bacteria 3952
71 Ga0070688_100052743 3300005365 Bacteria 2541
72 Ga0070688_100121788 3300005365 Bacteria 1748
73 Ga0070659_100179024 3300005366 Bacteria 1739
74 Ga0070659_100294410 3300005366 Unclassified 1352
75 Ga0070659_100296099 3300005366 Bacteria 1348
76 Ga0070659_100327627 3300005366 Unclassified 1281
77 Ga0070667_100020939 3300005367 Bacteria 5432
78 Ga0070667_100061825 3300005367 Bacteria 3171
79 Ga0070667_100216538 3300005367 Bacteria 1703
80 Ga0070709_10023079 3300005434 Bacteria 3648
81 Ga0070709_10196975 3300005434 Unclassified 1424
82 Ga0070714_100016862 3300005435 Bacteria 5908
83 Ga0070713_100004094 3300005436 Bacteria 9717
84 Ga0070713_100007213 3300005436 Bacteria 7781
85 Ga0070713_100011397 3300005436 Bacteria 6475
86 Ga0070713_100327973 3300005436 Unclassified 1415
87 Ga0070710_10001693 3300005437 Bacteria 10396
88 Ga0070710_10047313 3300005437 Bacteria 2399
89 Ga0070701_10007665 3300005438 Bacteria 4628
90 Ga0070701_10092267 3300005438 Unclassified 1661
91 Ga0070711_100007637 3300005439 Bacteria 6583
92 Ga0070711_100013035 3300005439 Bacteria 5212
93 Ga0070711_100209489 3300005439 Bacteria 1509
94 Ga0070705_100013839 3300005440 Bacteria 4135
95 Ga0070705_100065793 3300005440 Unclassified 2171
96 Ga0070705_100184966 3300005440 Bacteria 1415
97 Ga0070700_100012162 3300005441 Bacteria 4792
98 Ga0070700_100045779 3300005441 Bacteria 2700
99 Ga0070700_100139572 3300005441 Bacteria 1645
100 Ga0070694_100049641 3300005444 Bacteria 2826
101 Ga0070694_100233098 3300005444 Unclassified 1386
102 Ga0070694_100236085 3300005444 Bacteria 1377
103 Ga0070694_100253345 3300005444 Unclassified 1332
104 Ga0070708_100077516 3300005445 Bacteria 3003
105 Ga0070708_100092432 3300005445 Bacteria 2756
106 Ga0070708_100325537 3300005445 Bacteria 1448
107 Ga0070663_100082475 3300005455 Bacteria 2365
108 Ga0070663_100357852 3300005455 Unclassified 1183
109 Ga0070663_100427927 3300005455 Bacteria 1087
110 Ga0070678_100035261 3300005456 Bacteria 3491
111 Ga0070678_100242476 3300005456 Unclassified 1508
112 Ga0070678_100464258 3300005456 Unclassified 1111
113 Ga0070662_100002108 3300005457 Bacteria 12200
114 Ga0070662_100022584 3300005457 Bacteria 4309
115 Ga0070662_100349279 3300005457 Bacteria 1211
116 Ga0070681_10027500 3300005458 Bacteria 5718
117 Ga0070681_10158380 3300005458 Bacteria 2188
118 Ga0070681_10238203 3300005458 Bacteria 1733
119 Ga0068867_100015137 3300005459 Bacteria 5469
120 Ga0070685_10009690 3300005466 Bacteria 4987
121 Ga0070706_100041803 3300005467 Bacteria 4233
122 Ga0070706_100166804 3300005467 Bacteria 2056
123 Ga0070706_100254501 3300005467 Bacteria 1639
124 Ga0070707_100012483 3300005468 Bacteria 7935
125 Ga0070707_100224595 3300005468 Bacteria 1828
126 Ga0070698_100059258 3300005471 Bacteria 3867
127 Ga0070698_100124734 3300005471 Bacteria 2532
128 Ga0070698_100213371 3300005471 Bacteria 1864
129 Ga0070698_100231627 3300005471 Bacteria 1780
130 Ga0070698_100352271 3300005471 Bacteria 1404
131 Ga0070699_100004122 3300005518 Bacteria 12838
132 Ga0070699_100177414 3300005518 Bacteria 1890
133 Ga0070699_100250388 3300005518 Bacteria 1582
134 Ga0070679_100063022 3300005530 Bacteria 3696
135 Ga0070679_100125866 3300005530 Bacteria 2545
136 Ga0070679_100272450 3300005530 Unclassified 1646
137 Ga0070679_100383860 3300005530 Bacteria 1351
138 Ga0070684_100521346 3300005535 Bacteria 1101
139 Ga0070697_100018594 3300005536 Bacteria 5479
140 Ga0070697_100062962 3300005536 Bacteria 3029
141 Ga0070697_100258271 3300005536 Bacteria 1491
142 Ga0068853_100377924 3300005539 Bacteria 1322
143 Ga0070672_100001451 3300005543 Bacteria 14681
144 Ga0070672_100034892 3300005543 Bacteria 3820
145 Ga0070672_100041095 3300005543 Bacteria 3553
146 Ga0070672_100201483 3300005543 Bacteria 1664
147 Ga0070686_100087774 3300005544 Bacteria 2074
148 Ga0070686_100101949 3300005544 Bacteria 1940
149 Ga0070695_100011209 3300005545 Bacteria 5360
150 Ga0070695_100012227 3300005545 Bacteria 5147
151 Ga0070695_100017313 3300005545 Bacteria 4369
152 Ga0070695_100029507 3300005545 Bacteria 3408
153 Ga0070695_100051261 3300005545 Bacteria 2648
154 Ga0070695_100354268 3300005545 Bacteria 1100
155 Ga0070696_100012282 3300005546 Bacteria 5740
156 Ga0070696_100018913 3300005546 Bacteria 4663
157 Ga0070696_100137478 3300005546 Unclassified 1782
158 Ga0070696_100150020 3300005546 Bacteria 1710
159 Ga0070693_100055875 3300005547 Bacteria 2276
160 Ga0070693_100106200 3300005547 Unclassified 1719
161 Ga0070665_100078992 3300005548 Bacteria 3297
162 Ga0070704_100032649 3300005549 Bacteria 3514
163 Ga0070704_100072077 3300005549 Unclassified 2512
164 Ga0070704_100204210 3300005549 Unclassified 1597
165 Ga0068855_100144369 3300005563 Bacteria 2711
166 Ga0070664_100076250 3300005564 Bacteria 2880
167 Ga0070664_100317465 3300005564 Unclassified 1411
168 Ga0070664_100373112 3300005564 Bacteria 1301
169 Ga0070664_100482015 3300005564 Bacteria 1141
170 Ga0068857_100021887 3300005577 Bacteria 5626
171 Ga0068857_100126366 3300005577 Bacteria 2304
172 Ga0068857_100459166 3300005577 Bacteria 1192
173 Ga0068854_100036600 3300005578 Bacteria 3442
174 Ga0068856_100000505 3300005614 Bacteria 43297
175 Ga0070702_100013438 3300005615 Bacteria 4133
176 Ga0070702_100210798 3300005615 Unclassified 1293
177 Ga0068852_100043002 3300005616 Bacteria 3829
178 Ga0068852_100050060 3300005616 Bacteria 3578
179 Ga0068852_100147641 3300005616 Bacteria 2183
180 Ga0068859_100096647 3300005617 Bacteria 3006
181 Ga0068859_100342733 3300005617 Bacteria 1589
182 Ga0068859_100355070 3300005617 Bacteria 1561
183 Ga0068864_100003648 3300005618 Bacteria 12726
184 Ga0068864_100073169 3300005618 Bacteria 2988
185 Ga0068864_100095474 3300005618 Bacteria 2629
186 Ga0068864_100220111 3300005618 Bacteria 1751
187 Ga0068861_100080627 3300005719 Bacteria 2546
188 Ga0068861_100143462 3300005719 Unclassified 1952
189 Ga0068851_10138650 3300005834 Bacteria 1321
190 Ga0068851_10191382 3300005834 Bacteria 1137
191 Ga0068870_10027115 3300005840 Bacteria 2863
192 Ga0068870_10107763 3300005840 Unclassified 1585
193 Ga0068863_100010844 3300005841 Bacteria 8837
194 Ga0068863_100014129 3300005841 Bacteria 7692
195 Ga0068863_100190880 3300005841 Bacteria 1969
196 Ga0068858_100039890 3300005842 Bacteria 4353
197 Ga0068858_100093624 3300005842 Unclassified 2797
198 Ga0068858_100361793 3300005842 Unclassified 1391
199 Ga0068860_100001009 3300005843 Bacteria 31175
200 Ga0068860_100002602 3300005843 Bacteria 18884
201 Ga0068860_100025197 3300005843 Bacteria 5740
202 Ga0068860_100062335 3300005843 Bacteria 3543
203 Ga0068860_100171270 3300005843 Bacteria 2097
204 Ga0068860_100267912 3300005843 Bacteria 1666
205 Ga0068862_100019656 3300005844 Bacteria 5639
206 Ga0068862_100048902 3300005844 Bacteria 3611
207 Ga0068862_100073986 3300005844 Bacteria 2945
208 Ga0068862_100121923 3300005844 Unclassified 2298
209 Ga0068862_100252762 3300005844 Unclassified 1607
210 Ga0068862_100610560 3300005844 Bacteria 1048
211 Ga0081455_10003604 3300005937 Bacteria 17762
212 Ga0081455_10004659 3300005937 Bacteria 15268
213 Ga0081455_10008660 3300005937 Bacteria 10542
214 Ga0081455_10031809 3300005937 Bacteria 4766
215 Ga0081455_10034722 3300005937 Bacteria 4515
216 Ga0081455_10039939 3300005937 Bacteria 4142
217 Ga0081455_10063317 3300005937 Bacteria 3104
218 Ga0081455_10082032 3300005937 Bacteria 2639
219 Ga0081455_10088529 3300005937 Bacteria 2515
220 Ga0081455_10092484 3300005937 Bacteria 2447
221 Ga0081540_1001417 3300005983 Bacteria 20744
222 Ga0081540_1003548 3300005983 Bacteria 12289
223 Ga0081540_1003853 3300005983 Bacteria 11708
224 Ga0081540_1003871 3300005983 Bacteria 11683
225 Ga0081540_1005308 3300005983 Bacteria 9641
226 Ga0081540_1005508 3300005983 Bacteria 9441
227 Ga0081540_1042130 3300005983 Bacteria 2358
228 Ga0081540_1054177 3300005983 Bacteria 1962
229 Ga0081540_1070249 3300005983 Bacteria 1623
230 Ga0081539_10000035 3300005985 Bacteria 302689
231 Ga0081539_10035500 3300005985 Bacteria 2995
232 Ga0070717_10003805 3300006028 Bacteria 10854
233 Ga0070717_10023645 3300006028 Unclassified 4871
234 Ga0070717_10081807 3300006028 Bacteria 2712
235 Ga0070717_10339769 3300006028 Bacteria 1341
236 Ga0075365_10024840 3300006038 Bacteria 3786
237 Ga0075365_10039426 3300006038 Unclassified 3075
238 Ga0070715_10004288 3300006163 Bacteria 4656
239 Ga0070715_10080197 3300006163 Bacteria 1479
240 Ga0070716_100002987 3300006173 Bacteria 7887
241 Ga0070716_100003999 3300006173 Bacteria 7000
242 Ga0070716_100283178 3300006173 Bacteria 1145
243 Ga0070712_100006218 3300006175 Bacteria 7389
244 Ga0070712_100014865 3300006175 Bacteria 5003
245 Ga0070712_100204489 3300006175 Bacteria 1553
246 Ga0075367_10151549 3300006178 Bacteria 1439
247 Ga0075367_10232223 3300006178 Bacteria 1155
248 Ga0075366_10021791 3300006195 Bacteria 3726
249 Ga0097621_100005573 3300006237 Bacteria 8873
250 Ga0075370_10140788 3300006353 Bacteria 1410
251 Ga0068871_100065463 3300006358 Bacteria 2977
252 Ga0068871_100489068 3300006358 Unclassified 1108
253 Ga0075428_100022678 3300006844 Bacteria 6949
254 Ga0075428_100325473 3300006844 Unclassified 1651
255 Ga0075430_100001979 3300006846 Bacteria 16876
256 Ga0075430_100111729 3300006846 Bacteria 2278
257 Ga0075431_100008762 3300006847 Bacteria 10135
258 Ga0075431_100023948 3300006847 Bacteria 6250
259 Ga0075431_100448232 3300006847 Bacteria 1286
260 Ga0075431_100524725 3300006847 Unclassified 1173
261 Ga0075433_10046732 3300006852 Bacteria 3765
262 Ga0075433_10051401 3300006852 Bacteria 3589
263 Ga0075433_10091603 3300006852 Bacteria 2688
264 Ga0075434_100036852 3300006871 Bacteria 4838
265 Ga0075434_100086529 3300006871 Bacteria 3134
266 Ga0075434_100120862 3300006871 Bacteria 2635
267 Ga0075434_100124425 3300006871 Plasmid 2596
268 Ga0075434_100174625 3300006871 Bacteria 2168
269 Ga0075434_100407818 3300006871 Bacteria 1380
270 Ga0075434_100436069 3300006871 Unclassified 1331
271 Ga0075434_100550082 3300006871 Bacteria 1174
272 Ga0075429_100070410 3300006880 Bacteria 3045
273 Ga0075429_100265012 3300006880 Bacteria 1504
274 Ga0075429_100270096 3300006880 Unclassified 1489
275 Ga0068865_100004690 3300006881 Bacteria 8254
276 Ga0068865_100028550 3300006881 Bacteria 3695
277 Ga0068865_100032531 3300006881 Bacteria 3484
278 Ga0068865_100069867 3300006881 Unclassified 2487
279 Ga0068865_100099032 3300006881 Bacteria 2131
280 Ga0068865_100132730 3300006881 Bacteria 1867
281 Ga0075436_100048594 3300006914 Bacteria 2927
282 Ga0075436_100249245 3300006914 Bacteria 1264
283 Ga0097620_100096642 3300006931 Bacteria 3006
284 Ga0097620_100342702 3300006931 Bacteria 1589
285 Ga0097620_100355072 3300006931 Bacteria 1561
286 Ga0075435_100003406 3300007076 Bacteria 10784
287 Ga0075435_100249895 3300007076 Unclassified 1510
288 Ga0075435_100420836 3300007076 Bacteria 1150
289 Ga0099794_10013528 3300007265 Bacteria 3553
290 Ga0099794_10036749 3300007265 Unclassified 2317
291 Ga0099794_10101913 3300007265 Bacteria 1433
292 Ga0099794_10147268 3300007265 Bacteria 1194
293 Ga0099795_10012656 3300007788 Bacteria 2566
294 Ga0099795_10033980 3300007788 Bacteria 1774
295 Ga0099795_10042018 3300007788 Bacteria 1630
296 Ga0105251_10073605 3300009011 Bacteria 1587
297 Ga0105251_10080495 3300009011 Bacteria 1506
298 Ga0105240_10172585 3300009093 Bacteria 2559
299 Ga0105240_10711066 3300009093 Bacteria 1096
300 Ga0111539_10004905 3300009094 Bacteria 17416
301 Ga0111539_10097433 3300009094 Bacteria 3455
302 Ga0111539_10157413 3300009094 Bacteria 2658
303 Ga0111539_10276488 3300009094 Bacteria 1954
304 Ga0111539_10404092 3300009094 Bacteria 1591
305 Ga0111539_10536407 3300009094 Bacteria 1363
306 Ga0105245_10019926 3300009098 Bacteria 5881
307 Ga0105245_10031532 3300009098 Unclassified 4691
308 Ga0105245_10149118 3300009098 Unclassified 2210
309 Ga0105245_10327039 3300009098 Bacteria 1512
310 Ga0105245_10354323 3300009098 Unclassified 1455
311 Ga0114129_10001447 3300009147 Bacteria 32031
312 Ga0114129_10007205 3300009147 Bacteria 15826
313 Ga0114129_10074073 3300009147 Bacteria 4742
314 Ga0114129_10091462 3300009147 Bacteria 4215
315 Ga0114129_10152242 3300009147 Bacteria 3165
316 Ga0114129_10231747 3300009147 Bacteria 2487
317 Ga0114129_10421106 3300009147 Unclassified 1756
318 Ga0114129_10554625 3300009147 Bacteria 1494
319 Ga0105243_10013128 3300009148 Bacteria 6260
320 Ga0105243_10160961 3300009148 Unclassified 1935
321 Ga0105243_10212467 3300009148 Bacteria 1704
322 Ga0105243_10256081 3300009148 Bacteria 1565
323 Ga0105243_10258806 3300009148 Bacteria 1557
324 Ga0105241_10076670 3300009174 Bacteria 2608
325 Ga0105241_10326021 3300009174 Unclassified 1326
326 Ga0105242_10028307 3300009176 Bacteria 4460
327 Ga0105242_10028455 3300009176 Bacteria 4450
328 Ga0105242_10193235 3300009176 Bacteria 1803
329 Ga0105242_10240510 3300009176 Bacteria 1627
330 Ga0105248_10082316 3300009177 Bacteria 3619
331 Ga0105248_10099882 3300009177 Bacteria 3270
332 Ga0105248_10115847 3300009177 Bacteria 3022
333 Ga0105248_10275769 3300009177 Bacteria 1893
334 Ga0105248_10323969 3300009177 Bacteria 1736
335 Ga0105237_10429360 3300009545 Unclassified 1327
336 Ga0105238_10047788 3300009551 Bacteria 4314
337 Ga0105249_10071868 3300009553 Bacteria 3198
338 Ga0105249_10078302 3300009553 Bacteria 3067
339 Ga0105249_10165792 3300009553 Bacteria 2138
340 Ga0105249_10181145 3300009553 Unclassified 2050
341 Ga0105249_10225011 3300009553 Bacteria 1848
342 Ga0105249_10315788 3300009553 Unclassified 1572
343 Ga0099796_10017719 3300010159 Bacteria 2126
344 Ga0105239_10076919 3300010375 Bacteria 3671
345 Ga0105239_10154443 3300010375 Bacteria 2563
346 Ga0105246_10015590 3300011119 Bacteria 4802
347 Ga0105246_10177723 3300011119 Bacteria 1636
348 Ga0105246_10208577 3300011119 Bacteria 1524
349 Ga0157373_10108738 3300013100 Bacteria 1950
350 Ga0157370_10170718 3300013104 Bacteria 2022
351 Ga0157369_10033163 3300013105 Bacteria 5677
352 Ga0157369_10052802 3300013105 Bacteria 4395
353 Ga0157369_10094975 3300013105 Bacteria 3182
354 Ga0157374_10001949 3300013296 Bacteria 17306
355 Ga0157374_10020022 3300013296 Bacteria 5932
356 Ga0157378_10047475 3300013297 Bacteria 3818
357 Ga0157378_10309797 3300013297 Unclassified 1531
358 Ga0157378_10588055 3300013297 Bacteria 1123
359 Ga0163162_10025015 3300013306 Bacteria 5898
360 Ga0163162_10227999 3300013306 Unclassified 1993
361 Ga0163162_10414429 3300013306 Unclassified 1479
362 Ga0163162_10591292 3300013306 Bacteria 1236
363 Ga0157372_10095017 3300013307 Bacteria 3396
364 Ga0157375_10004049 3300013308 Bacteria 12710
365 Ga0157375_10009517 3300013308 Bacteria 8530
366 Ga0157375_10065154 3300013308 Bacteria 3631
367 Ga0157375_10126909 3300013308 Unclassified 2667
368 Ga0157375_10383540 3300013308 Bacteria 1572
369 Ga0157375_10701462 3300013308 Unclassified 1166
370 Ga0163163_10108550 3300014325 Bacteria 2802
371 Ga0163163_10123192 3300014325 Bacteria 2628
372 Ga0157380_10004793 3300014326 Bacteria 9426
373 Ga0157380_10043822 3300014326 Unclassified 3504
374 Ga0157380_10119170 3300014326 Unclassified 2232
375 Ga0157380_10328871 3300014326 Bacteria 1420
376 Ga0157377_10134454 3300014745 Unclassified 1514
377 Ga0157379_10008707 3300014968 Bacteria 8842
378 Ga0157376_10012977 3300014969 Bacteria 6205
379 Ga0157376_10055244 3300014969 Bacteria 3313
380 Ga0157376_10520743 3300014969 Unclassified 1172
381 Ga0163161_10014661 3300017792 Bacteria 5458
382 Ga0163161_10019836 3300017792 Bacteria 4717
383 Ga0163161_10092343 3300017792 Bacteria 2241
384 Ga0163161_10109332 3300017792 Bacteria 2065
385 Ga0163161_10118149 3300017792 Bacteria 1990
386 Ga0163161_10156447 3300017792 Unclassified 1735
387 Ga0207666_1001292 3300025271 Unclassified 2946
388 Ga0207697_10052604 3300025315 Bacteria 1685
389 Ga0207697_10084515 3300025315 Unclassified 1340
390 Ga0207697_10122361 3300025315 Unclassified 1120
391 Ga0207656_10056401 3300025321 Bacteria 1712
392 Ga0207713_1060646 3300025735 Unclassified 1444
393 Ga0207653_10009126 3300025885 Bacteria 3094
394 Ga0207682_10031867 3300025893 Unclassified 2118
395 Ga0207682_10072525 3300025893 Bacteria 1461
396 Ga0207692_10052462 3300025898 Bacteria 2072
397 Ga0207692_10153175 3300025898 Bacteria 1322
398 Ga0207688_10081293 3300025901 Bacteria 1851
399 Ga0207688_10267537 3300025901 Bacteria 1039
400 Ga0207680_10002264 3300025903 Bacteria 8971
401 Ga0207680_10080686 3300025903 Bacteria 2043
402 Ga0207680_10186851 3300025903 Bacteria 1404
403 Ga0207685_10012056 3300025905 Bacteria 2625
404 Ga0207685_10097869 3300025905 Bacteria 1249
405 Ga0207699_10003107 3300025906 Bacteria 7890
406 Ga0207699_10008004 3300025906 Bacteria 5193
407 Ga0207645_10140361 3300025907 Bacteria 1574
408 Ga0207643_10100322 3300025908 Bacteria 1697
409 Ga0207684_10120493 3300025910 Bacteria 2249
410 Ga0207654_10037552 3300025911 Bacteria 2712
411 Ga0207654_10041118 3300025911 Bacteria 2608
412 Ga0207707_10001660 3300025912 Bacteria 20546
413 Ga0207707_10183165 3300025912 Bacteria 1828
414 Ga0207695_10075767 3300025913 Bacteria 3422
415 Ga0207693_10005527 3300025915 Bacteria 10521
416 Ga0207693_10013428 3300025915 Bacteria 6604
417 Ga0207693_10021302 3300025915 Bacteria 5152
418 Ga0207663_10005731 3300025916 Bacteria 6287
419 Ga0207663_10148790 3300025916 Viruses 1640
420 Ga0207663_10186214 3300025916 Unclassified 1487
421 Ga0207660_10086337 3300025917 Unclassified 2317
422 Ga0207660_10375453 3300025917 Bacteria 1142
423 Ga0207662_10099506 3300025918 Bacteria 1800
424 Ga0207662_10198042 3300025918 Bacteria 1299
425 Ga0207657_10260069 3300025919 Unclassified 1381
426 Ga0207649_10138253 3300025920 Bacteria 1663
427 Ga0207652_10005062 3300025921 Bacteria 10693
428 Ga0207652_10010980 3300025921 Bacteria 7302
429 Ga0207652_10137290 3300025921 Bacteria 2184
430 Ga0207646_10004205 3300025922 Bacteria 15761
431 Ga0207646_10374453 3300025922 Bacteria 1286
432 Ga0207681_10000795 3300025923 Bacteria 20798
433 Ga0207681_10142052 3300025923 Bacteria 1789
434 Ga0207681_10191708 3300025923 Bacteria 1564
435 Ga0207681_10270574 3300025923 Bacteria 1333
436 Ga0207650_10004622 3300025925 Bacteria 9415
437 Ga0207650_10068310 3300025925 Bacteria 2668
438 Ga0207650_10326526 3300025925 Bacteria 1258
439 Ga0207659_10000948 3300025926 Bacteria 17347
440 Ga0207659_10002548 3300025926 Bacteria 10844
441 Ga0207687_10113835 3300025927 Bacteria 2013
442 Ga0207687_10214473 3300025927 Bacteria 1512
443 Ga0207687_10232769 3300025927 Unclassified 1456
444 Ga0207700_10004740 3300025928 Bacteria 8067
445 Ga0207700_10007138 3300025928 Bacteria 6808
446 Ga0207700_10271502 3300025928 Bacteria 1456
447 Ga0207664_10054849 3300025929 Bacteria 3160
448 Ga0207644_10004844 3300025931 Bacteria 8761
449 Ga0207644_10234458 3300025931 Bacteria 1459
450 Ga0207644_10371429 3300025931 Bacteria 1165
451 Ga0207644_10423167 3300025931 Bacteria 1091
452 Ga0207690_10109456 3300025932 Bacteria 1988
453 Ga0207690_10303672 3300025932 Unclassified 1250
454 Ga0207706_10032604 3300025933 Bacteria 4639
455 Ga0207706_10097040 3300025933 Bacteria 2592
456 Ga0207706_10233144 3300025933 Bacteria 1610
457 Ga0207706_10350063 3300025933 Bacteria 1285
458 Ga0207706_10460198 3300025933 Bacteria 1100
459 Ga0207686_10152970 3300025934 Bacteria 1608
460 Ga0207709_10001091 3300025935 Bacteria 19875
461 Ga0207709_10005754 3300025935 Bacteria 7003
462 Ga0207709_10168919 3300025935 Bacteria 1533
463 Ga0207709_10244784 3300025935 Unclassified 1306
464 Ga0207670_10069356 3300025936 Bacteria 2432
465 Ga0207670_10163130 3300025936 Unclassified 1665
466 Ga0207669_10007648 3300025937 Bacteria 5017
467 Ga0207669_10148493 3300025937 Bacteria 1638
468 Ga0207669_10340792 3300025937 Bacteria 1154
469 Ga0207704_10001128 3300025938 Bacteria 11880
470 Ga0207704_10010907 3300025938 Bacteria 4454
471 Ga0207704_10407472 3300025938 Viruses 1074
472 Ga0207665_10006574 3300025939 Bacteria 7706
473 Ga0207665_10009026 3300025939 Bacteria 6544
474 Ga0207665_10135407 3300025939 Bacteria 1752
475 Ga0207691_10013364 3300025940 Bacteria 7862
476 Ga0207691_10218553 3300025940 Bacteria 1653
477 Ga0207711_10058312 3300025941 Unclassified 3322
478 Ga0207711_10381047 3300025941 Bacteria 1309
479 Ga0207689_10003512 3300025942 Bacteria 14319
480 Ga0207689_10010277 3300025942 Bacteria 8060
481 Ga0207689_10145039 3300025942 Unclassified 1956
482 Ga0207689_10321468 3300025942 Bacteria 1284
483 Ga0207661_10083039 3300025944 Bacteria 2650
484 Ga0207661_10176991 3300025944 Bacteria 1861
485 Ga0207661_10324583 3300025944 Bacteria 1384
486 Ga0207679_10037948 3300025945 Bacteria 3429
487 Ga0207667_10176097 3300025949 Bacteria 2197
488 Ga0207667_10260023 3300025949 Bacteria 1775
489 Ga0207667_10547317 3300025949 Unclassified 1171
490 Ga0207651_10076453 3300025960 Bacteria 2393
491 Ga0207712_10016858 3300025961 Bacteria 4737
492 Ga0207712_10097888 3300025961 Unclassified 2174
493 Ga0207712_10340988 3300025961 Unclassified 1243
494 Ga0207668_10004719 3300025972 Bacteria 8016
495 Ga0207668_10032927 3300025972 Unclassified 3431
496 Ga0207668_10053532 3300025972 Unclassified 2797
497 Ga0207640_10428741 3300025981 Bacteria 1084
498 Ga0207658_10012149 3300025986 Bacteria 5873
499 Ga0207677_10301278 3300026023 Unclassified 1324
500 Ga0207703_10001999 3300026035 Bacteria 17992
501 Ga0207703_10054709 3300026035 Bacteria 3246
502 Ga0207703_10086686 3300026035 Unclassified 2623
503 Ga0207703_10406195 3300026035 Unclassified 1264
504 Ga0207639_10336171 3300026041 Bacteria 1345
505 Ga0207639_10369809 3300026041 Unclassified 1285
506 Ga0207678_10016458 3300026067 Bacteria 6492
507 Ga0207678_10049297 3300026067 Unclassified 3640
508 Ga0207678_10056436 3300026067 Bacteria 3380
509 Ga0207678_10111875 3300026067 Bacteria 2329
510 Ga0207678_10157876 3300026067 Bacteria 1937
511 Ga0207678_10378623 3300026067 Bacteria 1223
512 Ga0207678_10465606 3300026067 Bacteria 1100
513 Ga0207708_10019266 3300026075 Bacteria 5141
514 Ga0207708_10023082 3300026075 Bacteria 4700
515 Ga0207708_10028708 3300026075 Bacteria 4213
516 Ga0207708_10279879 3300026075 Bacteria 1351
517 Ga0207702_10000127 3300026078 Bacteria 89755
518 Ga0207641_10045615 3300026088 Bacteria 3691
519 Ga0207648_10009156 3300026089 Bacteria 9513
520 Ga0207648_10061272 3300026089 Bacteria 3281
521 Ga0207648_10170018 3300026089 Bacteria 1927
522 Ga0207648_10250302 3300026089 Bacteria 1579
523 Ga0207676_10003243 3300026095 Bacteria 11584
524 Ga0207676_10017788 3300026095 Bacteria 5158
525 Ga0207674_10063659 3300026116 Bacteria 3723
526 Ga0207674_10135721 3300026116 Bacteria 2422
527 Ga0207675_100003386 3300026118 Bacteria 15580
528 Ga0207675_100269059 3300026118 Bacteria 1653
529 Ga0207683_10028153 3300026121 Bacteria 4858
530 Ga0207683_10032475 3300026121 Bacteria 4535
531 Ga0207683_10047450 3300026121 Unclassified 3762
532 Ga0207683_10118671 3300026121 Bacteria 2373
533 Ga0207683_10247313 3300026121 Unclassified 1627
534 Ga0207683_10250745 3300026121 Bacteria 1616
535 Ga0207698_10128016 3300026142 Bacteria 2164
536 Ga0207698_10182198 3300026142 Bacteria 1861
537 Ga0207698_10235814 3300026142 Unclassified 1664
538 Ga0209179_1001895 3300027512 Bacteria 2694
539 Ga0209588_1006064 3300027671 Bacteria 3491
540 Ga0209588_1011526 3300027671 Bacteria 2673
541 Ga0207428_10000664 3300027907 Bacteria 40266
542 Ga0207428_10011295 3300027907 Bacteria 7909
543 Ga0207428_10072712 3300027907 Bacteria 2699
544 Ga0268266_10056339 3300028379 Bacteria 3382
545 Ga0268266_10143361 3300028379 Bacteria 2145
546 Ga0268265_10009944 3300028380 Bacteria 6425
547 Ga0268265_10164502 3300028380 Unclassified 1889
548 Ga0268264_10015732 3300028381 Bacteria 6195
549 Ga0268264_10237528 3300028381 Bacteria 1686
550 Ga0268264_10279028 3300028381 Unclassified 1564
551 Ga0268264_10287305 3300028381 Bacteria 1543
552 Ga0268264_10335335 3300028381 Bacteria 1435
553 Ga0373930_0000082 3300034816 Bacteria 9567
554 Ga0373930_0026003 3300034816 Bacteria 1178
555 Ga0373948_0001083 3300034817 Bacteria 3688
556 Ga0373950_0001391 3300034818 Bacteria 3149
557 Ga0373958_0000241 3300034819 Bacteria 6407
558 Ga0373958_0004533 3300034819 Bacteria 2060
559 Ga0373938_0000222 3300034957 Bacteria 8761
560 Ga0373926_0082663 3300035083 Bacteria 1189
561 Ga0373926_0083062 3300035083 Bacteria 1186
562 Ga0373928_0000048 3300035084 Bacteria 20964
563 Ga0373929_0000056 3300035085 Bacteria 20392
564 Ga0373940_0005577 3300035088 Bacteria 2736
565 Ga0373944_0048510 3300035089 Bacteria 1333
566 Ga0373949_0000558 3300035090 Bacteria 12270
567 Ga0373951_0000521 3300035091 Bacteria 10836
568 Ga0373952_0001750 3300035092 Bacteria 3943
569 Ga0373932_0000755 3300035112 Bacteria 9636
570 Ga0373936_0029667 3300035113 Bacteria 2154
571 Ga0373936_0067083 3300035113 Bacteria 1474
572 Ga0373939_0004609 3300035114 Bacteria 3265
573 Ga0373941_0000282 3300035115 Bacteria 9813
574 Ga0373945_0004304 3300035116 Bacteria 4521
575 Ga0373945_0015155 3300035116 Bacteria 2591
576 Ga0373945_0043946 3300035116 Bacteria 1623
577 Ga0373945_0118288 3300035116 Bacteria 1051
578 Ga0373953_0096980 3300035117 Unclassified 1238
579 Ga0373954_0045877 3300035118 Bacteria 2042
580 Ga0373954_0048756 3300035118 Unclassified 1985
581 Ga0373956_0040326 3300035119 Bacteria 2071
582 Ga0373957_0093902 3300035120 Unclassified 1195
583 Ga0373960_0000021 3300035121 Bacteria 20241
584 Ga0373943_0005050 3300035170 Bacteria 5952
585 Ga0373943_0139124 3300035170 Bacteria 1306
586 Ga0373946_0002290 3300035171 Bacteria 6771
587 Ga0373946_0015782 3300035171 Bacteria 2869
588 Ga0373955_0199689 3300035172 Unclassified 1190
589 Ga0373942_0014196 3300035207 Bacteria 1924
590 Ga0373961_0000771 3300035241 Bacteria 10989
591 Ga0373962_0005559 3300035242 Bacteria 3046
592 Ga0373924_0060706 3300035410 Bacteria 1581
593 Ga0373931_0002703 3300035691 Bacteria 7890
594 Ga0373931_0004981 3300035691 Bacteria 6109
595 Ga0373931_0034068 3300035691 Bacteria 2641
596 Ga0373931_0101817 3300035691 Unclassified 1616
597 Ga0373931_0151310 3300035691 Bacteria 1353
598 Ga0373931_0155416 3300035691 Bacteria 1336
599 Ga0373935_0008332 3300035692 Bacteria 6201
600 Ga0373935_0087091 3300035692 Bacteria 2039
601 Ga0373927_0033954 3300035695 Bacteria 3319
602 Ga0373927_0037073 3300035695 Bacteria 3170
603 Ga0373927_0051061 3300035695 Bacteria 2674
604 Ga0373927_0241098 3300035695 Bacteria 1188
605 Ga0373933_0133956 3300035724 Bacteria 1560
606 Ga0373947_0002200 3300035725 Bacteria 11814
607 Ga0373947_0028788 3300035725 Bacteria 3258
608 Ga0373947_0120157 3300035725 Unclassified 1668
609 Ga0373947_0169144 3300035725 Unclassified 1417
610 Ga0373947_0185441 3300035725 Bacteria 1356
611 Ga0373937_0011015 3300036401 Bacteria 7926
612 Ga0373937_0064505 3300036401 Bacteria 3369
613 Ga0373937_0095017 3300036401 Bacteria 2764
614 Ga0373937_0265136 3300036401 Bacteria 1620
615 Ga0373925_0040668 3300037068 Bacteria 3443
616 Ga0373925_0105396 3300037068 Bacteria 2172
617 Ga0373925_0343858 3300037068 Bacteria 1210
618 Ga0373925_0454077 3300037068 Unclassified 1050
619 Ga0395900_0121610 3300037418 Bacteria 2678
620 Ga0395898_0013732 3300037466 Bacteria 8330
621 Ga0395898_0542424 3300037466 Bacteria 1105
622 Ga0395901_0010282 3300038443 Bacteria 9478
623 Ga0395901_0482758 3300038443 Bacteria 1264
624 Ga0436365_0717194 3300039437 Bacteria 1678
625 Ga0451853_3533905 3300041512 Unclassified 1192
626 Ga0439435_0011590 3300042436 Bacteria 2118
627 Ga0439464_0014471 3300042439 Bacteria 2121
628 Ga0439464_0037235 3300042439 Bacteria 1379
629 Ga0439460_0002108 3300042461 Bacteria 4767
630 Ga0453683_0006221 3300044673 Bacteria 8214
631 Ga0453683_0138771 3300044673 Bacteria 1534
632 Ga0466957_0037879 3300044842 Bacteria 2904
633 Ga0466959_0052653 3300045049 Bacteria 2980
634 Ga0451576_0022529 3300045051 Bacteria 6829
635 Ga0451576_0037628 3300045051 Bacteria 5125
636 Ga0495592_0132334 3300046454 Bacteria 1743
637 Ga0495603_0000092 3300046455 Bacteria 40980
638 Ga0495603_0023861 3300046455 Bacteria 3700
639 Ga0495603_0031574 3300046455 Bacteria 3189
640 Ga0495603_0032639 3300046455 Bacteria 3132
641 Ga0495590_0025471 3300046457 Bacteria 2080
642 Ga0495629_0003950 3300046459 Bacteria 11154
643 Ga0495629_0012730 3300046459 Bacteria 6091
644 Ga0495629_0024398 3300046459 Bacteria 4306
645 Ga0495629_0080953 3300046459 Bacteria 2267
646 Ga0495641_0022828 3300046461 Bacteria 3122
647 Ga0495580_0000120 3300046472 Bacteria 53826
648 Ga0495580_0035859 3300046472 Bacteria 3565
649 Ga0495580_0037749 3300046472 Unclassified 3464
650 Ga0495580_0106766 3300046472 Unclassified 1945
651 Ga0495580_0249154 3300046472 Bacteria 1216
652 Ga0495582_0000039 3300046473 Bacteria 66883
653 Ga0495582_0018429 3300046473 Bacteria 3817
654 Ga0495582_0063386 3300046473 Bacteria 2042
655 Ga0495582_0161613 3300046473 Bacteria 1274
656 Ga0495639_0000441 3300046475 Bacteria 19762
657 Ga0495639_0030313 3300046475 Bacteria 2404
658 Ga0495639_0073595 3300046475 Bacteria 1582
659 Ga0495639_0128400 3300046475 Bacteria 1212
660 Ga0495662_0017280 3300046476 Bacteria 3491
661 Ga0495664_0034746 3300046477 Bacteria 2966
662 Ga0495664_0116488 3300046477 Bacteria 1615
663 Ga0495584_0090494 3300046491 Bacteria 1543
664 Ga0495585_0139498 3300046492 Bacteria 1270
665 Ga0495585_0160009 3300046492 Bacteria 1169
666 Ga0495594_0003605 3300046499 Bacteria 7961
667 Ga0495594_0027843 3300046499 Bacteria 3047
668 Ga0495594_0049195 3300046499 Bacteria 2317
669 Ga0495594_0067361 3300046499 Bacteria 1987
670 Ga0495594_0086514 3300046499 Unclassified 1754
671 Ga0495594_0176603 3300046499 Bacteria 1215
672 Ga0495594_0204337 3300046499 Bacteria 1126
673 Ga0495594_0222700 3300046499 Bacteria 1076
674 Ga0495628_0018365 3300046516 Bacteria 5794
675 Ga0495628_0159905 3300046516 Bacteria 1712
676 Ga0495630_0061837 3300046517 Bacteria 2812
677 Ga0495630_0249703 3300046517 Bacteria 1355
678 Ga0495652_0062235 3300046529 Bacteria 3147
679 Ga0495665_0027711 3300046531 Bacteria 3039
680 Ga0495665_0072971 3300046531 Bacteria 1807
681 Ga0495640_0046816 3300046533 Bacteria 2995
682 Ga0495586_0031683 3300046535 Bacteria 2833
683 Ga0495622_0021018 3300046557 Bacteria 3040
684 Ga0495622_0047519 3300046557 Bacteria 1994
685 Ga0495622_0051816 3300046557 Bacteria 1904
686 Ga0495668_0156764 3300046616 Bacteria 1247
687 Ga0495634_0008568 3300046642 Bacteria 7599
688 Ga0495634_0051946 3300046642 Bacteria 2749
689 Ga0495635_0035409 3300046663 Bacteria 3460
690 Ga0495635_0062837 3300046663 Bacteria 2550
691 Ga0495588_0007162 3300046674 Bacteria 5060
692 Ga0495588_0014118 3300046674 Bacteria 3818
693 Ga0495588_0173604 3300046674 Bacteria 1140
694 Ga0495647_0007938 3300046681 Bacteria 3566
695 Ga0495647_0057195 3300046681 Bacteria 1530
696 Ga0495647_0105087 3300046681 Bacteria 1172
697 Ga0495658_0003032 3300046683 Bacteria 8416
698 Ga0495658_0006358 3300046683 Bacteria 5802
699 Ga0495658_0016616 3300046683 Bacteria 3788
700 Ga0495658_0019548 3300046683 Bacteria 3538
701 Ga0495669_0104033 3300046684 Bacteria 1321
702 Ga0495613_0053585 3300046689 Unclassified 2968
703 Ga0495624_0011119 3300046690 Bacteria 6191
704 Ga0495624_0036884 3300046690 Bacteria 3148
705 Ga0495670_0164115 3300046691 Bacteria 1168
706 Ga0495581_0018347 3300047315 Bacteria 4064
707 Ga0495581_0032014 3300047315 Bacteria 3045
708 Ga0495674_0068044 3300047319 Bacteria 3083
709 Ga0495674_0263645 3300047319 Bacteria 1415
710 Ga0495676_0022963 3300047321 Bacteria 5421
711 Ga0495676_0082840 3300047321 Bacteria 2426
712 Ga0495676_0143638 3300047321 Bacteria 1707
713 Ga0495676_0221283 3300047321 Bacteria 1304
714 Ga0495680_0133694 3300047322 Bacteria 1820
715 Ga0495680_0146941 3300047322 Unclassified 1721
716 Ga0495686_0098569 3300047472 Bacteria 1766
717 Ga0495593_0002416 3300047673 Bacteria 11229
718 Ga0495593_0041300 3300047673 Unclassified 2480
719 Ga0495614_0018224 3300048089 Bacteria 3042
720 Ga0496100_0009979 3300048903 Bacteria 5359
721 Ga0496100_0046567 3300048903 Unclassified 2790
722 Ga0496100_0103865 3300048903 Bacteria 1963
723 Ga0496100_0206613 3300048903 Bacteria 1434
724 Ga0496101_0004178 3300048904 Bacteria 9044
725 Ga0496101_0039623 3300048904 Bacteria 3352
726 Ga0496101_0043583 3300048904 Bacteria 3207
727 Ga0496101_0073963 3300048904 Bacteria 2504
728 Ga0496101_0117328 3300048904 Bacteria 2009
729 Ga0496101_0153956 3300048904 Bacteria 1760
730 Ga0496102_0021943 3300048905 Bacteria 5653
731 Ga0496102_0040849 3300048905 Bacteria 4198
732 Ga0496102_0071149 3300048905 Bacteria 3193
733 Ga0496102_0109817 3300048905 Unclassified 2570
734 Ga0496102_0165310 3300048905 Bacteria 2082
735 Ga0496102_0620121 3300048905 Bacteria 1005
736 Ga0496103_0017950 3300048906 Bacteria 4240
737 Ga0496103_0093415 3300048906 Bacteria 1899
738 Ga0496104_0000220 3300048907 Bacteria 50041
739 Ga0496104_0003887 3300048907 Bacteria 12930
740 Ga0496104_0004734 3300048907 Bacteria 11842
741 Ga0496104_0007480 3300048907 Bacteria 9654
742 Ga0496104_0008349 3300048907 Bacteria 9201
743 Ga0496104_0010878 3300048907 Bacteria 8138
744 Ga0496104_0012907 3300048907 Bacteria 7523
745 Ga0496104_0046618 3300048907 Bacteria 4082
746 Ga0496104_0053745 3300048907 Bacteria 3806
747 Ga0496104_0075970 3300048907 Bacteria 3199
748 Ga0496104_0256665 3300048907 Bacteria 1661
749 Ga0496104_0421894 3300048907 Unclassified 1246
750 Ga0496105_0004150 3300048908 Bacteria 10870
751 Ga0496105_0006955 3300048908 Bacteria 8715
752 Ga0496105_0016540 3300048908 Bacteria 5890
753 Ga0496105_0020393 3300048908 Bacteria 5356
754 Ga0496105_0121836 3300048908 Bacteria 2150
755 Ga0496105_0133563 3300048908 Bacteria 2045
756 Ga0496105_0149728 3300048908 Bacteria 1918
757 Ga0496105_0367608 3300048908 Unclassified 1146
758 Ga0496105_0373245 3300048908 Bacteria 1136
759 Ga0496106_0017445 3300048909 Bacteria 5312
760 Ga0496106_0085006 3300048909 Bacteria 2435
761 Ga0496106_0108375 3300048909 Bacteria 2160
762 Ga0496106_0128664 3300048909 Bacteria 1984
763 Ga0496106_0251702 3300048909 Bacteria 1412
764 Ga0496106_0273233 3300048909 Unclassified 1353
765 Ga0496107_0011412 3300048910 Bacteria 6188
766 Ga0496107_0012044 3300048910 Bacteria 6031
767 Ga0496107_0015801 3300048910 Bacteria 5295
768 Ga0496107_0041209 3300048910 Bacteria 3315
769 Ga0496107_0266313 3300048910 Bacteria 1275
770 Ga0496108_0011929 3300048911 Bacteria 7070
771 Ga0496108_0031311 3300048911 Bacteria 4413
772 Ga0496108_0045049 3300048911 Plasmid 3683
773 Ga0496108_0054146 3300048911 Unclassified 3367
774 Ga0496108_0106508 3300048911 Bacteria 2394
775 Ga0496108_0186850 3300048911 Bacteria 1795
776 Ga0496108_0465102 3300048911 Bacteria 1105
777 Ga0496109_0028866 3300048912 Bacteria 4966
778 Ga0496109_0040542 3300048912 Bacteria 4218
779 Ga0496109_0044904 3300048912 Bacteria 4009
780 Ga0496109_0094894 3300048912 Bacteria 2761
781 Ga0496109_0232837 3300048912 Bacteria 1733
782 Ga0496109_0253200 3300048912 Unclassified 1658
783 Ga0496109_0492716 3300048912 Bacteria 1157
784 Ga0496109_0535515 3300048912 Unclassified 1105
785 Ga0496110_0003153 3300048913 Bacteria 12538
786 Ga0496110_0019053 3300048913 Bacteria 5768
787 Ga0496110_0032469 3300048913 Bacteria 4509
788 Ga0496110_0039560 3300048913 Bacteria 4106
789 Ga0496110_0065499 3300048913 Bacteria 3212
790 Ga0496110_0131805 3300048913 Bacteria 2258
791 Ga0496110_0170830 3300048913 Unclassified 1972
792 Ga0496110_0209791 3300048913 Bacteria 1771
793 Ga0496110_0298015 3300048913 Unclassified 1469
794 Ga0496111_0007249 3300048914 Bacteria 7255
795 Ga0496111_0033542 3300048914 Bacteria 3662
796 Ga0496111_0134173 3300048914 Bacteria 1833
797 Ga0496111_0136910 3300048914 Unclassified 1814
798 Ga0496111_0155948 3300048914 Bacteria 1694
799 Ga0496111_0215348 3300048914 Bacteria 1427
800 Ga0496112_0008064 3300048915 Bacteria 9400
801 Ga0496112_0020083 3300048915 Bacteria 6324
802 Ga0496112_0030287 3300048915 Bacteria 5235
803 Ga0496112_0049135 3300048915 Bacteria 4134
804 Ga0496112_0075854 3300048915 Bacteria 3325
805 Ga0496112_0165021 3300048915 Bacteria 2181
806 Ga0496112_0166453 3300048915 Bacteria 2170
807 Ga0496112_0190692 3300048915 Bacteria 2012
808 Ga0496112_0254599 3300048915 Bacteria 1706
809 Ga0496112_0462512 3300048915 Unclassified 1206
810 Ga0496113_0029631 3300048916 Bacteria 3956
811 Ga0496113_0032558 3300048916 Unclassified 3789
812 Ga0496113_0043101 3300048916 Plasmid 3337
813 Ga0496113_0050085 3300048916 Bacteria 3112
814 Ga0496113_0058782 3300048916 Bacteria 2894
815 Ga0496113_0149378 3300048916 Unclassified 1842
816 Ga0496114_0027018 3300048917 Bacteria 4701
817 Ga0496114_0033103 3300048917 Bacteria 4257
818 Ga0496114_0043578 3300048917 Bacteria 3721
819 Ga0496114_0139501 3300048917 Bacteria 2098
820 Ga0496114_0205618 3300048917 Bacteria 1726
821 Ga0496114_0319677 3300048917 Unclassified 1371
822 Ga0496114_0506075 3300048917 Unclassified 1068
823 Ga0496115_0002974 3300048918 Bacteria 12180
824 Ga0496115_0025751 3300048918 Bacteria 4584
825 Ga0496115_0053058 3300048918 Bacteria 3253
826 Ga0496115_0055835 3300048918 Bacteria 3173
827 Ga0496115_0097583 3300048918 Unclassified 2406
828 Ga0496115_0099223 3300048918 Bacteria 2386
829 Ga0496115_0132194 3300048918 Bacteria 2057
830 Ga0496125_0263707 3300048928 Bacteria 1078
831 Ga0501032_0108400 3300049569 Unclassified 1839
832 Ga0501033_0231081 3300049570 Bacteria 1314
833 Ga0501036_0039309 3300049572 Bacteria 4004
834 Ga0501036_0061575 3300049572 Bacteria 3179
835 Ga0501038_0001763 3300049574 Bacteria 20122
836 Ga0501040_0009053 3300049576 Bacteria 6478
837 Ga0501040_0022067 3300049576 Bacteria 4258
838 Ga0501041_0152971 3300049577 Bacteria 1441
839 Ga0501046_0010851 3300049580 Bacteria 7809
840 Ga0501046_0274874 3300049580 Bacteria 1235
841 Ga0501048_0001087 3300049582 Bacteria 20390
842 Ga0501048_0060186 3300049582 Bacteria 2691
843 Ga0501048_0285421 3300049582 Bacteria 1174
844 Ga0501068_0005846 3300049584 Bacteria 6749
845 Ga0501069_0160933 3300049585 Bacteria 1293
846 Ga0501071_0050022 3300049587 Bacteria 3010
847 Ga0501071_0172749 3300049587 Bacteria 1618
848 Ga0501072_0006517 3300049588 Bacteria 8891
849 Ga0501072_0010608 3300049588 Bacteria 7016
850 Ga0501072_0084127 3300049588 Bacteria 2522
851 Ga0501072_0386669 3300049588 Unclassified 1110
852 Ga0501075_0023006 3300049591 Bacteria 4558
853 Ga0501075_0045600 3300049591 Bacteria 3291
854 Ga0501075_0344453 3300049591 Bacteria 1136
855 Ga0501075_0408781 3300049591 Unclassified 1035
856 Ga0501076_0000166 3300049592 Bacteria 38261
857 Ga0501076_0000941 3300049592 Bacteria 18993
858 Ga0501076_0030156 3300049592 Bacteria 4224
859 Ga0501076_0240845 3300049592 Unclassified 1480
860 Ga0501076_0538091 3300049592 Unclassified 963
861 Ga0501077_0000059 3300049593 Bacteria 55812
862 Ga0501079_0001697 3300049741 Bacteria 15680
863 Ga0501080_0000357 3300049742 Bacteria 35204
864 Ga0501080_0022167 3300049742 Bacteria 5883
865 Ga0501081_0016967 3300049743 Bacteria 4812
866 Ga0501083_0297311 3300049744 Bacteria 1050
867 Ga0501045_0006400 3300049824 Bacteria 8152
868 Ga0501045_0026363 3300049824 Bacteria 4180
869 nmdc:mga0yw44_89662_c1 3300050492 Bacteria 1941
870 nmdc:mga0k408_18287_c1 3300050493 Bacteria 3911
871 nmdc:mga07m45_141959_c1 3300050496 Bacteria 1391
872 nmdc:mga07m45_179417_c1 3300050496 Bacteria 1231
873 nmdc:mga05p37_100784_c1 3300050507 Bacteria 3557
874 nmdc:mga05p37_130378_c1 3300050507 Bacteria 3085
875 nmdc:mga05p37_140194_c1 3300050507 Bacteria 2963
876 nmdc:mga05p37_367185_c1 3300050507 Unclassified 1690
877 nmdc:mga05p37_53636_c1 3300050507 Unclassified 4959
878 nmdc:mga05p37_6539_c1 3300050507 Bacteria 13747
879 nmdc:mga05p37_9213_c1 3300050507 Bacteria 11667
880 nmdc:mga05p37_96170_c1 3300050507 Bacteria 3649
881 nmdc:mga05p37_9798_c1 3300050507 Bacteria 11369
882 nmdc:mga09592_250671_c1 3300050508 Unclassified 1535
883 nmdc:mga09592_265770_c1 3300050508 Unclassified 1488
884 nmdc:mga09592_3912_c1 3300050508 Bacteria 11998
885 nmdc:mga09592_40166_c1 3300050508 Bacteria 3930
886 nmdc:mga09592_45933_c1 3300050508 Unclassified 3678
887 nmdc:mga0qj67_16709_c1 3300050509 Bacteria 5571
888 nmdc:mga0qj67_354073_c1 3300050509 Bacteria 1187
889 nmdc:mga06r32_15651_c1 3300050510 Bacteria 6891
890 nmdc:mga06r32_276146_c1 3300050510 Unclassified 1668
891 nmdc:mga06r32_453457_c1 3300050510 Bacteria 1262
892 nmdc:mga06r32_59509_c1 3300050510 Bacteria 3674
893 nmdc:mga08y16_3102_c1 3300050511 Bacteria 17196
894 nmdc:mga08y16_341406_c1 3300050511 Bacteria 1539
895 nmdc:mga08y16_352603_c1 3300050511 Bacteria 1511
896 nmdc:mga08y16_362972_c1 3300050511 Bacteria 1487
897 nmdc:mga08y16_561165_c1 3300050511 Unclassified 1155
898 nmdc:mga08y16_5778_c1 3300050511 Bacteria 12957
899 nmdc:mga0n895_116446_c1 3300050512 Bacteria 2691
900 nmdc:mga0n895_11965_c1 3300050512 Bacteria 7763
901 nmdc:mga0n895_132992_c1 3300050512 Unclassified 2513
902 nmdc:mga0n895_1477_c1 3300050512 Bacteria 17626
903 nmdc:mga0n895_26132_c1 3300050512 Bacteria 5525
904 nmdc:mga0n895_261734_c1 3300050512 Bacteria 1755
905 nmdc:mga0n895_310990_c1 3300050512 Bacteria 1597
906 nmdc:mga0n895_453175_c1 3300050512 Bacteria 1295
907 nmdc:mga0n895_497188_c1 3300050512 Bacteria 1229
908 nmdc:mga0n895_501953_c1 3300050512 Bacteria 1222
909 nmdc:mga0n895_549369_c1 3300050512 Bacteria 1161
910 nmdc:mga0n895_73171_c1 3300050512 Bacteria 3402
911 nmdc:mga0rr50_283006_c1 3300050513 Unclassified 1384
912 nmdc:mga0rr50_450458_c1 3300050513 Unclassified 1091
913 nmdc:mga0rr50_451599_c1 3300050513 Bacteria 1090
914 nmdc:mga0rr50_51843_c1 3300050513 Bacteria 3046
915 nmdc:mga0rr50_9853_c1 3300050513 Bacteria 6036
916 nmdc:mga08x19_198266_c1 3300050514 Unclassified 1375
917 nmdc:mga08x19_268742_c1 3300050514 Unclassified 1180
918 nmdc:mga0a205_12697_c1 3300050515 Bacteria 7805
919 nmdc:mga0a205_182871_c1 3300050515 Bacteria 1990
920 nmdc:mga0a205_28033_c1 3300050515 Bacteria 5381
921 nmdc:mga0a205_323168_c1 3300050515 Bacteria 1414
922 nmdc:mga0a205_39114_c1 3300050515 Bacteria 4564
923 Ga0495612_0099432 3300053078 Bacteria 1238
924 Ga0495619_0001420 3300053085 Bacteria 15740
925 Ga0495619_0003302 3300053085 Bacteria 10425
926 Ga0495619_0032510 3300053085 Bacteria 3386
927 Ga0495619_0408536 3300053085 Bacteria 937
928 Ga0501082_0003064 3300060353 Bacteria 14587
929 Ga0501082_0004974 3300060353 Bacteria 11604
930 Ga0501082_0339982 3300060353 Bacteria 1308
931 Ga0530510_0000148 3300061734 Bacteria 41757
932 Ga0530510_0000710 3300061734 Bacteria 21611
933 Ga0530510_0165216 3300061734 Bacteria 1638
934 Ga0530510_0178359 3300061734 Bacteria 1575
935 Ga0530510_0303670 3300061734 Bacteria 1195

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100011397 Ga0070713_10001139714 249
2 3300025938 Ga0207704_10407472 Ga0207704_104074722 250
3 3300035725 Ga0373947_0120157 Ga0373947_0120157_20_844 254
4 3300050512 nmdc:mga0n895_73171_c1 nmdc:mga0n895_73171_c1_2332_3183 262
5 3300050514 nmdc:mga08x19_268742_c1 nmdc:mga08x19_268742_c1_11_862 262
6 3300005471 Ga0070698_100213371 Ga0070698_1002133711 265
7 3300047322 Ga0495680_0146941 Ga0495680_0146941_54_875 265
8 3300038443 Ga0395901_0010282 Ga0395901_0010282_127_936 268
9 3300005435 Ga0070714_100016862 Ga0070714_1000168626 271
10 3300005439 Ga0070711_100013035 Ga0070711_1000130356 271
11 3300048928 Ga0496125_0263707 Ga0496125_0263707_104_925 271
12 3300050512 nmdc:mga0n895_497188_c1 nmdc:mga0n895_497188_c1_300_1121 271
13 3300053085 Ga0495619_0408536 Ga0495619_0408536_59_892 276
14 3300005440 Ga0070705_100184966 Ga0070705_1001849662 278
15 3300013306 Ga0163162_10227999 Ga0163162_102279993 278
16 3300048907 Ga0496104_0421894 Ga0496104_0421894_218_1120 278
17 3300048908 Ga0496105_0367608 Ga0496105_0367608_120_1022 278
18 3300050513 nmdc:mga0rr50_283006_c1 nmdc:mga0rr50_283006_c1_231_1133 278
19 3300050515 nmdc:mga0a205_12697_c1 nmdc:mga0a205_12697_c1_2456_3307 278
20 3300013297 Ga0157378_10047475 Ga0157378_100474753 279
21 3300048918 Ga0496115_0099223 Ga0496115_0099223_723_1628 279
22 3300050515 nmdc:mga0a205_182871_c1 nmdc:mga0a205_182871_c1_1052_1969 285
23 3300048904 Ga0496101_0153956 Ga0496101_0153956_94_960 286
24 3300048907 Ga0496104_0007480 Ga0496104_0007480_4147_5013 286
25 3300048911 Ga0496108_0186850 Ga0496108_0186850_861_1727 286
26 3300048915 Ga0496112_0254599 Ga0496112_0254599_26_892 286
27 3300048917 Ga0496114_0205618 Ga0496114_0205618_101_967 286
28 3300046477 Ga0495664_0116488 Ga0495664_0116488_24_953 288
29 3300034816 Ga0373930_0026003 Ga0373930_0026003_198_1139 289
30 3300046499 Ga0495594_0086514 Ga0495594_0086514_449_1387 289
31 3300005468 Ga0070707_100224595 Ga0070707_1002245952 290
32 3300006871 Ga0075434_100120862 Ga0075434_1001208622 290
33 3300048907 Ga0496104_0012907 Ga0496104_0012907_4309_5190 290
34 3300048909 Ga0496106_0251702 Ga0496106_0251702_395_1276 290
35 3300048912 Ga0496109_0492716 Ga0496109_0492716_242_1144 290
36 3300048916 Ga0496113_0029631 Ga0496113_0029631_1636_2517 290
37 3300050512 nmdc:mga0n895_261734_c1 nmdc:mga0n895_261734_c1_453_1451 290
38 3300048907 Ga0496104_0000220 Ga0496104_0000220_44033_44920 291
39 3300048907 Ga0496104_0075970 Ga0496104_0075970_340_1224 291
40 3300048908 Ga0496105_0004150 Ga0496105_0004150_7599_8486 291
41 3300048911 Ga0496108_0031311 Ga0496108_0031311_2778_3662 291
42 3300048912 Ga0496109_0028866 Ga0496109_0028866_1278_2162 291
43 3300048913 Ga0496110_0032469 Ga0496110_0032469_2738_3622 291
44 3300048913 Ga0496110_0298015 Ga0496110_0298015_408_1295 291
45 3300048914 Ga0496111_0033542 Ga0496111_0033542_1294_2178 291
46 3300048915 Ga0496112_0166453 Ga0496112_0166453_778_1662 291
47 3300009147 Ga0114129_10554625 Ga0114129_105546252 293
48 3300035120 Ga0373957_0093902 Ga0373957_0093902_291_1178 293
49 3300037068 Ga0373925_0343858 Ga0373925_0343858_65_952 293
50 3300005937 Ga0081455_10004659 Ga0081455_100046597 297
51 3300009147 Ga0114129_10421106 Ga0114129_104211062 297
52 3300048917 Ga0496114_0506075 Ga0496114_0506075_105_1007 297
53 3300049592 Ga0501076_0538091 Ga0501076_0538091_17_919 297
54 3300050507 nmdc:mga05p37_367185_c1 nmdc:mga05p37_367185_c1_469_1371 297
55 3300037068 Ga0373925_0454077 Ga0373925_0454077_19_990 300
56 3300046459 Ga0495629_0080953 Ga0495629_0080953_1166_2137 300
57 3300046473 Ga0495582_0063386 Ga0495582_0063386_581_1552 300
58 3300046475 Ga0495639_0073595 Ga0495639_0073595_319_1290 300
59 3300046499 Ga0495594_0222700 Ga0495594_0222700_17_988 300
60 3300046517 Ga0495630_0249703 Ga0495630_0249703_264_1235 300
61 3300047315 Ga0495581_0018347 Ga0495581_0018347_2565_3536 300
62 3300047321 Ga0495676_0221283 Ga0495676_0221283_93_1064 300
63 3300046557 Ga0495622_0051816 Ga0495622_0051816_237_1154 301
64 3300046681 Ga0495647_0105087 Ga0495647_0105087_69_1040 301
65 3300005983 Ga0081540_1054177 Ga0081540_10541773 302
66 3300046459 Ga0495629_0024398 Ga0495629_0024398_1922_2896 302
67 3300046473 Ga0495582_0018429 Ga0495582_0018429_1066_2040 302
68 3300046499 Ga0495594_0049195 Ga0495594_0049195_1266_2240 302
69 3300046683 Ga0495658_0019548 Ga0495658_0019548_1275_2249 302
70 3300046684 Ga0495669_0104033 Ga0495669_0104033_37_954 302
71 3300047322 Ga0495680_0133694 Ga0495680_0133694_774_1748 302
72 3300047673 Ga0495593_0041300 Ga0495593_0041300_363_1337 302
73 3300053085 Ga0495619_0001420 Ga0495619_0001420_13356_14330 302
74 3300005355 Ga0070671_100229808 Ga0070671_1002298081 303
75 3300005937 Ga0081455_10031809 Ga0081455_100318094 303
76 3300009148 Ga0105243_10256081 Ga0105243_102560812 303
77 3300009174 Ga0105241_10076670 Ga0105241_100766702 303
78 3300009177 Ga0105248_10115847 Ga0105248_101158472 303
79 3300010375 Ga0105239_10076919 Ga0105239_100769191 303
80 3300025911 Ga0207654_10041118 Ga0207654_100411182 303
81 3300035691 Ga0373931_0002703 Ga0373931_0002703_2943_3929 303
82 3300035695 Ga0373927_0037073 Ga0373927_0037073_316_1302 303
83 3300048904 Ga0496101_0117328 Ga0496101_0117328_338_1324 303
84 3300048905 Ga0496102_0109817 Ga0496102_0109817_76_1062 303
85 3300048906 Ga0496103_0017950 Ga0496103_0017950_1453_2439 303
86 3300048907 Ga0496104_0053745 Ga0496104_0053745_245_1231 303
87 3300048908 Ga0496105_0020393 Ga0496105_0020393_432_1418 303
88 3300048910 Ga0496107_0012044 Ga0496107_0012044_1866_2852 303
89 3300048912 Ga0496109_0040542 Ga0496109_0040542_2995_3981 303
90 3300048913 Ga0496110_0065499 Ga0496110_0065499_1998_2984 303
91 3300048914 Ga0496111_0134173 Ga0496111_0134173_223_1209 303
92 3300048915 Ga0496112_0030287 Ga0496112_0030287_340_1326 303
93 3300048917 Ga0496114_0033103 Ga0496114_0033103_304_1290 303
94 3300003659 JGI25404J52841_10017054 JGI25404J52841_100170542 304
95 3300005439 Ga0070711_100007637 Ga0070711_1000076372 304
96 3300005983 Ga0081540_1003548 Ga0081540_10035485 304
97 3300006846 Ga0075430_100111729 Ga0075430_1001117294 304
98 3300006847 Ga0075431_100524725 Ga0075431_1005247251 304
99 3300006871 Ga0075434_100436069 Ga0075434_1004360692 304
100 3300009094 Ga0111539_10157413 Ga0111539_101574132 304
101 3300009147 Ga0114129_10152242 Ga0114129_101522422 304
102 3300009147 Ga0114129_10231747 Ga0114129_102317473 304
103 3300025916 Ga0207663_10005731 Ga0207663_1000573111 304
104 3300025928 Ga0207700_10007138 Ga0207700_1000713812 304
105 3300027907 Ga0207428_10072712 Ga0207428_100727121 304
106 3300050508 nmdc:mga09592_250671_c1 nmdc:mga09592_250671_c1_216_1190 304
107 3300050509 nmdc:mga0qj67_354073_c1 nmdc:mga0qj67_354073_c1_40_1014 304
108 3300050510 nmdc:mga06r32_276146_c1 nmdc:mga06r32_276146_c1_110_1084 304
109 3300050511 nmdc:mga08y16_341406_c1 nmdc:mga08y16_341406_c1_157_1128 304
110 3300050511 nmdc:mga08y16_561165_c1 nmdc:mga08y16_561165_c1_115_1089 304
111 3300050512 nmdc:mga0n895_116446_c1 nmdc:mga0n895_116446_c1_1636_2610 304
112 3300050513 nmdc:mga0rr50_450458_c1 nmdc:mga0rr50_450458_c1_24_998 304
113 3300003659 JGI25404J52841_10003373 JGI25404J52841_100033731 305
114 3300003659 JGI25404J52841_10017720 JGI25404J52841_100177202 305
115 3300005983 Ga0081540_1003853 Ga0081540_100385316 305
116 3300007076 Ga0075435_100249895 Ga0075435_1002498952 305
117 3300048915 Ga0496112_0165021 Ga0496112_0165021_371_1351 305
118 3300005366 Ga0070659_100296099 Ga0070659_1002960991 306
119 3300005455 Ga0070663_100427927 Ga0070663_1004279271 306
120 3300005458 Ga0070681_10027500 Ga0070681_100275006 306
121 3300005545 Ga0070695_100029507 Ga0070695_1000295071 306
122 3300005546 Ga0070696_100012282 Ga0070696_1000122825 306
123 3300026067 Ga0207678_10049297 Ga0207678_100492972 306
124 3300026067 Ga0207678_10378623 Ga0207678_103786231 306
125 3300026121 Ga0207683_10118671 Ga0207683_101186712 306
126 3300035692 Ga0373935_0087091 Ga0373935_0087091_47_1027 306
127 3300036401 Ga0373937_0064505 Ga0373937_0064505_2043_3026 306
128 3300047321 Ga0495676_0082840 Ga0495676_0082840_36_1028 306
129 3300048903 Ga0496100_0103865 Ga0496100_0103865_421_1413 306
130 3300048905 Ga0496102_0620121 Ga0496102_0620121_46_975 306
131 3300048913 Ga0496110_0131805 Ga0496110_0131805_1212_2204 306
132 3300035083 Ga0373926_0082663 Ga0373926_0082663_30_998 307
133 3300035116 Ga0373945_0004304 Ga0373945_0004304_542_1510 307
134 3300035691 Ga0373931_0151310 Ga0373931_0151310_22_1002 307
135 3300046531 Ga0495665_0072971 Ga0495665_0072971_102_1070 307
136 3300046642 Ga0495634_0051946 Ga0495634_0051946_827_1795 307
137 3300047315 Ga0495581_0032014 Ga0495581_0032014_75_1043 307
138 3300047321 Ga0495676_0143638 Ga0495676_0143638_117_1085 307
139 3300006844 Ga0075428_100325473 Ga0075428_1003254732 308
140 3300006847 Ga0075431_100448232 Ga0075431_1004482321 308
141 3300006880 Ga0075429_100270096 Ga0075429_1002700961 308
142 3300050507 nmdc:mga05p37_140194_c1 nmdc:mga05p37_140194_c1_150_1133 308
143 3300050508 nmdc:mga09592_265770_c1 nmdc:mga09592_265770_c1_227_1210 308
144 3300050510 nmdc:mga06r32_453457_c1 nmdc:mga06r32_453457_c1_185_1168 308
145 3300005330 Ga0070690_100006214 Ga0070690_1000062146 309
146 3300005334 Ga0068869_100036009 Ga0068869_1000360091 309
147 3300005335 Ga0070666_10020373 Ga0070666_100203732 309
148 3300005347 Ga0070668_100013101 Ga0070668_1000131012 309
149 3300005353 Ga0070669_100006176 Ga0070669_10000617610 309
150 3300005354 Ga0070675_100018746 Ga0070675_1000187465 309
151 3300005356 Ga0070674_100002846 Ga0070674_1000028468 309
152 3300005367 Ga0070667_100020939 Ga0070667_1000209394 309
153 3300005441 Ga0070700_100012162 Ga0070700_1000121622 309
154 3300005457 Ga0070662_100002108 Ga0070662_10000210813 309
155 3300005459 Ga0068867_100015137 Ga0068867_1000151375 309
156 3300005543 Ga0070672_100001451 Ga0070672_1000014516 309
157 3300005564 Ga0070664_100373112 Ga0070664_1003731122 309
158 3300005616 Ga0068852_100147641 Ga0068852_1001476412 309
159 3300005617 Ga0068859_100096647 Ga0068859_1000966472 309
160 3300005618 Ga0068864_100073169 Ga0068864_1000731695 309
161 3300005841 Ga0068863_100014129 Ga0068863_1000141297 309
162 3300005843 Ga0068860_100001009 Ga0068860_1000010098 309
163 3300006881 Ga0068865_100004690 Ga0068865_1000046904 309
164 3300006931 Ga0097620_100096642 Ga0097620_1000966422 309
165 3300009098 Ga0105245_10327039 Ga0105245_103270392 309
166 3300009148 Ga0105243_10013128 Ga0105243_100131286 309
167 3300009177 Ga0105248_10082316 Ga0105248_100823162 309
168 3300009553 Ga0105249_10071868 Ga0105249_100718683 309
169 3300017792 Ga0163161_10019836 Ga0163161_100198364 309
170 3300025903 Ga0207680_10002264 Ga0207680_100022648 309
171 3300025923 Ga0207681_10000795 Ga0207681_1000079520 309
172 3300025927 Ga0207687_10113835 Ga0207687_101138352 309
173 3300025933 Ga0207706_10032604 Ga0207706_100326046 309
174 3300025935 Ga0207709_10005754 Ga0207709_100057546 309
175 3300025938 Ga0207704_10010907 Ga0207704_100109074 309
176 3300025940 Ga0207691_10013364 Ga0207691_100133648 309
177 3300025942 Ga0207689_10003512 Ga0207689_100035128 309
178 3300025961 Ga0207712_10016858 Ga0207712_100168583 309
179 3300025986 Ga0207658_10012149 Ga0207658_100121497 309
180 3300026035 Ga0207703_10001999 Ga0207703_1000199914 309
181 3300026075 Ga0207708_10019266 Ga0207708_100192668 309
182 3300026088 Ga0207641_10045615 Ga0207641_100456156 309
183 3300026089 Ga0207648_10009156 Ga0207648_100091568 309
184 3300026095 Ga0207676_10017788 Ga0207676_100177887 309
185 3300026118 Ga0207675_100003386 Ga0207675_10000338616 309
186 3300026142 Ga0207698_10128016 Ga0207698_101280163 309
187 3300028381 Ga0268264_10015732 Ga0268264_100157328 309
188 3300048910 Ga0496107_0266313 Ga0496107_0266313_29_967 309
189 3300050512 nmdc:mga0n895_132992_c1 nmdc:mga0n895_132992_c1_1208_2146 309
190 3300050512 nmdc:mga0n895_453175_c1 nmdc:mga0n895_453175_c1_347_1285 309
191 3300005356 Ga0070674_100096653 Ga0070674_1000966532 311
192 3300009545 Ga0105237_10429360 Ga0105237_104293601 311
193 3300025937 Ga0207669_10340792 Ga0207669_103407921 311
194 3300006880 Ga0075429_100070410 Ga0075429_1000704103 312
195 3300013308 Ga0157375_10009517 Ga0157375_100095174 312
196 3300013308 Ga0157375_10065154 Ga0157375_100651542 312
197 3300014969 Ga0157376_10012977 Ga0157376_100129774 312
198 3300005335 Ga0070666_10016162 Ga0070666_100161623 313
199 3300005355 Ga0070671_100053598 Ga0070671_1000535982 313
200 3300005355 Ga0070671_100387240 Ga0070671_1003872401 313
201 3300005564 Ga0070664_100317465 Ga0070664_1003174652 313
202 3300006358 Ga0068871_100065463 Ga0068871_1000654632 313
203 3300009177 Ga0105248_10323969 Ga0105248_103239691 313
204 3300025903 Ga0207680_10080686 Ga0207680_100806862 313
205 3300025931 Ga0207644_10371429 Ga0207644_103714291 313
206 3300025941 Ga0207711_10381047 Ga0207711_103810472 313
207 3300035083 Ga0373926_0083062 Ga0373926_0083062_147_1097 313
208 3300044673 Ga0453683_0138771 Ga0453683_0138771_574_1515 313
209 3300048912 Ga0496109_0535515 Ga0496109_0535515_94_1077 313
210 3300049574 Ga0501038_0001763 Ga0501038_0001763_4376_5434 313
211 3300049584 Ga0501068_0005846 Ga0501068_0005846_864_1922 313
212 3300049593 Ga0501077_0000059 Ga0501077_0000059_17010_18068 313
213 3300049741 Ga0501079_0001697 Ga0501079_0001697_13368_14426 313
214 3300049824 Ga0501045_0006400 Ga0501045_0006400_210_1268 313
215 3300050493 nmdc:mga0k408_18287_c1 nmdc:mga0k408_18287_c1_558_1508 313
216 3300050496 nmdc:mga07m45_141959_c1 nmdc:mga07m45_141959_c1_216_1166 313
217 3300005983 Ga0081540_1070249 Ga0081540_10702492 314
218 3300035116 Ga0373945_0118288 Ga0373945_0118288_11_1006 314
219 3300035170 Ga0373943_0139124 Ga0373943_0139124_243_1238 314
220 3300035171 Ga0373946_0015782 Ga0373946_0015782_285_1403 314
221 3300035695 Ga0373927_0033954 Ga0373927_0033954_1249_2367 314
222 3300035725 Ga0373947_0002200 Ga0373947_0002200_8207_9325 314
223 3300037068 Ga0373925_0105396 Ga0373925_0105396_1039_2034 314
224 3300046455 Ga0495603_0031574 Ga0495603_0031574_341_1336 314
225 3300046472 Ga0495580_0037749 Ga0495580_0037749_1442_2425 314
226 3300046472 Ga0495580_0106766 Ga0495580_0106766_97_1215 314
227 3300046499 Ga0495594_0027843 Ga0495594_0027843_1378_2496 314
228 3300046557 Ga0495622_0047519 Ga0495622_0047519_530_1513 314
229 3300046674 Ga0495588_0007162 Ga0495588_0007162_2446_3429 314
230 3300046674 Ga0495588_0014118 Ga0495588_0014118_202_1329 314
231 3300046681 Ga0495647_0007938 Ga0495647_0007938_871_1989 314
232 3300046683 Ga0495658_0006358 Ga0495658_0006358_3063_4181 314
233 3300046690 Ga0495624_0036884 Ga0495624_0036884_366_1361 314
234 3300047321 Ga0495676_0022963 Ga0495676_0022963_1199_2317 314
235 3300049572 Ga0501036_0061575 Ga0501036_0061575_1095_2051 314
236 3300049576 Ga0501040_0022067 Ga0501040_0022067_1157_2113 314
237 3300049582 Ga0501048_0060186 Ga0501048_0060186_255_1211 314
238 3300049582 Ga0501048_0285421 Ga0501048_0285421_77_1024 314
239 3300049587 Ga0501071_0050022 Ga0501071_0050022_113_1069 314
240 3300049588 Ga0501072_0084127 Ga0501072_0084127_1005_1961 314
241 3300049592 Ga0501076_0000166 Ga0501076_0000166_29116_30072 314
242 3300049742 Ga0501080_0022167 Ga0501080_0022167_4460_5416 314
243 3300060353 Ga0501082_0004974 Ga0501082_0004974_2150_3106 314
244 3300006038 Ga0075365_10024840 Ga0075365_100248403 315
245 3300006844 Ga0075428_100022678 Ga0075428_1000226787 315
246 3300006847 Ga0075431_100008762 Ga0075431_1000087622 315
247 3300006852 Ga0075433_10091603 Ga0075433_100916032 315
248 3300009147 Ga0114129_10001447 Ga0114129_1000144717 315
249 3300046459 Ga0495629_0012730 Ga0495629_0012730_3181_4158 315
250 3300046472 Ga0495580_0000120 Ga0495580_0000120_27615_28583 315
251 3300046499 Ga0495594_0204337 Ga0495594_0204337_37_1014 315
252 3300046683 Ga0495658_0003032 Ga0495658_0003032_5892_6869 315
253 3300046689 Ga0495613_0053585 Ga0495613_0053585_1548_2525 315
254 3300050507 nmdc:mga05p37_6539_c1 nmdc:mga05p37_6539_c1_2744_3781 315
255 3300050510 nmdc:mga06r32_59509_c1 nmdc:mga06r32_59509_c1_1709_2746 315
256 3300053085 Ga0495619_0003302 Ga0495619_0003302_201_1178 315
257 3300053085 Ga0495619_0032510 Ga0495619_0032510_1780_2748 315
258 3300005331 Ga0070670_100275182 Ga0070670_1002751821 316
259 3300005339 Ga0070660_100286470 Ga0070660_1002864701 316
260 3300005340 Ga0070689_100356806 Ga0070689_1003568061 316
261 3300005355 Ga0070671_100041930 Ga0070671_1000419305 316
262 3300005365 Ga0070688_100052743 Ga0070688_1000527432 316
263 3300005434 Ga0070709_10196975 Ga0070709_101969751 316
264 3300005436 Ga0070713_100004094 Ga0070713_1000040949 316
265 3300005437 Ga0070710_10001693 Ga0070710_100016936 316
266 3300005455 Ga0070663_100082475 Ga0070663_1000824754 316
267 3300005456 Ga0070678_100242476 Ga0070678_1002424761 316
268 3300005466 Ga0070685_10009690 Ga0070685_100096904 316
269 3300005467 Ga0070706_100254501 Ga0070706_1002545012 316
270 3300005564 Ga0070664_100076250 Ga0070664_1000762502 316
271 3300005842 Ga0068858_100039890 Ga0068858_1000398904 316
272 3300006028 Ga0070717_10003805 Ga0070717_100038053 316
273 3300006163 Ga0070715_10080197 Ga0070715_100801972 316
274 3300006173 Ga0070716_100002987 Ga0070716_1000029876 316
275 3300006175 Ga0070712_100006218 Ga0070712_1000062184 316
276 3300006237 Ga0097621_100005573 Ga0097621_1000055732 316
277 3300006881 Ga0068865_100028550 Ga0068865_1000285506 316
278 3300009011 Ga0105251_10073605 Ga0105251_100736052 316
279 3300009176 Ga0105242_10028455 Ga0105242_100284554 316
280 3300009551 Ga0105238_10047788 Ga0105238_100477882 316
281 3300009553 Ga0105249_10315788 Ga0105249_103157881 316
282 3300011119 Ga0105246_10208577 Ga0105246_102085772 316
283 3300017792 Ga0163161_10014661 Ga0163161_100146611 316
284 3300025735 Ga0207713_1060646 Ga0207713_10606461 316
285 3300025905 Ga0207685_10012056 Ga0207685_100120561 316
286 3300025906 Ga0207699_10003107 Ga0207699_100031078 316
287 3300025915 Ga0207693_10005527 Ga0207693_100055274 316
288 3300025928 Ga0207700_10004740 Ga0207700_100047405 316
289 3300025929 Ga0207664_10054849 Ga0207664_100548491 316
290 3300025931 Ga0207644_10004844 Ga0207644_100048448 316
291 3300025936 Ga0207670_10163130 Ga0207670_101631302 316
292 3300025937 Ga0207669_10007648 Ga0207669_100076484 316
293 3300025939 Ga0207665_10009026 Ga0207665_100090265 316
294 3300026035 Ga0207703_10054709 Ga0207703_100547093 316
295 3300026067 Ga0207678_10157876 Ga0207678_101578762 316
296 3300026121 Ga0207683_10247313 Ga0207683_102473131 316
297 3300028379 Ga0268266_10143361 Ga0268266_101433612 316
298 3300046492 Ga0495585_0160009 Ga0495585_0160009_113_1093 316
299 3300048903 Ga0496100_0009979 Ga0496100_0009979_2659_3621 316
300 3300048904 Ga0496101_0039623 Ga0496101_0039623_324_1286 316
301 3300048905 Ga0496102_0021943 Ga0496102_0021943_317_1279 316
302 3300048905 Ga0496102_0071149 Ga0496102_0071149_1405_2367 316
303 3300048907 Ga0496104_0008349 Ga0496104_0008349_444_1406 316
304 3300048908 Ga0496105_0121836 Ga0496105_0121836_375_1337 316
305 3300048909 Ga0496106_0108375 Ga0496106_0108375_887_1849 316
306 3300048910 Ga0496107_0015801 Ga0496107_0015801_882_1844 316
307 3300048911 Ga0496108_0045049 Ga0496108_0045049_834_1796 316
308 3300048913 Ga0496110_0170830 Ga0496110_0170830_437_1399 316
309 3300048914 Ga0496111_0007249 Ga0496111_0007249_150_1112 316
310 3300048916 Ga0496113_0043101 Ga0496113_0043101_1534_2496 316
311 3300048916 Ga0496113_0050085 Ga0496113_0050085_846_1808 316
312 3300048916 Ga0496113_0149378 Ga0496113_0149378_461_1423 316
313 3300048917 Ga0496114_0027018 Ga0496114_0027018_2218_3180 316
314 3300048918 Ga0496115_0053058 Ga0496115_0053058_1405_2367 316
315 3300005328 Ga0070676_10001849 Ga0070676_100018498 317
316 3300005353 Ga0070669_100084415 Ga0070669_1000844152 317
317 3300005355 Ga0070671_100270092 Ga0070671_1002700922 317
318 3300005441 Ga0070700_100045779 Ga0070700_1000457792 317
319 3300005618 Ga0068864_100220111 Ga0068864_1002201112 317
320 3300005844 Ga0068862_100073986 Ga0068862_1000739862 317
321 3300006881 Ga0068865_100032531 Ga0068865_1000325312 317
322 3300014326 Ga0157380_10004793 Ga0157380_100047935 317
323 3300014968 Ga0157379_10008707 Ga0157379_100087078 317
324 3300025931 Ga0207644_10234458 Ga0207644_102344581 317
325 3300026067 Ga0207678_10111875 Ga0207678_101118752 317
326 3300026075 Ga0207708_10028708 Ga0207708_100287083 317
327 3300026121 Ga0207683_10047450 Ga0207683_100474502 317
328 3300028380 Ga0268265_10009944 Ga0268265_100099444 317
329 3300045051 Ga0451576_0037628 Ga0451576_0037628_540_1508 317
330 3300048915 Ga0496112_0462512 Ga0496112_0462512_95_1057 317
331 3300053078 Ga0495612_0099432 Ga0495612_0099432_170_1138 318
332 3300025933 Ga0207706_10097040 Ga0207706_100970401 319
333 3300042439 Ga0439464_0014471 Ga0439464_0014471_477_1451 319
334 3300042461 Ga0439460_0002108 Ga0439460_0002108_1184_2158 319
335 3300046681 Ga0495647_0057195 Ga0495647_0057195_142_1149 319
336 3300048915 Ga0496112_0190692 Ga0496112_0190692_884_1855 319
337 3300049587 Ga0501071_0172749 Ga0501071_0172749_100_1074 319
338 3300049588 Ga0501072_0386669 Ga0501072_0386669_112_1086 319
339 3300049592 Ga0501076_0240845 Ga0501076_0240845_476_1450 319
340 3300061734 Ga0530510_0165216 Ga0530510_0165216_552_1526 319
341 3300005353 Ga0070669_100191631 Ga0070669_1001916311 320
342 3300005536 Ga0070697_100258271 Ga0070697_1002582712 320
343 3300005577 Ga0068857_100459166 Ga0068857_1004591662 320
344 3300005843 Ga0068860_100002602 Ga0068860_1000026022 320
345 3300005985 Ga0081539_10000035 Ga0081539_10000035179 320
346 3300025923 Ga0207681_10191708 Ga0207681_101917082 320
347 3300046516 Ga0495628_0018365 Ga0495628_0018365_2890_3864 320
348 3300049570 Ga0501033_0231081 Ga0501033_0231081_342_1304 320
349 3300049572 Ga0501036_0039309 Ga0501036_0039309_1611_2573 320
350 3300049580 Ga0501046_0274874 Ga0501046_0274874_220_1182 320
351 3300049591 Ga0501075_0408781 Ga0501075_0408781_14_982 320
352 3300049743 Ga0501081_0016967 Ga0501081_0016967_1830_2792 320
353 3300049824 Ga0501045_0026363 Ga0501045_0026363_682_1644 320
354 iso_pu_bacteria 2513237161 2514016786 320
355 3300005347 Ga0070668_100376507 Ga0070668_1003765071 321
356 3300005545 Ga0070695_100011209 Ga0070695_1000112092 321
357 3300005614 Ga0068856_100000505 Ga0068856_10000050513 321
358 3300006871 Ga0075434_100124425 Ga0075434_1001244253 321
359 3300007076 Ga0075435_100003406 Ga0075435_10000340612 321
360 3300009093 Ga0105240_10172585 Ga0105240_101725853 321
361 3300013105 Ga0157369_10052802 Ga0157369_100528021 321
362 3300017792 Ga0163161_10118149 Ga0163161_101181492 321
363 3300025913 Ga0207695_10075767 Ga0207695_100757673 321
364 3300025949 Ga0207667_10260023 Ga0207667_102600233 321
365 3300026078 Ga0207702_10000127 Ga0207702_1000012765 321
366 3300037466 Ga0395898_0542424 Ga0395898_0542424_66_1040 321
367 3300038443 Ga0395901_0482758 Ga0395901_0482758_94_1068 321
368 3300050512 nmdc:mga0n895_26132_c1 nmdc:mga0n895_26132_c1_3824_4804 321
369 3300050513 nmdc:mga0rr50_9853_c1 nmdc:mga0rr50_9853_c1_4852_5832 321
370 3300050514 nmdc:mga08x19_198266_c1 nmdc:mga08x19_198266_c1_179_1159 321
371 3300061734 Ga0530510_0000148 Ga0530510_0000148_6081_7055 321
372 3300003659 JGI25404J52841_10002030 JGI25404J52841_100020303 322
373 3300003659 JGI25404J52841_10006341 JGI25404J52841_100063412 322
374 3300003659 JGI25404J52841_10013652 JGI25404J52841_100136522 322
375 3300005329 Ga0070683_100089278 Ga0070683_1000892782 322
376 3300005330 Ga0070690_100339058 Ga0070690_1003390581 322
377 3300005334 Ga0068869_100287551 Ga0068869_1002875511 322
378 3300005337 Ga0070682_100073320 Ga0070682_1000733202 322
379 3300005338 Ga0068868_100057759 Ga0068868_1000577594 322
380 3300005366 Ga0070659_100327627 Ga0070659_1003276271 322
381 3300005444 Ga0070694_100236085 Ga0070694_1002360851 322
382 3300005456 Ga0070678_100035261 Ga0070678_1000352612 322
383 3300005458 Ga0070681_10158380 Ga0070681_101583802 322
384 3300005530 Ga0070679_100063022 Ga0070679_1000630221 322
385 3300005548 Ga0070665_100078992 Ga0070665_1000789924 322
386 3300005616 Ga0068852_100050060 Ga0068852_1000500603 322
387 3300005842 Ga0068858_100093624 Ga0068858_1000936243 322
388 3300005842 Ga0068858_100361793 Ga0068858_1003617932 322
389 3300005937 Ga0081455_10082032 Ga0081455_100820321 322
390 3300005983 Ga0081540_1003871 Ga0081540_10038715 322
391 3300005983 Ga0081540_1005308 Ga0081540_10053087 322
392 3300005983 Ga0081540_1005508 Ga0081540_10055088 322
393 3300006178 Ga0075367_10232223 Ga0075367_102322231 322
394 3300006195 Ga0075366_10021791 Ga0075366_100217914 322
395 3300006353 Ga0075370_10140788 Ga0075370_101407881 322
396 3300006358 Ga0068871_100489068 Ga0068871_1004890681 322
397 3300006871 Ga0075434_100174625 Ga0075434_1001746251 322
398 3300006881 Ga0068865_100069867 Ga0068865_1000698671 322
399 3300006881 Ga0068865_100099032 Ga0068865_1000990321 322
400 3300007265 Ga0099794_10036749 Ga0099794_100367494 322
401 3300007265 Ga0099794_10101913 Ga0099794_101019131 322
402 3300009094 Ga0111539_10276488 Ga0111539_102764883 322
403 3300009098 Ga0105245_10019926 Ga0105245_100199263 322
404 3300009147 Ga0114129_10074073 Ga0114129_100740734 322
405 3300009176 Ga0105242_10028307 Ga0105242_100283075 322
406 3300009177 Ga0105248_10099882 Ga0105248_100998821 322
407 3300011119 Ga0105246_10015590 Ga0105246_100155902 322
408 3300013296 Ga0157374_10001949 Ga0157374_100019493 322
409 3300013297 Ga0157378_10309797 Ga0157378_103097971 322
410 3300013308 Ga0157375_10004049 Ga0157375_100040492 322
411 3300014325 Ga0163163_10123192 Ga0163163_101231921 322
412 3300014745 Ga0157377_10134454 Ga0157377_101344542 322
413 3300014969 Ga0157376_10055244 Ga0157376_100552441 322
414 3300017792 Ga0163161_10092343 Ga0163161_100923432 322
415 3300025315 Ga0207697_10084515 Ga0207697_100845152 322
416 3300025315 Ga0207697_10122361 Ga0207697_101223611 322
417 3300025901 Ga0207688_10081293 Ga0207688_100812932 322
418 3300025912 Ga0207707_10001660 Ga0207707_1000166010 322
419 3300025916 Ga0207663_10186214 Ga0207663_101862141 322
420 3300025919 Ga0207657_10260069 Ga0207657_102600691 322
421 3300025921 Ga0207652_10010980 Ga0207652_100109802 322
422 3300025927 Ga0207687_10214473 Ga0207687_102144731 322
423 3300025932 Ga0207690_10303672 Ga0207690_103036721 322
424 3300025939 Ga0207665_10135407 Ga0207665_101354073 322
425 3300025941 Ga0207711_10058312 Ga0207711_100583122 322
426 3300025942 Ga0207689_10321468 Ga0207689_103214681 322
427 3300025944 Ga0207661_10083039 Ga0207661_100830392 322
428 3300025949 Ga0207667_10547317 Ga0207667_105473171 322
429 3300026023 Ga0207677_10301278 Ga0207677_103012781 322
430 3300026035 Ga0207703_10086686 Ga0207703_100866862 322
431 3300026035 Ga0207703_10406195 Ga0207703_104061951 322
432 3300026041 Ga0207639_10336171 Ga0207639_103361712 322
433 3300026041 Ga0207639_10369809 Ga0207639_103698091 322
434 3300026067 Ga0207678_10056436 Ga0207678_100564364 322
435 3300026121 Ga0207683_10028153 Ga0207683_100281533 322
436 3300026121 Ga0207683_10032475 Ga0207683_100324754 322
437 3300026142 Ga0207698_10235814 Ga0207698_102358142 322
438 3300027671 Ga0209588_1011526 Ga0209588_10115261 322
439 3300028379 Ga0268266_10056339 Ga0268266_100563392 322
440 3300035089 Ga0373944_0048510 Ga0373944_0048510_125_1105 322
441 3300035113 Ga0373936_0029667 Ga0373936_0029667_720_1700 322
442 3300035113 Ga0373936_0067083 Ga0373936_0067083_155_1135 322
443 3300035116 Ga0373945_0015155 Ga0373945_0015155_175_1155 322
444 3300035117 Ga0373953_0096980 Ga0373953_0096980_42_1022 322
445 3300035118 Ga0373954_0045877 Ga0373954_0045877_412_1392 322
446 3300035118 Ga0373954_0048756 Ga0373954_0048756_865_1845 322
447 3300035171 Ga0373946_0002290 Ga0373946_0002290_3694_4674 322
448 3300035172 Ga0373955_0199689 Ga0373955_0199689_62_1042 322
449 3300035410 Ga0373924_0060706 Ga0373924_0060706_125_1105 322
450 3300035691 Ga0373931_0004981 Ga0373931_0004981_4381_5361 322
451 3300035692 Ga0373935_0008332 Ga0373935_0008332_132_1112 322
452 3300035695 Ga0373927_0051061 Ga0373927_0051061_330_1310 322
453 3300035725 Ga0373947_0028788 Ga0373947_0028788_194_1174 322
454 3300035725 Ga0373947_0169144 Ga0373947_0169144_353_1333 322
455 3300036401 Ga0373937_0095017 Ga0373937_0095017_822_1802 322
456 3300036401 Ga0373937_0265136 Ga0373937_0265136_168_1148 322
457 3300037068 Ga0373925_0040668 Ga0373925_0040668_129_1109 322
458 3300041512 Ga0451853_3533905 Ga0451853_3533905_129_1109 322
459 3300042439 Ga0439464_0037235 Ga0439464_0037235_99_1076 322
460 3300046454 Ga0495592_0132334 Ga0495592_0132334_127_1107 322
461 3300046455 Ga0495603_0000092 Ga0495603_0000092_39833_40813 322
462 3300046455 Ga0495603_0032639 Ga0495603_0032639_1103_2083 322
463 3300046459 Ga0495629_0003950 Ga0495629_0003950_10007_10987 322
464 3300046461 Ga0495641_0022828 Ga0495641_0022828_168_1148 322
465 3300046472 Ga0495580_0035859 Ga0495580_0035859_193_1173 322
466 3300046472 Ga0495580_0249154 Ga0495580_0249154_151_1131 322
467 3300046473 Ga0495582_0000039 Ga0495582_0000039_63668_64648 322
468 3300046475 Ga0495639_0000441 Ga0495639_0000441_786_1766 322
469 3300046476 Ga0495662_0017280 Ga0495662_0017280_2389_3369 322
470 3300046477 Ga0495664_0034746 Ga0495664_0034746_159_1139 322
471 3300046491 Ga0495584_0090494 Ga0495584_0090494_171_1151 322
472 3300046492 Ga0495585_0139498 Ga0495585_0139498_197_1177 322
473 3300046499 Ga0495594_0003605 Ga0495594_0003605_6802_7782 322
474 3300046516 Ga0495628_0159905 Ga0495628_0159905_565_1545 322
475 3300046517 Ga0495630_0061837 Ga0495630_0061837_165_1145 322
476 3300046529 Ga0495652_0062235 Ga0495652_0062235_1981_2961 322
477 3300046531 Ga0495665_0027711 Ga0495665_0027711_1915_2895 322
478 3300046533 Ga0495640_0046816 Ga0495640_0046816_1848_2828 322
479 3300046557 Ga0495622_0021018 Ga0495622_0021018_1894_2874 322
480 3300046642 Ga0495634_0008568 Ga0495634_0008568_196_1176 322
481 3300046663 Ga0495635_0035409 Ga0495635_0035409_183_1163 322
482 3300046663 Ga0495635_0062837 Ga0495635_0062837_10_990 322
483 3300046683 Ga0495658_0016616 Ga0495658_0016616_2317_3297 322
484 3300046690 Ga0495624_0011119 Ga0495624_0011119_4440_5420 322
485 3300046691 Ga0495670_0164115 Ga0495670_0164115_101_1081 322
486 3300047319 Ga0495674_0068044 Ga0495674_0068044_1908_2888 322
487 3300047319 Ga0495674_0263645 Ga0495674_0263645_219_1199 322
488 3300047472 Ga0495686_0098569 Ga0495686_0098569_263_1243 322
489 3300047673 Ga0495593_0002416 Ga0495593_0002416_172_1152 322
490 3300048089 Ga0495614_0018224 Ga0495614_0018224_184_1164 322
491 3300048903 Ga0496100_0046567 Ga0496100_0046567_1147_2127 322
492 3300048904 Ga0496101_0043583 Ga0496101_0043583_85_1065 322
493 3300048904 Ga0496101_0073963 Ga0496101_0073963_703_1683 322
494 3300048905 Ga0496102_0040849 Ga0496102_0040849_1614_2594 322
495 3300048905 Ga0496102_0165310 Ga0496102_0165310_119_1099 322
496 3300048907 Ga0496104_0010878 Ga0496104_0010878_2644_3624 322
497 3300048908 Ga0496105_0006955 Ga0496105_0006955_556_1536 322
498 3300048908 Ga0496105_0149728 Ga0496105_0149728_57_1037 322
499 3300048909 Ga0496106_0017445 Ga0496106_0017445_3958_4938 322
500 3300048909 Ga0496106_0273233 Ga0496106_0273233_122_1102 322
501 3300048910 Ga0496107_0011412 Ga0496107_0011412_4392_5372 322
502 3300048911 Ga0496108_0011929 Ga0496108_0011929_3624_4604 322
503 3300048911 Ga0496108_0106508 Ga0496108_0106508_1394_2374 322
504 3300048912 Ga0496109_0044904 Ga0496109_0044904_2364_3344 322
505 3300048912 Ga0496109_0253200 Ga0496109_0253200_464_1444 322
506 3300048913 Ga0496110_0019053 Ga0496110_0019053_3904_4884 322
507 3300048913 Ga0496110_0039560 Ga0496110_0039560_2190_3170 322
508 3300048913 Ga0496110_0209791 Ga0496110_0209791_468_1448 322
509 3300048914 Ga0496111_0136910 Ga0496111_0136910_203_1183 322
510 3300048915 Ga0496112_0049135 Ga0496112_0049135_817_1797 322
511 3300048916 Ga0496113_0058782 Ga0496113_0058782_995_1975 322
512 3300048917 Ga0496114_0319677 Ga0496114_0319677_370_1350 322
513 3300048918 Ga0496115_0002974 Ga0496115_0002974_8516_9496 322
514 3300048918 Ga0496115_0097583 Ga0496115_0097583_1267_2247 322
515 3300049744 Ga0501083_0297311 Ga0501083_0297311_12_992 322
516 3300050507 nmdc:mga05p37_100784_c1 nmdc:mga05p37_100784_c1_186_1157 322
517 3300050511 nmdc:mga08y16_352603_c1 nmdc:mga08y16_352603_c1_507_1490 322
518 3300005347 Ga0070668_100032930 Ga0070668_1000329304 323
519 3300005347 Ga0070668_100033845 Ga0070668_1000338452 323
520 3300005549 Ga0070704_100204210 Ga0070704_1002042102 323
521 3300005719 Ga0068861_100143462 Ga0068861_1001434622 323
522 3300005841 Ga0068863_100190880 Ga0068863_1001908802 323
523 3300005843 Ga0068860_100025197 Ga0068860_1000251976 323
524 3300005844 Ga0068862_100121923 Ga0068862_1001219232 323
525 3300005937 Ga0081455_10003604 Ga0081455_1000360427 323
526 3300005937 Ga0081455_10008660 Ga0081455_1000866011 323
527 3300005937 Ga0081455_10034722 Ga0081455_100347225 323
528 3300006038 Ga0075365_10039426 Ga0075365_100394262 323
529 3300006914 Ga0075436_100249245 Ga0075436_1002492452 323
530 3300007265 Ga0099794_10013528 Ga0099794_100135281 323
531 3300007788 Ga0099795_10033980 Ga0099795_100339802 323
532 3300013308 Ga0157375_10126909 Ga0157375_101269093 323
533 3300014326 Ga0157380_10119170 Ga0157380_101191702 323
534 3300025898 Ga0207692_10153175 Ga0207692_101531751 323
535 3300025923 Ga0207681_10142052 Ga0207681_101420521 323
536 3300025925 Ga0207650_10068310 Ga0207650_100683102 323
537 3300025972 Ga0207668_10004719 Ga0207668_100047194 323
538 3300025972 Ga0207668_10032927 Ga0207668_100329272 323
539 3300027671 Ga0209588_1006064 Ga0209588_10060643 323
540 3300035170 Ga0373943_0005050 Ga0373943_0005050_2747_3730 323
541 3300035724 Ga0373933_0133956 Ga0373933_0133956_69_1274 323
542 3300044673 Ga0453683_0006221 Ga0453683_0006221_324_1295 323
543 3300046616 Ga0495668_0156764 Ga0495668_0156764_125_1105 323
544 3300048903 Ga0496100_0206613 Ga0496100_0206613_87_1085 323
545 3300048912 Ga0496109_0232837 Ga0496109_0232837_425_1405 323
546 3300048915 Ga0496112_0075854 Ga0496112_0075854_1451_2431 323
547 3300048917 Ga0496114_0139501 Ga0496114_0139501_660_1640 323
548 3300050492 nmdc:mga0yw44_89662_c1 nmdc:mga0yw44_89662_c1_410_1399 323
549 3300061734 Ga0530510_0303670 Ga0530510_0303670_13_993 323
550 3300005334 Ga0068869_100014742 Ga0068869_1000147427 324
551 3300005344 Ga0070661_100014451 Ga0070661_1000144517 324
552 3300005364 Ga0070673_100032047 Ga0070673_1000320477 324
553 3300005434 Ga0070709_10023079 Ga0070709_100230793 324
554 3300005436 Ga0070713_100007213 Ga0070713_1000072137 324
555 3300005436 Ga0070713_100327973 Ga0070713_1003279731 324
556 3300005437 Ga0070710_10047313 Ga0070710_100473133 324
557 3300005439 Ga0070711_100209489 Ga0070711_1002094892 324
558 3300005444 Ga0070694_100253345 Ga0070694_1002533451 324
559 3300005445 Ga0070708_100092432 Ga0070708_1000924322 324
560 3300005467 Ga0070706_100166804 Ga0070706_1001668042 324
561 3300005471 Ga0070698_100059258 Ga0070698_1000592583 324
562 3300005471 Ga0070698_100352271 Ga0070698_1003522712 324
563 3300005518 Ga0070699_100177414 Ga0070699_1001774142 324
564 3300005530 Ga0070679_100125866 Ga0070679_1001258662 324
565 3300005543 Ga0070672_100034892 Ga0070672_1000348923 324
566 3300005545 Ga0070695_100012227 Ga0070695_1000122274 324
567 3300005547 Ga0070693_100106200 Ga0070693_1001062001 324
568 3300005549 Ga0070704_100032649 Ga0070704_1000326493 324
569 3300005834 Ga0068851_10191382 Ga0068851_101913821 324
570 3300005844 Ga0068862_100019656 Ga0068862_1000196566 324
571 3300005937 Ga0081455_10039939 Ga0081455_100399393 324
572 3300005937 Ga0081455_10088529 Ga0081455_100885292 324
573 3300005937 Ga0081455_10092484 Ga0081455_100924842 324
574 3300005983 Ga0081540_1001417 Ga0081540_10014178 324
575 3300005983 Ga0081540_1042130 Ga0081540_10421301 324
576 3300006028 Ga0070717_10023645 Ga0070717_100236455 324
577 3300006028 Ga0070717_10339769 Ga0070717_103397691 324
578 3300006163 Ga0070715_10004288 Ga0070715_100042884 324
579 3300006173 Ga0070716_100003999 Ga0070716_1000039992 324
580 3300006175 Ga0070712_100204489 Ga0070712_1002044892 324
581 3300006847 Ga0075431_100023948 Ga0075431_1000239485 324
582 3300006852 Ga0075433_10046732 Ga0075433_100467326 324
583 3300006871 Ga0075434_100036852 Ga0075434_1000368527 324
584 3300006880 Ga0075429_100265012 Ga0075429_1002650122 324
585 3300006914 Ga0075436_100048594 Ga0075436_1000485943 324
586 3300007265 Ga0099794_10147268 Ga0099794_101472681 324
587 3300007788 Ga0099795_10012656 Ga0099795_100126562 324
588 3300007788 Ga0099795_10042018 Ga0099795_100420182 324
589 3300009094 Ga0111539_10536407 Ga0111539_105364071 324
590 3300009098 Ga0105245_10031532 Ga0105245_100315322 324
591 3300009147 Ga0114129_10007205 Ga0114129_1000720513 324
592 3300009147 Ga0114129_10091462 Ga0114129_100914622 324
593 3300009553 Ga0105249_10181145 Ga0105249_101811451 324
594 3300010159 Ga0099796_10017719 Ga0099796_100177192 324
595 3300013105 Ga0157369_10033163 Ga0157369_100331634 324
596 3300025898 Ga0207692_10052462 Ga0207692_100524621 324
597 3300025905 Ga0207685_10097869 Ga0207685_100978691 324
598 3300025906 Ga0207699_10008004 Ga0207699_100080043 324
599 3300025915 Ga0207693_10013428 Ga0207693_100134283 324
600 3300025916 Ga0207663_10148790 Ga0207663_101487901 324
601 3300025921 Ga0207652_10137290 Ga0207652_101372902 324
602 3300025928 Ga0207700_10271502 Ga0207700_102715021 324
603 3300025935 Ga0207709_10244784 Ga0207709_102447841 324
604 3300025939 Ga0207665_10006574 Ga0207665_100065744 324
605 3300025942 Ga0207689_10010277 Ga0207689_100102777 324
606 3300025944 Ga0207661_10176991 Ga0207661_101769912 324
607 3300025961 Ga0207712_10097888 Ga0207712_100978882 324
608 3300027512 Ga0209179_1001895 Ga0209179_10018952 324
609 3300035116 Ga0373945_0043946 Ga0373945_0043946_352_1338 324
610 3300035119 Ga0373956_0040326 Ga0373956_0040326_851_1834 324
611 3300036401 Ga0373937_0011015 Ga0373937_0011015_6370_7368 324
612 3300042436 Ga0439435_0011590 Ga0439435_0011590_141_1118 324
613 3300046455 Ga0495603_0023861 Ga0495603_0023861_2544_3527 324
614 3300046457 Ga0495590_0025471 Ga0495590_0025471_1034_2029 324
615 3300046473 Ga0495582_0161613 Ga0495582_0161613_172_1155 324
616 3300046475 Ga0495639_0030313 Ga0495639_0030313_407_1390 324
617 3300046499 Ga0495594_0067361 Ga0495594_0067361_573_1556 324
618 3300048907 Ga0496104_0003887 Ga0496104_0003887_9688_10740 324
619 3300048907 Ga0496104_0004734 Ga0496104_0004734_3142_4134 324
620 3300048907 Ga0496104_0256665 Ga0496104_0256665_390_1367 324
621 3300048908 Ga0496105_0016540 Ga0496105_0016540_2691_3743 324
622 3300048908 Ga0496105_0133563 Ga0496105_0133563_267_1250 324
623 3300048911 Ga0496108_0054146 Ga0496108_0054146_10_1062 324
624 3300048912 Ga0496109_0094894 Ga0496109_0094894_307_1290 324
625 3300048913 Ga0496110_0003153 Ga0496110_0003153_140_1123 324
626 3300048914 Ga0496111_0215348 Ga0496111_0215348_136_1119 324
627 3300048915 Ga0496112_0020083 Ga0496112_0020083_1451_2434 324
628 3300048916 Ga0496113_0032558 Ga0496113_0032558_1747_2730 324
629 3300048918 Ga0496115_0025751 Ga0496115_0025751_30_1022 324
630 3300048918 Ga0496115_0055835 Ga0496115_0055835_708_1760 324
631 3300049585 Ga0501069_0160933 Ga0501069_0160933_275_1267 324
632 3300050507 nmdc:mga05p37_9213_c1 nmdc:mga05p37_9213_c1_7591_8583 324
633 3300050507 nmdc:mga05p37_96170_c1 nmdc:mga05p37_96170_c1_1639_2634 324
634 3300050507 nmdc:mga05p37_9798_c1 nmdc:mga05p37_9798_c1_8478_9461 324
635 3300050508 nmdc:mga09592_40166_c1 nmdc:mga09592_40166_c1_1214_2209 324
636 3300050508 nmdc:mga09592_45933_c1 nmdc:mga09592_45933_c1_312_1304 324
637 3300050510 nmdc:mga06r32_15651_c1 nmdc:mga06r32_15651_c1_5794_6789 324
638 3300050511 nmdc:mga08y16_362972_c1 nmdc:mga08y16_362972_c1_333_1328 324
639 3300050512 nmdc:mga0n895_11965_c1 nmdc:mga0n895_11965_c1_118_1113 324
640 3300050513 nmdc:mga0rr50_51843_c1 nmdc:mga0rr50_51843_c1_1201_2196 324
641 3300050515 nmdc:mga0a205_28033_c1 nmdc:mga0a205_28033_c1_1294_2289 324
642 3300061734 Ga0530510_0178359 Ga0530510_0178359_88_1071 324
643 iso_pu_bacteria 2838122688 2838128593 324
644 iso_pu_bacteria 2841983080 2841984466 324
645 3300005336 Ga0070680_100187568 Ga0070680_1001875681 325
646 3300005345 Ga0070692_10139631 Ga0070692_101396312 325
647 3300005366 Ga0070659_100294410 Ga0070659_1002944102 325
648 3300005440 Ga0070705_100013839 Ga0070705_1000138394 325
649 3300005530 Ga0070679_100383860 Ga0070679_1003838601 325
650 3300005546 Ga0070696_100018913 Ga0070696_1000189137 325
651 3300005549 Ga0070704_100072077 Ga0070704_1000720773 325
652 3300005937 Ga0081455_10063317 Ga0081455_100633173 325
653 3300005985 Ga0081539_10035500 Ga0081539_100355002 325
654 3300006028 Ga0070717_10081807 Ga0070717_100818072 325
655 3300006175 Ga0070712_100014865 Ga0070712_1000148654 325
656 3300006871 Ga0075434_100407818 Ga0075434_1004078182 325
657 3300006871 Ga0075434_100550082 Ga0075434_1005500821 325
658 3300007076 Ga0075435_100420836 Ga0075435_1004208361 325
659 3300009094 Ga0111539_10157413 Ga0111539_101574133 325
660 3300009094 Ga0111539_10404092 Ga0111539_104040922 325
661 3300009147 Ga0114129_10152242 Ga0114129_101522421 325
662 3300013104 Ga0157370_10170718 Ga0157370_101707182 325
663 3300013105 Ga0157369_10094975 Ga0157369_100949753 325
664 3300013307 Ga0157372_10095017 Ga0157372_100950171 325
665 3300025915 Ga0207693_10021302 Ga0207693_100213022 325
666 3300025921 Ga0207652_10005062 Ga0207652_100050623 325
667 3300025922 Ga0207646_10374453 Ga0207646_103744532 325
668 3300025949 Ga0207667_10176097 Ga0207667_101760971 325
669 3300035691 Ga0373931_0155416 Ga0373931_0155416_81_1058 325
670 3300035695 Ga0373927_0241098 Ga0373927_0241098_126_1118 325
671 3300037418 Ga0395900_0121610 Ga0395900_0121610_1664_2647 325
672 3300037466 Ga0395898_0013732 Ga0395898_0013732_6252_7235 325
673 3300048907 Ga0496104_0046618 Ga0496104_0046618_2623_3606 325
674 3300050507 nmdc:mga05p37_53636_c1 nmdc:mga05p37_53636_c1_2350_3345 325
675 3300050512 nmdc:mga0n895_501953_c1 nmdc:mga0n895_501953_c1_95_1078 325
676 3300050512 nmdc:mga0n895_549369_c1 nmdc:mga0n895_549369_c1_76_1053 325
677 3300050513 nmdc:mga0rr50_451599_c1 nmdc:mga0rr50_451599_c1_92_1069 325
678 2209111006 2214800759 2213830100 326
679 3300000041 ARcpr5oldR_c000105 ARcpr5oldR_0001059 326
680 3300000042 ARSoilYngRDRAFT_c00092 ARSoilYngRDRAFT_000926 326
681 3300000043 ARcpr5yngRDRAFT_c000085 ARcpr5yngRDRAFT_0000859 326
682 3300000044 ARSoilOldRDRAFT_c000016 ARSoilOldRDRAFT_0000169 326
683 3300000045 ARCol0oldRDRAFT_c00328 ARCol0oldRDRAFT_003283 326
684 3300000652 ARCol0yngRDRAFT_1000096 ARCol0yngRDRAFT_10000969 326
685 3300001990 JGI24737J22298_10013112 JGI24737J22298_100131122 326
686 3300001990 JGI24737J22298_10032275 JGI24737J22298_100322751 326
687 3300005277 Ga0065716_1001939 Ga0065716_10019392 326
688 3300005289 Ga0065704_10090328 Ga0065704_100903281 326
689 3300005295 Ga0065707_10100212 Ga0065707_101002123 326
690 3300005328 Ga0070676_10119601 Ga0070676_101196013 326
691 3300005329 Ga0070683_100253881 Ga0070683_1002538811 326
692 3300005333 Ga0070677_10141711 Ga0070677_101417111 326
693 3300005334 Ga0068869_100135247 Ga0068869_1001352472 326
694 3300005336 Ga0070680_100081181 Ga0070680_1000811811 326
695 3300005339 Ga0070660_100009542 Ga0070660_1000095429 326
696 3300005340 Ga0070689_100014457 Ga0070689_1000144573 326
697 3300005340 Ga0070689_100045521 Ga0070689_1000455213 326
698 3300005343 Ga0070687_100042178 Ga0070687_1000421782 326
699 3300005343 Ga0070687_100120742 Ga0070687_1001207421 326
700 3300005344 Ga0070661_100402496 Ga0070661_1004024961 326
701 3300005345 Ga0070692_10117721 Ga0070692_101177211 326
702 3300005345 Ga0070692_10231679 Ga0070692_102316791 326
703 3300005347 Ga0070668_100393820 Ga0070668_1003938201 326
704 3300005353 Ga0070669_100149608 Ga0070669_1001496082 326
705 3300005354 Ga0070675_100039484 Ga0070675_1000394844 326
706 3300005354 Ga0070675_100187606 Ga0070675_1001876062 326
707 3300005356 Ga0070674_100179785 Ga0070674_1001797851 326
708 3300005364 Ga0070673_100021826 Ga0070673_1000218264 326
709 3300005365 Ga0070688_100121788 Ga0070688_1001217881 326
710 3300005366 Ga0070659_100179024 Ga0070659_1001790242 326
711 3300005367 Ga0070667_100061825 Ga0070667_1000618254 326
712 3300005367 Ga0070667_100216538 Ga0070667_1002165382 326
713 3300005438 Ga0070701_10007665 Ga0070701_100076652 326
714 3300005438 Ga0070701_10092267 Ga0070701_100922673 326
715 3300005440 Ga0070705_100065793 Ga0070705_1000657931 326
716 3300005441 Ga0070700_100139572 Ga0070700_1001395722 326
717 3300005444 Ga0070694_100049641 Ga0070694_1000496414 326
718 3300005444 Ga0070694_100233098 Ga0070694_1002330981 326
719 3300005445 Ga0070708_100077516 Ga0070708_1000775164 326
720 3300005445 Ga0070708_100325537 Ga0070708_1003255371 326
721 3300005455 Ga0070663_100357852 Ga0070663_1003578521 326
722 3300005456 Ga0070678_100464258 Ga0070678_1004642581 326
723 3300005457 Ga0070662_100022584 Ga0070662_1000225844 326
724 3300005457 Ga0070662_100349279 Ga0070662_1003492791 326
725 3300005458 Ga0070681_10238203 Ga0070681_102382031 326
726 3300005467 Ga0070706_100041803 Ga0070706_1000418034 326
727 3300005468 Ga0070707_100012483 Ga0070707_1000124835 326
728 3300005471 Ga0070698_100124734 Ga0070698_1001247343 326
729 3300005471 Ga0070698_100231627 Ga0070698_1002316271 326
730 3300005518 Ga0070699_100004122 Ga0070699_1000041221 326
731 3300005518 Ga0070699_100250388 Ga0070699_1002503882 326
732 3300005530 Ga0070679_100272450 Ga0070679_1002724501 326
733 3300005535 Ga0070684_100521346 Ga0070684_1005213461 326
734 3300005536 Ga0070697_100018594 Ga0070697_1000185946 326
735 3300005536 Ga0070697_100062962 Ga0070697_1000629624 326
736 3300005539 Ga0068853_100377924 Ga0068853_1003779241 326
737 3300005543 Ga0070672_100041095 Ga0070672_1000410952 326
738 3300005543 Ga0070672_100201483 Ga0070672_1002014831 326
739 3300005544 Ga0070686_100087774 Ga0070686_1000877742 326
740 3300005544 Ga0070686_100101949 Ga0070686_1001019491 326
741 3300005545 Ga0070695_100017313 Ga0070695_1000173132 326
742 3300005545 Ga0070695_100051261 Ga0070695_1000512612 326
743 3300005545 Ga0070695_100354268 Ga0070695_1003542681 326
744 3300005546 Ga0070696_100137478 Ga0070696_1001374782 326
745 3300005546 Ga0070696_100150020 Ga0070696_1001500202 326
746 3300005547 Ga0070693_100055875 Ga0070693_1000558752 326
747 3300005563 Ga0068855_100144369 Ga0068855_1001443694 326
748 3300005564 Ga0070664_100482015 Ga0070664_1004820151 326
749 3300005577 Ga0068857_100021887 Ga0068857_1000218875 326
750 3300005577 Ga0068857_100126366 Ga0068857_1001263662 326
751 3300005578 Ga0068854_100036600 Ga0068854_1000366004 326
752 3300005615 Ga0070702_100013438 Ga0070702_1000134382 326
753 3300005615 Ga0070702_100210798 Ga0070702_1002107981 326
754 3300005616 Ga0068852_100043002 Ga0068852_1000430024 326
755 3300005617 Ga0068859_100342733 Ga0068859_1003427332 326
756 3300005617 Ga0068859_100355070 Ga0068859_1003550703 326
757 3300005618 Ga0068864_100003648 Ga0068864_1000036484 326
758 3300005618 Ga0068864_100095474 Ga0068864_1000954742 326
759 3300005719 Ga0068861_100080627 Ga0068861_1000806274 326
760 3300005834 Ga0068851_10138650 Ga0068851_101386501 326
761 3300005840 Ga0068870_10027115 Ga0068870_100271154 326
762 3300005840 Ga0068870_10107763 Ga0068870_101077632 326
763 3300005841 Ga0068863_100010844 Ga0068863_1000108447 326
764 3300005843 Ga0068860_100062335 Ga0068860_1000623352 326
765 3300005843 Ga0068860_100171270 Ga0068860_1001712702 326
766 3300005843 Ga0068860_100267912 Ga0068860_1002679122 326
767 3300005844 Ga0068862_100048902 Ga0068862_1000489025 326
768 3300005844 Ga0068862_100252762 Ga0068862_1002527622 326
769 3300005844 Ga0068862_100610560 Ga0068862_1006105601 326
770 3300006173 Ga0070716_100283178 Ga0070716_1002831781 326
771 3300006178 Ga0075367_10151549 Ga0075367_101515491 326
772 3300006846 Ga0075430_100001979 Ga0075430_1000019792 326
773 3300006852 Ga0075433_10051401 Ga0075433_100514014 326
774 3300006871 Ga0075434_100086529 Ga0075434_1000865293 326
775 3300006881 Ga0068865_100132730 Ga0068865_1001327301 326
776 3300006931 Ga0097620_100342702 Ga0097620_1003427022 326
777 3300006931 Ga0097620_100355072 Ga0097620_1003550721 326
778 3300009011 Ga0105251_10080495 Ga0105251_100804951 326
779 3300009093 Ga0105240_10711066 Ga0105240_107110661 326
780 3300009094 Ga0111539_10004905 Ga0111539_100049053 326
781 3300009094 Ga0111539_10097433 Ga0111539_100974331 326
782 3300009098 Ga0105245_10149118 Ga0105245_101491181 326
783 3300009098 Ga0105245_10354323 Ga0105245_103543232 326
784 3300009148 Ga0105243_10160961 Ga0105243_101609612 326
785 3300009148 Ga0105243_10212467 Ga0105243_102124672 326
786 3300009148 Ga0105243_10258806 Ga0105243_102588061 326
787 3300009174 Ga0105241_10326021 Ga0105241_103260212 326
788 3300009176 Ga0105242_10193235 Ga0105242_101932351 326
789 3300009176 Ga0105242_10240510 Ga0105242_102405101 326
790 3300009177 Ga0105248_10275769 Ga0105248_102757691 326
791 3300009553 Ga0105249_10078302 Ga0105249_100783024 326
792 3300009553 Ga0105249_10165792 Ga0105249_101657921 326
793 3300009553 Ga0105249_10225011 Ga0105249_102250112 326
794 3300010375 Ga0105239_10154443 Ga0105239_101544432 326
795 3300011119 Ga0105246_10177723 Ga0105246_101777232 326
796 3300013100 Ga0157373_10108738 Ga0157373_101087382 326
797 3300013296 Ga0157374_10020022 Ga0157374_100200221 326
798 3300013297 Ga0157378_10588055 Ga0157378_105880551 326
799 3300013306 Ga0163162_10025015 Ga0163162_100250154 326
800 3300013306 Ga0163162_10414429 Ga0163162_104144291 326
801 3300013306 Ga0163162_10591292 Ga0163162_105912921 326
802 3300013308 Ga0157375_10383540 Ga0157375_103835401 326
803 3300013308 Ga0157375_10701462 Ga0157375_107014621 326
804 3300014325 Ga0163163_10108550 Ga0163163_101085502 326
805 3300014326 Ga0157380_10043822 Ga0157380_100438221 326
806 3300014326 Ga0157380_10328871 Ga0157380_103288712 326
807 3300014969 Ga0157376_10520743 Ga0157376_105207431 326
808 3300017792 Ga0163161_10109332 Ga0163161_101093322 326
809 3300017792 Ga0163161_10156447 Ga0163161_101564471 326
810 3300025271 Ga0207666_1001292 Ga0207666_10012922 326
811 3300025315 Ga0207697_10052604 Ga0207697_100526041 326
812 3300025321 Ga0207656_10056401 Ga0207656_100564011 326
813 3300025885 Ga0207653_10009126 Ga0207653_100091262 326
814 3300025893 Ga0207682_10031867 Ga0207682_100318672 326
815 3300025893 Ga0207682_10072525 Ga0207682_100725251 326
816 3300025901 Ga0207688_10267537 Ga0207688_102675371 326
817 3300025903 Ga0207680_10186851 Ga0207680_101868511 326
818 3300025907 Ga0207645_10140361 Ga0207645_101403611 326
819 3300025908 Ga0207643_10100322 Ga0207643_101003222 326
820 3300025910 Ga0207684_10120493 Ga0207684_101204933 326
821 3300025911 Ga0207654_10037552 Ga0207654_100375522 326
822 3300025912 Ga0207707_10183165 Ga0207707_101831651 326
823 3300025917 Ga0207660_10086337 Ga0207660_100863372 326
824 3300025917 Ga0207660_10375453 Ga0207660_103754531 326
825 3300025918 Ga0207662_10099506 Ga0207662_100995061 326
826 3300025918 Ga0207662_10198042 Ga0207662_101980421 326
827 3300025920 Ga0207649_10138253 Ga0207649_101382531 326
828 3300025922 Ga0207646_10004205 Ga0207646_100042056 326
829 3300025923 Ga0207681_10270574 Ga0207681_102705741 326
830 3300025925 Ga0207650_10004622 Ga0207650_100046229 326
831 3300025925 Ga0207650_10326526 Ga0207650_103265261 326
832 3300025926 Ga0207659_10000948 Ga0207659_100009481 326
833 3300025926 Ga0207659_10002548 Ga0207659_100025488 326
834 3300025927 Ga0207687_10232769 Ga0207687_102327692 326
835 3300025931 Ga0207644_10423167 Ga0207644_104231671 326
836 3300025932 Ga0207690_10109456 Ga0207690_101094561 326
837 3300025933 Ga0207706_10233144 Ga0207706_102331441 326
838 3300025933 Ga0207706_10350063 Ga0207706_103500631 326
839 3300025933 Ga0207706_10460198 Ga0207706_104601981 326
840 3300025934 Ga0207686_10152970 Ga0207686_101529701 326
841 3300025935 Ga0207709_10001091 Ga0207709_1000109118 326
842 3300025935 Ga0207709_10168919 Ga0207709_101689192 326
843 3300025936 Ga0207670_10069356 Ga0207670_100693562 326
844 3300025937 Ga0207669_10148493 Ga0207669_101484931 326
845 3300025938 Ga0207704_10001128 Ga0207704_100011282 326
846 3300025940 Ga0207691_10218553 Ga0207691_102185531 326
847 3300025942 Ga0207689_10145039 Ga0207689_101450391 326
848 3300025944 Ga0207661_10324583 Ga0207661_103245831 326
849 3300025945 Ga0207679_10037948 Ga0207679_100379483 326
850 3300025960 Ga0207651_10076453 Ga0207651_100764532 326
851 3300025961 Ga0207712_10340988 Ga0207712_103409882 326
852 3300025972 Ga0207668_10053532 Ga0207668_100535321 326
853 3300025981 Ga0207640_10428741 Ga0207640_104287411 326
854 3300026067 Ga0207678_10016458 Ga0207678_100164582 326
855 3300026067 Ga0207678_10465606 Ga0207678_104656061 326
856 3300026075 Ga0207708_10023082 Ga0207708_100230821 326
857 3300026075 Ga0207708_10279879 Ga0207708_102798791 326
858 3300026089 Ga0207648_10061272 Ga0207648_100612723 326
859 3300026089 Ga0207648_10170018 Ga0207648_101700182 326
860 3300026089 Ga0207648_10250302 Ga0207648_102503021 326
861 3300026095 Ga0207676_10003243 Ga0207676_100032439 326
862 3300026116 Ga0207674_10063659 Ga0207674_100636592 326
863 3300026116 Ga0207674_10135721 Ga0207674_101357211 326
864 3300026118 Ga0207675_100269059 Ga0207675_1002690591 326
865 3300026121 Ga0207683_10250745 Ga0207683_102507451 326
866 3300026142 Ga0207698_10182198 Ga0207698_101821981 326
867 3300027907 Ga0207428_10000664 Ga0207428_1000066425 326
868 3300027907 Ga0207428_10011295 Ga0207428_100112958 326
869 3300028380 Ga0268265_10164502 Ga0268265_101645022 326
870 3300028381 Ga0268264_10237528 Ga0268264_102375281 326
871 3300028381 Ga0268264_10279028 Ga0268264_102790282 326
872 3300028381 Ga0268264_10287305 Ga0268264_102873051 326
873 3300028381 Ga0268264_10335335 Ga0268264_103353352 326
874 3300034816 Ga0373930_0000082 Ga0373930_0000082_5095_6075 326
875 3300034817 Ga0373948_0001083 Ga0373948_0001083_1318_2298 326
876 3300034818 Ga0373950_0001391 Ga0373950_0001391_506_1486 326
877 3300034819 Ga0373958_0000241 Ga0373958_0000241_5116_6096 326
878 3300034819 Ga0373958_0004533 Ga0373958_0004533_945_1925 326
879 3300034957 Ga0373938_0000222 Ga0373938_0000222_1226_2206 326
880 3300035084 Ga0373928_0000048 Ga0373928_0000048_5549_6529 326
881 3300035085 Ga0373929_0000056 Ga0373929_0000056_3586_4566 326
882 3300035088 Ga0373940_0005577 Ga0373940_0005577_1443_2423 326
883 3300035090 Ga0373949_0000558 Ga0373949_0000558_6609_7589 326
884 3300035091 Ga0373951_0000521 Ga0373951_0000521_4761_5741 326
885 3300035092 Ga0373952_0001750 Ga0373952_0001750_1533_2513 326
886 3300035112 Ga0373932_0000755 Ga0373932_0000755_1650_2630 326
887 3300035114 Ga0373939_0004609 Ga0373939_0004609_1246_2226 326
888 3300035115 Ga0373941_0000282 Ga0373941_0000282_4512_5492 326
889 3300035121 Ga0373960_0000021 Ga0373960_0000021_9083_10063 326
890 3300035207 Ga0373942_0014196 Ga0373942_0014196_712_1692 326
891 3300035241 Ga0373961_0000771 Ga0373961_0000771_6688_7668 326
892 3300035242 Ga0373962_0005559 Ga0373962_0005559_1543_2523 326
893 3300035691 Ga0373931_0034068 Ga0373931_0034068_314_1294 326
894 3300035691 Ga0373931_0101817 Ga0373931_0101817_182_1162 326
895 3300035725 Ga0373947_0185441 Ga0373947_0185441_95_1084 326
896 3300039437 Ga0436365_0717194 Ga0436365_0717194_199_1188 326
897 3300044842 Ga0466957_0037879 Ga0466957_0037879_886_1878 326
898 3300045049 Ga0466959_0052653 Ga0466959_0052653_149_1141 326
899 3300045051 Ga0451576_0022529 Ga0451576_0022529_1276_2256 326
900 3300046475 Ga0495639_0128400 Ga0495639_0128400_125_1114 326
901 3300046499 Ga0495594_0176603 Ga0495594_0176603_64_1053 326
902 3300046535 Ga0495586_0031683 Ga0495586_0031683_50_1033 326
903 3300046674 Ga0495588_0173604 Ga0495588_0173604_23_1018 326
904 3300048904 Ga0496101_0004178 Ga0496101_0004178_6873_7853 326
905 3300048906 Ga0496103_0093415 Ga0496103_0093415_422_1402 326
906 3300048908 Ga0496105_0373245 Ga0496105_0373245_69_1049 326
907 3300048909 Ga0496106_0085006 Ga0496106_0085006_1245_2225 326
908 3300048909 Ga0496106_0128664 Ga0496106_0128664_610_1590 326
909 3300048910 Ga0496107_0041209 Ga0496107_0041209_265_1245 326
910 3300048911 Ga0496108_0465102 Ga0496108_0465102_70_1059 326
911 3300048914 Ga0496111_0155948 Ga0496111_0155948_71_1051 326
912 3300048915 Ga0496112_0008064 Ga0496112_0008064_6063_7043 326
913 3300048917 Ga0496114_0043578 Ga0496114_0043578_164_1144 326
914 3300048918 Ga0496115_0132194 Ga0496115_0132194_232_1212 326
915 3300049569 Ga0501032_0108400 Ga0501032_0108400_331_1389 326
916 3300049576 Ga0501040_0009053 Ga0501040_0009053_4150_5163 326
917 3300049577 Ga0501041_0152971 Ga0501041_0152971_374_1387 326
918 3300049580 Ga0501046_0010851 Ga0501046_0010851_5119_6177 326
919 3300049582 Ga0501048_0001087 Ga0501048_0001087_764_1822 326
920 3300049588 Ga0501072_0006517 Ga0501072_0006517_192_1250 326
921 3300049588 Ga0501072_0010608 Ga0501072_0010608_2079_3065 326
922 3300049591 Ga0501075_0023006 Ga0501075_0023006_398_1384 326
923 3300049591 Ga0501075_0045600 Ga0501075_0045600_1174_2178 326
924 3300049591 Ga0501075_0344453 Ga0501075_0344453_36_1049 326
925 3300049592 Ga0501076_0000941 Ga0501076_0000941_13674_14660 326
926 3300049592 Ga0501076_0030156 Ga0501076_0030156_1839_2843 326
927 3300049742 Ga0501080_0000357 Ga0501080_0000357_12580_13638 326
928 3300050496 nmdc:mga07m45_179417_c1 nmdc:mga07m45_179417_c1_217_1197 326
929 3300050507 nmdc:mga05p37_130378_c1 nmdc:mga05p37_130378_c1_2066_3055 326
930 3300050508 nmdc:mga09592_3912_c1 nmdc:mga09592_3912_c1_171_1160 326
931 3300050509 nmdc:mga0qj67_16709_c1 nmdc:mga0qj67_16709_c1_398_1387 326
932 3300050511 nmdc:mga08y16_3102_c1 nmdc:mga08y16_3102_c1_7007_7987 326
933 3300050511 nmdc:mga08y16_5778_c1 nmdc:mga08y16_5778_c1_11620_12600 326
934 3300050512 nmdc:mga0n895_1477_c1 nmdc:mga0n895_1477_c1_1875_2864 326
935 3300050512 nmdc:mga0n895_310990_c1 nmdc:mga0n895_310990_c1_371_1351 326
936 3300050515 nmdc:mga0a205_323168_c1 nmdc:mga0a205_323168_c1_369_1349 326
937 3300050515 nmdc:mga0a205_39114_c1 nmdc:mga0a205_39114_c1_2168_3148 326
938 3300060353 Ga0501082_0003064 Ga0501082_0003064_12123_13109 326
939 3300060353 Ga0501082_0339982 Ga0501082_0339982_157_1143 326
940 3300061734 Ga0530510_0000710 Ga0530510_0000710_9831_10817 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

74

366

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9355 29 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9294 32 325
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9294 29 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9267 28 324
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9232 32 325
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9019 28 295 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9018 149 324 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9017 31 141 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.894 143 325 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8904 28 295 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V7D4C4-F1-model_v4 ABC transporter substrate-binding protein 0.9891 228 326
AF-A0A2V8BD40-F1-model_v4 ABC transporter substrate-binding protein 0.9806 218 309
AF-A0A1F3YG64-F1-model_v4 ABC transporter substrate-binding protein 0.9802 29 326
AF-A0A536UEY7-F1-model_v4 ABC transporter substrate-binding protein 0.9772 156 326
AF-A0A023XKA0-F1-model_v4 deleted 0.9766 166 326

Feature Viewer

pLDDT pTM Quality
91.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map