F486307

General Info

Members Datasets Scaffolds Average Seq Length
940 408 1880 471

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100007818|Ga0068856_1000078187
Length 491
Sequence MERARVHPRALRRRISTMKTLFLHPPSFGGYDGGAGARYQMKREVRSFWYPTWLAQPAALVEGSKLIDAPPHRLQFEDIAPEVHNRDLVVMHTSTPSFNSDVKIAEMIKSLKPDIKIGLIGAKVAVEPEKSLVAAPAVDFVARNEFDFTIKEVADGRAWSDIKGISYRNKEGAIVHNDDREVLENMDALPWVTPVYKRDLTIENYFGGYLKHPYISFYTGRGCKSRCTFCLWPQTVGGHRYRVRSVEDVVAEMQWAMHAFPQVKEYFFDDDTLTDNLPRVEALAKALGKLGVIWSCNAKANVPRRTLEIMKDNGLRLLLVGYESGNQQILFNIKKGMRVEFARRFTKDCHELGIKIHGTFILGLPGETKETIQQTLDFAKEMNPHTIQVSLAAPYPGTFLYRQAKENGWLYNEEIDLLTQEGTQIAPLSYPHLSHGEIFDSVEDFYKKFYFRPTKIAAIVAEMIASPQMMKRRLREGAEFFRFLRTRHDTP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
204 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
379 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
382 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
395 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
396 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
397 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
405 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
406 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
407 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
408 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.64
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 0
Rhizoplane 5.74
Rhizosphere 83.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100007818 3300005614 Bacteria 10439
2 JGI24736J21556_1001509 3300001904 Bacteria 4250
3 JGI24741J21665_1003682 3300001915 Bacteria 3583
4 JGI24752J21851_1000027 3300001976 Bacteria 17325
5 JGI24740J21852_10003653 3300001979 Bacteria 6700
6 JGI24739J22299_10009686 3300001989 Bacteria 3586
7 JGI24739J22299_10009980 3300001989 Bacteria 3531
8 JGI24737J22298_10001928 3300001990 Bacteria 7416
9 JGI24737J22298_10006746 3300001990 Bacteria 3903
10 JGI24735J21928_10029735 3300002067 Bacteria 1625
11 JGI24750J21931_1000041 3300002070 Bacteria 17174
12 JGI24748J21848_1000096 3300002074 Bacteria 23684
13 JGI24738J21930_10003555 3300002075 Bacteria 3911
14 JGI24738J21930_10004883 3300002075 Bacteria 3254
15 JGI24034J26672_10000028 3300002239 Bacteria 105058
16 JGI24742J22300_10001008 3300002244 Bacteria 4339
17 JGI25165J46597_1000008 3300003214 Bacteria 478603
18 JGI25165J46597_1000297 3300003214 Bacteria 62745
19 JGI25165J46597_1000489 3300003214 Bacteria 38233
20 JGI25153J46596_10000113 3300003215 Bacteria 92345
21 JGI25153J46596_10000672 3300003215 Bacteria 20919
22 Ga0055525_1000051 3300003759 Bacteria 240942
23 Ga0055542_1000677 3300003762 Bacteria 27414
24 Ga0055542_1002995 3300003762 Bacteria 4926
25 Ga0055529_1000016 3300003763 Bacteria 364775
26 Ga0058863_11589608 3300004799 Bacteria 1683
27 Ga0058862_12249235 3300004803 Bacteria 1678
28 Ga0065165_1009874 3300005262 Bacteria 4210
29 Ga0065707_10081714 3300005295 Bacteria 75872
30 Ga0070658_10000116 3300005327 Bacteria 71744
31 Ga0070658_10002598 3300005327 Bacteria 15043
32 Ga0070658_10003253 3300005327 Bacteria 13411
33 Ga0070658_10018921 3300005327 Bacteria 5517
34 Ga0070658_10027870 3300005327 Bacteria 4533
35 Ga0070658_10093562 3300005327 Bacteria 2479
36 Ga0070676_10014080 3300005328 Bacteria 4390
37 Ga0070690_100000003 3300005330 Bacteria 144748
38 Ga0070690_100024373 3300005330 Bacteria 3720
39 Ga0070690_100036723 3300005330 Bacteria 3082
40 Ga0070670_100005173 3300005331 Bacteria 10983
41 Ga0070670_100081940 3300005331 Bacteria 2772
42 Ga0070666_10000006 3300005335 Bacteria 319173
43 Ga0070666_10000410 3300005335 Bacteria 26678
44 Ga0070680_100000166 3300005336 Bacteria 41693
45 Ga0070680_100047651 3300005336 Bacteria 3490
46 Ga0070680_100078812 3300005336 Bacteria 2714
47 Ga0070682_100044476 3300005337 Bacteria 2749
48 Ga0070660_100003168 3300005339 Bacteria 11299
49 Ga0070660_100040499 3300005339 Bacteria 3546
50 Ga0070660_100064491 3300005339 Bacteria 2850
51 Ga0070689_100013461 3300005340 Bacteria 5920
52 Ga0070689_100032566 3300005340 Bacteria 3966
53 Ga0070691_10001140 3300005341 Bacteria 11052
54 Ga0070692_10024711 3300005345 Bacteria 2955
55 Ga0070668_100029899 3300005347 Bacteria 4139
56 Ga0070669_100000014 3300005353 Bacteria 206875
57 Ga0070669_100066282 3300005353 Bacteria 2661
58 Ga0070671_100035911 3300005355 Bacteria 4107
59 Ga0070674_100000746 3300005356 Bacteria 16681
60 Ga0070674_100018639 3300005356 Bacteria 4393
61 Ga0070667_100024894 3300005367 Bacteria 4972
62 Ga0070667_100069756 3300005367 Bacteria 2991
63 Ga0070667_100143696 3300005367 Bacteria 2091
64 Ga0070709_10007492 3300005434 Bacteria 5985
65 Ga0070709_10013017 3300005434 Bacteria 4669
66 Ga0070714_100000761 3300005435 Bacteria 22822
67 Ga0070714_100007392 3300005435 Bacteria 8546
68 Ga0070713_100000007 3300005436 Bacteria 186402
69 Ga0070713_100010825 3300005436 Bacteria 6610
70 Ga0070713_100041897 3300005436 Bacteria 3733
71 Ga0070713_100130626 3300005436 Bacteria 2214
72 Ga0070711_100003889 3300005439 Bacteria 8771
73 Ga0070711_100012918 3300005439 Bacteria 5232
74 Ga0070711_100035173 3300005439 Bacteria 3347
75 Ga0070711_100047124 3300005439 Bacteria 2941
76 Ga0070711_100048812 3300005439 Bacteria 2896
77 Ga0070705_100002764 3300005440 Bacteria 8757
78 Ga0070705_100093762 3300005440 Bacteria 1878
79 Ga0070700_100074742 3300005441 Bacteria 2172
80 Ga0070694_100035591 3300005444 Bacteria 3293
81 Ga0070694_100050902 3300005444 Bacteria 2794
82 Ga0070663_100007242 3300005455 Bacteria 6742
83 Ga0070678_100000585 3300005456 Bacteria 17909
84 Ga0070678_100094202 3300005456 Bacteria 2305
85 Ga0070662_100008234 3300005457 Bacteria 6789
86 Ga0070662_100026287 3300005457 Bacteria 4029
87 Ga0070681_10000966 3300005458 Bacteria 24277
88 Ga0070681_10002890 3300005458 Bacteria 15869
89 Ga0070681_10003601 3300005458 Bacteria 14521
90 Ga0070681_10020624 3300005458 Bacteria 6604
91 Ga0070681_10154665 3300005458 Bacteria 2219
92 Ga0070685_10000072 3300005466 Bacteria 59953
93 Ga0070685_10021125 3300005466 Bacteria 3535
94 Ga0070698_100032083 3300005471 Bacteria 5443
95 Ga0070699_100023877 3300005518 Bacteria 5270
96 Ga0070679_100008818 3300005530 Bacteria 9514
97 Ga0070679_100022694 3300005530 Bacteria 6136
98 Ga0070679_100058090 3300005530 Bacteria 3855
99 Ga0070679_100067291 3300005530 Bacteria 3572
100 Ga0070684_100087173 3300005535 Bacteria 2771
101 Ga0070697_100008449 3300005536 Bacteria 8033
102 Ga0070697_100101520 3300005536 Bacteria 2390
103 Ga0070697_100104358 3300005536 Bacteria 2357
104 Ga0070697_100147862 3300005536 Bacteria 1979
105 Ga0068853_100004213 3300005539 Bacteria 11101
106 Ga0068853_100065265 3300005539 Bacteria 3159
107 Ga0070686_100000022 3300005544 Bacteria 131168
108 Ga0070695_100018861 3300005545 Bacteria 4193
109 Ga0070695_100055638 3300005545 Bacteria 2551
110 Ga0070696_100143284 3300005546 Bacteria 1748
111 Ga0070693_100006405 3300005547 Bacteria 5706
112 Ga0070665_100000019 3300005548 Bacteria 413972
113 Ga0070665_100000058 3300005548 Bacteria 225040
114 Ga0070665_100002528 3300005548 Bacteria 20093
115 Ga0070665_100009420 3300005548 Bacteria 9885
116 Ga0070665_100024420 3300005548 Bacteria 6086
117 Ga0070665_100035688 3300005548 Bacteria 5000
118 Ga0070665_100125292 3300005548 Bacteria 2571
119 Ga0070665_100147500 3300005548 Bacteria 2355
120 Ga0070665_100221543 3300005548 Bacteria 1892
121 Ga0070704_100052902 3300005549 Bacteria 2867
122 Ga0070704_100126179 3300005549 Bacteria 1975
123 Ga0070704_100181114 3300005549 Bacteria 1685
124 Ga0068855_100003048 3300005563 Bacteria 20528
125 Ga0068855_100003607 3300005563 Bacteria 18908
126 Ga0068855_100032581 3300005563 Bacteria 6221
127 Ga0068855_100220888 3300005563 Bacteria 2125
128 Ga0068855_100244188 3300005563 Bacteria 2005
129 Ga0068857_100023641 3300005577 Bacteria 5411
130 Ga0068857_100035743 3300005577 Bacteria 4401
131 Ga0068857_100076939 3300005577 Bacteria 2976
132 Ga0068857_100154400 3300005577 Bacteria 2081
133 Ga0068856_100000142 3300005614 Bacteria 72931
134 Ga0068856_100040567 3300005614 Bacteria 4573
135 Ga0068856_100060295 3300005614 Bacteria 3749
136 Ga0070702_100025238 3300005615 Bacteria 3182
137 Ga0070702_100049483 3300005615 Bacteria 2397
138 Ga0068852_100000043 3300005616 Bacteria 89867
139 Ga0068852_100043311 3300005616 Bacteria 3817
140 Ga0068852_100053990 3300005616 Bacteria 3462
141 Ga0068852_100081292 3300005616 Bacteria 2875
142 Ga0068859_100002673 3300005617 Bacteria 18104
143 Ga0068859_100022887 3300005617 Bacteria 6265
144 Ga0068859_100047888 3300005617 Bacteria 4295
145 Ga0068859_100051845 3300005617 Bacteria 4125
146 Ga0068859_100062269 3300005617 Bacteria 3761
147 Ga0068859_100064968 3300005617 Bacteria 3683
148 Ga0068864_100000565 3300005618 Bacteria 31584
149 Ga0068864_100004975 3300005618 Bacteria 10896
150 Ga0068864_100010237 3300005618 Bacteria 7744
151 Ga0068864_100040174 3300005618 Bacteria 4002
152 Ga0068861_100000111 3300005719 Bacteria 41057
153 Ga0068861_100008113 3300005719 Bacteria 7223
154 Ga0068851_10004282 3300005834 Bacteria 6427
155 Ga0068870_10064079 3300005840 Bacteria 1984
156 Ga0068863_100000048 3300005841 Bacteria 135912
157 Ga0068863_100000051 3300005841 Bacteria 127526
158 Ga0068863_100095516 3300005841 Bacteria 2821
159 Ga0068858_100000254 3300005842 Bacteria 57050
160 Ga0068858_100110985 3300005842 Bacteria 2561
161 Ga0068858_100113002 3300005842 Bacteria 2536
162 Ga0068858_100161656 3300005842 Bacteria 2109
163 Ga0068860_100000014 3300005843 Bacteria 319437
164 Ga0068860_100000187 3300005843 Bacteria 98756
165 Ga0068860_100083473 3300005843 Bacteria 3038
166 Ga0068862_100023072 3300005844 Bacteria 5212
167 Ga0068862_100062843 3300005844 Bacteria 3194
168 Ga0081455_10000088 3300005937 Bacteria 98815
169 Ga0081455_10017022 3300005937 Bacteria 6988
170 Ga0081455_10028380 3300005937 Bacteria 5113
171 Ga0081538_10052953 3300005981 Bacteria 2419
172 Ga0081540_1004937 3300005983 Bacteria 10031
173 Ga0081540_1055391 3300005983 Bacteria 1931
174 Ga0070717_10004903 3300006028 Bacteria 9735
175 Ga0075363_100009459 3300006048 Bacteria 4582
176 Ga0075364_10134862 3300006051 Bacteria 1658
177 Ga0070716_100012383 3300006173 Bacteria 4323
178 Ga0070716_100021723 3300006173 Bacteria 3384
179 Ga0070712_100000015 3300006175 Bacteria 106593
180 Ga0070712_100001349 3300006175 Bacteria 14896
181 Ga0070712_100022267 3300006175 Bacteria 4172
182 Ga0075362_10000095 3300006177 Bacteria 24855
183 Ga0075369_10002175 3300006186 Bacteria 6928
184 Ga0075369_10046940 3300006186 Bacteria 1861
185 Ga0075366_10024202 3300006195 Bacteria 3542
186 Ga0097621_100000667 3300006237 Bacteria 24145
187 Ga0097621_100045788 3300006237 Bacteria 3535
188 Ga0075370_10000025 3300006353 Bacteria 52081
189 Ga0075370_10099057 3300006353 Bacteria 1686
190 Ga0068871_100006814 3300006358 Bacteria 8125
191 Ga0068871_100073058 3300006358 Bacteria 2827
192 Ga0075428_100000380 3300006844 Bacteria 44038
193 Ga0075428_100061682 3300006844 Bacteria 4106
194 Ga0075428_100073996 3300006844 Bacteria 3721
195 Ga0075428_100142075 3300006844 Bacteria 2610
196 Ga0075430_100007128 3300006846 Bacteria 9428
197 Ga0075430_100037467 3300006846 Bacteria 4110
198 Ga0075430_100055367 3300006846 Bacteria 3336
199 Ga0075431_100012379 3300006847 Bacteria 8610
200 Ga0075431_100018891 3300006847 Bacteria 7022
201 Ga0075431_100053013 3300006847 Bacteria 4182
202 Ga0075433_10001374 3300006852 Bacteria 17879
203 Ga0075433_10064307 3300006852 Bacteria 3215
204 Ga0075433_10070998 3300006852 Bacteria 3061
205 Ga0075433_10109601 3300006852 Bacteria 2449
206 Ga0075433_10181572 3300006852 Bacteria 1873
207 Ga0075434_100000753 3300006871 Bacteria 25538
208 Ga0075434_100014278 3300006871 Bacteria 7590
209 Ga0075434_100019894 3300006871 Bacteria 6501
210 Ga0075434_100030105 3300006871 Bacteria 5344
211 Ga0075434_100045158 3300006871 Bacteria 4370
212 Ga0075434_100054366 3300006871 Bacteria 3978
213 Ga0075434_100111213 3300006871 Bacteria 2750
214 Ga0075429_100000097 3300006880 Bacteria 47892
215 Ga0075429_100002097 3300006880 Bacteria 16632
216 Ga0075429_100012504 3300006880 Bacteria 7362
217 Ga0068865_100002716 3300006881 Bacteria 10503
218 Ga0075436_100000024 3300006914 Bacteria 115057
219 Ga0097620_100002673 3300006931 Bacteria 18104
220 Ga0097620_100022887 3300006931 Bacteria 6265
221 Ga0097620_100047889 3300006931 Bacteria 4295
222 Ga0097620_100051843 3300006931 Bacteria 4125
223 Ga0097620_100062268 3300006931 Bacteria 3761
224 Ga0097620_100064968 3300006931 Bacteria 3683
225 Ga0075435_100020165 3300007076 Bacteria 5102
226 Ga0075435_100048993 3300007076 Bacteria 3395
227 Ga0075435_100063562 3300007076 Bacteria 2998
228 Ga0099794_10004284 3300007265 Bacteria 5579
229 Ga0099795_10000617 3300007788 Bacteria 6847
230 Ga0099795_10001314 3300007788 Bacteria 5298
231 Ga0099795_10001349 3300007788 Bacteria 5261
232 Ga0105240_10000733 3300009093 Bacteria 59965
233 Ga0105240_10022602 3300009093 Bacteria 8330
234 Ga0105240_10023442 3300009093 Bacteria 8160
235 Ga0105240_10034962 3300009093 Bacteria 6479
236 Ga0105240_10036767 3300009093 Bacteria 6296
237 Ga0105240_10055350 3300009093 Bacteria 4966
238 Ga0105240_10061130 3300009093 Bacteria 4695
239 Ga0105240_10186611 3300009093 Bacteria 2442
240 Ga0105240_10350181 3300009093 Bacteria 1676
241 Ga0111539_10001385 3300009094 Bacteria 32227
242 Ga0111539_10006891 3300009094 Bacteria 14596
243 Ga0111539_10007288 3300009094 Bacteria 14162
244 Ga0111539_10021041 3300009094 Bacteria 8033
245 Ga0111539_10033953 3300009094 Bacteria 6190
246 Ga0105245_10001618 3300009098 Bacteria 20495
247 Ga0105245_10027313 3300009098 Bacteria 5028
248 Ga0105247_10025691 3300009101 Bacteria 3554
249 Ga0114129_10000156 3300009147 Bacteria 72734
250 Ga0114129_10000625 3300009147 Bacteria 43996
251 Ga0114129_10014790 3300009147 Bacteria 11118
252 Ga0114129_10021337 3300009147 Bacteria 9196
253 Ga0114129_10056170 3300009147 Bacteria 5515
254 Ga0114129_10067337 3300009147 Bacteria 4994
255 Ga0114129_10098690 3300009147 Bacteria 4042
256 Ga0105243_10000782 3300009148 Bacteria 30522
257 Ga0105243_10021440 3300009148 Bacteria 4905
258 Ga0105243_10047215 3300009148 Bacteria 3389
259 Ga0105241_10001365 3300009174 Bacteria 18600
260 Ga0105241_10003444 3300009174 Bacteria 11773
261 Ga0105241_10007433 3300009174 Bacteria 8066
262 Ga0105241_10042106 3300009174 Bacteria 3453
263 Ga0105241_10066259 3300009174 Bacteria 2792
264 Ga0105242_10029836 3300009176 Bacteria 4353
265 Ga0105242_10039657 3300009176 Bacteria 3791
266 Ga0105242_10075685 3300009176 Bacteria 2804
267 Ga0105248_10002303 3300009177 Bacteria 21145
268 Ga0105248_10007409 3300009177 Bacteria 12041
269 Ga0105248_10013887 3300009177 Bacteria 8861
270 Ga0105248_10044462 3300009177 Bacteria 4980
271 Ga0105248_10071941 3300009177 Bacteria 3886
272 Ga0105248_10075907 3300009177 Bacteria 3778
273 Ga0105248_10096555 3300009177 Bacteria 3329
274 Ga0105248_10257644 3300009177 Bacteria 1964
275 Ga0105237_10002363 3300009545 Bacteria 23404
276 Ga0105237_10030182 3300009545 Bacteria 5509
277 Ga0105238_10001921 3300009551 Bacteria 20862
278 Ga0105238_10013158 3300009551 Bacteria 8349
279 Ga0105238_10060392 3300009551 Bacteria 3795
280 Ga0105238_10125721 3300009551 Bacteria 2543
281 Ga0105238_10193015 3300009551 Bacteria 2012
282 Ga0105249_10000104 3300009553 Bacteria 118213
283 Ga0105249_10006192 3300009553 Bacteria 10386
284 Ga0099796_10002367 3300010159 Bacteria 4120
285 Ga0099796_10003638 3300010159 Bacteria 3610
286 Ga0099796_10009676 3300010159 Bacteria 2618
287 Ga0105239_10000138 3300010375 Bacteria 102176
288 Ga0105239_10024748 3300010375 Bacteria 6613
289 Ga0105239_10067661 3300010375 Bacteria 3924
290 Ga0105239_10085669 3300010375 Bacteria 3473
291 Ga0105239_10097212 3300010375 Bacteria 3254
292 Ga0157371_10000146 3300013102 Bacteria 103290
293 Ga0157370_10000503 3300013104 Bacteria 48827
294 Ga0157370_10001658 3300013104 Bacteria 27457
295 Ga0157370_10024422 3300013104 Bacteria 5986
296 Ga0157369_10009865 3300013105 Bacteria 10911
297 Ga0157369_10038161 3300013105 Bacteria 5254
298 Ga0157369_10055615 3300013105 Bacteria 4271
299 Ga0157378_10044499 3300013297 Bacteria 3942
300 Ga0157378_10059554 3300013297 Bacteria 3407
301 Ga0157378_10104103 3300013297 Bacteria 2594
302 Ga0163162_10002269 3300013306 Bacteria 18047
303 Ga0163162_10014904 3300013306 Bacteria 7591
304 Ga0163162_10103353 3300013306 Bacteria 2943
305 Ga0163162_10138786 3300013306 Bacteria 2543
306 Ga0163162_10180379 3300013306 Bacteria 2238
307 Ga0157372_10110327 3300013307 Bacteria 3151
308 Ga0157372_10151050 3300013307 Bacteria 2681
309 Ga0157372_10234477 3300013307 Bacteria 2128
310 Ga0157372_10369694 3300013307 Bacteria 1671
311 Ga0157375_10029036 3300013308 Bacteria 5195
312 Ga0163163_10000016 3300014325 Bacteria 213966
313 Ga0163163_10006398 3300014325 Bacteria 10289
314 Ga0163163_10102214 3300014325 Bacteria 2889
315 Ga0157380_10000181 3300014326 Bacteria 36496
316 Ga0157380_10006753 3300014326 Bacteria 8110
317 Ga0157380_10070190 3300014326 Bacteria 2830
318 Ga0157379_10019689 3300014968 Bacteria 5962
319 Ga0157379_10039312 3300014968 Bacteria 4220
320 Ga0157376_10132985 3300014969 Bacteria 2223
321 Ga0163161_10000020 3300017792 Bacteria 214642
322 Ga0206356_11622843 3300020070 Bacteria 2405
323 Ga0213872_10033254 3300021361 Bacteria 2363
324 Ga0213872_10056105 3300021361 Bacteria 1785
325 Ga0213874_10005997 3300021377 Bacteria 2857
326 Ga0213875_10000228 3300021388 Bacteria 56927
327 Ga0213871_10003950 3300021441 Bacteria 2917
328 Ga0213871_10006546 3300021441 Bacteria 2469
329 Ga0207672_1000860 3300025223 Bacteria 3136
330 Ga0209674_101931 3300025226 Bacteria 4859
331 Ga0209563_100019 3300025230 Bacteria 697828
332 Ga0207427_100640 3300025231 Bacteria 16950
333 Ga0209437_105888 3300025233 Bacteria 2067
334 Ga0209148_1000017 3300025254 Bacteria 787064
335 Ga0209148_1000061 3300025254 Bacteria 349575
336 Ga0209233_1000006 3300025261 Bacteria 1473685
337 Ga0209233_1000107 3300025261 Bacteria 267399
338 Ga0209233_1000382 3300025261 Bacteria 38319
339 Ga0209455_1000005 3300025272 Bacteria 1416756
340 Ga0209455_1011665 3300025272 Bacteria 2150
341 Ga0209758_1000035 3300025297 Bacteria 448190
342 Ga0207656_10008826 3300025321 Bacteria 3729
343 Ga0207682_10040825 3300025893 Bacteria 1892
344 Ga0207642_10013804 3300025899 Bacteria 2959
345 Ga0207680_10000011 3300025903 Bacteria 391225
346 Ga0207680_10031022 3300025903 Bacteria 3024
347 Ga0207647_10000527 3300025904 Bacteria 30498
348 Ga0207647_10001094 3300025904 Bacteria 20910
349 Ga0207647_10004311 3300025904 Bacteria 10549
350 Ga0207647_10046770 3300025904 Bacteria 2695
351 Ga0207685_10006206 3300025905 Bacteria 3234
352 Ga0207699_10000660 3300025906 Bacteria 16579
353 Ga0207699_10006424 3300025906 Bacteria 5690
354 Ga0207699_10016427 3300025906 Bacteria 3872
355 Ga0207699_10077254 3300025906 Bacteria 2054
356 Ga0207643_10029831 3300025908 Bacteria 3034
357 Ga0207643_10052068 3300025908 Bacteria 2324
358 Ga0207705_10001001 3300025909 Bacteria 23017
359 Ga0207705_10001461 3300025909 Bacteria 18836
360 Ga0207705_10007867 3300025909 Bacteria 7827
361 Ga0207705_10083646 3300025909 Bacteria 2328
362 Ga0207684_10014178 3300025910 Bacteria 6880
363 Ga0207654_10002077 3300025911 Bacteria 10270
364 Ga0207654_10018498 3300025911 Bacteria 3657
365 Ga0207654_10043009 3300025911 Bacteria 2558
366 Ga0207707_10000489 3300025912 Bacteria 40959
367 Ga0207707_10005090 3300025912 Bacteria 11527
368 Ga0207707_10013886 3300025912 Bacteria 7022
369 Ga0207707_10017985 3300025912 Bacteria 6161
370 Ga0207707_10046484 3300025912 Bacteria 3781
371 Ga0207707_10091488 3300025912 Bacteria 2658
372 Ga0207695_10001560 3300025913 Bacteria 37557
373 Ga0207695_10002853 3300025913 Bacteria 25128
374 Ga0207695_10005233 3300025913 Bacteria 17336
375 Ga0207695_10024058 3300025913 Bacteria 6865
376 Ga0207695_10036449 3300025913 Bacteria 5317
377 Ga0207695_10047816 3300025913 Bacteria 4523
378 Ga0207695_10053266 3300025913 Bacteria 4233
379 Ga0207695_10130979 3300025913 Bacteria 2466
380 Ga0207695_10218075 3300025913 Bacteria 1816
381 Ga0207695_10249326 3300025913 Bacteria 1675
382 Ga0207671_10000545 3300025914 Bacteria 50856
383 Ga0207671_10001056 3300025914 Bacteria 33385
384 Ga0207693_10000048 3300025915 Bacteria 100685
385 Ga0207693_10000560 3300025915 Bacteria 33567
386 Ga0207693_10001691 3300025915 Bacteria 19437
387 Ga0207693_10015924 3300025915 Bacteria 6020
388 Ga0207693_10017466 3300025915 Bacteria 5723
389 Ga0207663_10007856 3300025916 Bacteria 5559
390 Ga0207663_10010584 3300025916 Bacteria 4917
391 Ga0207663_10069844 3300025916 Bacteria 2261
392 Ga0207660_10083282 3300025917 Bacteria 2355
393 Ga0207662_10035528 3300025918 Bacteria 2911
394 Ga0207657_10000273 3300025919 Bacteria 54891
395 Ga0207657_10004635 3300025919 Bacteria 14525
396 Ga0207657_10006527 3300025919 Bacteria 12082
397 Ga0207657_10015118 3300025919 Bacteria 7495
398 Ga0207657_10020578 3300025919 Bacteria 6231
399 Ga0207649_10000110 3300025920 Bacteria 69018
400 Ga0207649_10000114 3300025920 Bacteria 68080
401 Ga0207649_10000145 3300025920 Bacteria 59071
402 Ga0207652_10000684 3300025921 Bacteria 33128
403 Ga0207652_10046597 3300025921 Bacteria 3699
404 Ga0207652_10061117 3300025921 Bacteria 3253
405 Ga0207646_10057041 3300025922 Bacteria 3489
406 Ga0207681_10000045 3300025923 Bacteria 128454
407 Ga0207681_10010321 3300025923 Bacteria 5713
408 Ga0207694_10006559 3300025924 Bacteria 8845
409 Ga0207694_10014019 3300025924 Bacteria 6044
410 Ga0207694_10018421 3300025924 Bacteria 5278
411 Ga0207694_10031100 3300025924 Bacteria 4076
412 Ga0207694_10036445 3300025924 Bacteria 3776
413 Ga0207694_10037901 3300025924 Bacteria 3705
414 Ga0207650_10003631 3300025925 Bacteria 10570
415 Ga0207650_10071659 3300025925 Bacteria 2607
416 Ga0207659_10108997 3300025926 Bacteria 2101
417 Ga0207687_10003650 3300025927 Bacteria 10372
418 Ga0207687_10018062 3300025927 Bacteria 4653
419 Ga0207700_10000014 3300025928 Bacteria 229475
420 Ga0207664_10029137 3300025929 Bacteria 4203
421 Ga0207644_10000777 3300025931 Bacteria 20242
422 Ga0207644_10080787 3300025931 Bacteria 2401
423 Ga0207690_10019724 3300025932 Bacteria 4157
424 Ga0207690_10092240 3300025932 Bacteria 2143
425 Ga0207706_10015816 3300025933 Bacteria 6821
426 Ga0207706_10017873 3300025933 Bacteria 6385
427 Ga0207706_10022694 3300025933 Bacteria 5634
428 Ga0207706_10111941 3300025933 Bacteria 2402
429 Ga0207686_10007035 3300025934 Bacteria 6054
430 Ga0207686_10025035 3300025934 Bacteria 3466
431 Ga0207709_10000031 3300025935 Bacteria 329046
432 Ga0207709_10007200 3300025935 Bacteria 6208
433 Ga0207709_10013817 3300025935 Bacteria 4456
434 Ga0207670_10001555 3300025936 Bacteria 12082
435 Ga0207670_10020384 3300025936 Bacteria 4074
436 Ga0207669_10000365 3300025937 Bacteria 20447
437 Ga0207669_10008618 3300025937 Bacteria 4798
438 Ga0207704_10063934 3300025938 Bacteria 2296
439 Ga0207665_10018330 3300025939 Bacteria 4600
440 Ga0207711_10000635 3300025941 Bacteria 35316
441 Ga0207711_10012614 3300025941 Bacteria 7020
442 Ga0207711_10035930 3300025941 Bacteria 4202
443 Ga0207711_10038895 3300025941 Bacteria 4045
444 Ga0207711_10104798 3300025941 Bacteria 2507
445 Ga0207689_10032638 3300025942 Bacteria 4329
446 Ga0207689_10099436 3300025942 Bacteria 2390
447 Ga0207679_10122118 3300025945 Bacteria 2076
448 Ga0207679_10157488 3300025945 Bacteria 1856
449 Ga0207667_10003961 3300025949 Bacteria 18221
450 Ga0207667_10005502 3300025949 Bacteria 15447
451 Ga0207667_10027048 3300025949 Bacteria 6254
452 Ga0207712_10000013 3300025961 Bacteria 391208
453 Ga0207712_10023320 3300025961 Bacteria 4083
454 Ga0207712_10072997 3300025961 Bacteria 2473
455 Ga0207668_10010144 3300025972 Bacteria 5678
456 Ga0207668_10033681 3300025972 Bacteria 3395
457 Ga0207668_10048576 3300025972 Bacteria 2913
458 Ga0207658_10008004 3300025986 Bacteria 7198
459 Ga0207658_10021603 3300025986 Bacteria 4471
460 Ga0207658_10054258 3300025986 Bacteria 2965
461 Ga0207677_10093069 3300026023 Bacteria 2196
462 Ga0207677_10167759 3300026023 Bacteria 1713
463 Ga0207703_10000255 3300026035 Bacteria 60030
464 Ga0207703_10003947 3300026035 Bacteria 12293
465 Ga0207703_10028124 3300026035 Bacteria 4429
466 Ga0207703_10054150 3300026035 Bacteria 3262
467 Ga0207703_10066182 3300026035 Bacteria 2972
468 Ga0207639_10000516 3300026041 Bacteria 26647
469 Ga0207639_10002060 3300026041 Bacteria 13562
470 Ga0207678_10003934 3300026067 Bacteria 13365
471 Ga0207678_10005571 3300026067 Bacteria 11258
472 Ga0207678_10121480 3300026067 Bacteria 2229
473 Ga0207678_10216873 3300026067 Bacteria 1637
474 Ga0207708_10057466 3300026075 Bacteria 2968
475 Ga0207708_10113490 3300026075 Bacteria 2105
476 Ga0207702_10000066 3300026078 Bacteria 117825
477 Ga0207702_10003870 3300026078 Bacteria 13488
478 Ga0207702_10010628 3300026078 Bacteria 7692
479 Ga0207702_10021440 3300026078 Bacteria 5350
480 Ga0207702_10119280 3300026078 Bacteria 2358
481 Ga0207702_10148270 3300026078 Bacteria 2131
482 Ga0207641_10000143 3300026088 Bacteria 102398
483 Ga0207641_10000675 3300026088 Bacteria 37002
484 Ga0207641_10026641 3300026088 Bacteria 4773
485 Ga0207641_10167906 3300026088 Bacteria 2000
486 Ga0207648_10038998 3300026089 Bacteria 4178
487 Ga0207648_10149402 3300026089 Bacteria 2061
488 Ga0207648_10194746 3300026089 Bacteria 1797
489 Ga0207676_10000214 3300026095 Bacteria 49961
490 Ga0207676_10007631 3300026095 Bacteria 7679
491 Ga0207676_10008620 3300026095 Bacteria 7247
492 Ga0207676_10032822 3300026095 Bacteria 3916
493 Ga0207674_10017008 3300026116 Bacteria 7939
494 Ga0207674_10027113 3300026116 Bacteria 6068
495 Ga0207674_10040487 3300026116 Bacteria 4826
496 Ga0207674_10057342 3300026116 Bacteria 3948
497 Ga0207674_10078266 3300026116 Bacteria 3311
498 Ga0207674_10206874 3300026116 Bacteria 1912
499 Ga0207675_100000019 3300026118 Bacteria 122642
500 Ga0207675_100007046 3300026118 Bacteria 10621
501 Ga0207675_100031913 3300026118 Bacteria 4907
502 Ga0207683_10001302 3300026121 Bacteria 22554
503 Ga0207683_10031662 3300026121 Bacteria 4590
504 Ga0207683_10064514 3300026121 Bacteria 3227
505 Ga0207698_10000449 3300026142 Bacteria 23772
506 Ga0207698_10042838 3300026142 Bacteria 3386
507 Ga0207698_10180578 3300026142 Bacteria 1869
508 Ga0207698_10233280 3300026142 Bacteria 1672
509 Ga0209179_1002970 3300027512 Bacteria 2375
510 Ga0209588_1005047 3300027671 Bacteria 3758
511 Ga0209588_1024292 3300027671 Bacteria 1913
512 Ga0207428_10000009 3300027907 Bacteria 410565
513 Ga0207428_10000199 3300027907 Bacteria 83918
514 Ga0207428_10006052 3300027907 Bacteria 11183
515 Ga0207428_10011692 3300027907 Bacteria 7741
516 Ga0265354_1001119 3300028016 Bacteria 4108
517 Ga0265356_1001861 3300028017 Bacteria 2951
518 Ga0268266_10000005 3300028379 Bacteria 1448194
519 Ga0268266_10000025 3300028379 Bacteria 477143
520 Ga0268266_10005105 3300028379 Bacteria 12373
521 Ga0268266_10022606 3300028379 Bacteria 5354
522 Ga0268266_10086830 3300028379 Bacteria 2735
523 Ga0268266_10092535 3300028379 Bacteria 2653
524 Ga0268266_10130507 3300028379 Bacteria 2247
525 Ga0268265_10000546 3300028380 Bacteria 38362
526 Ga0268265_10068698 3300028380 Bacteria 2749
527 Ga0268265_10078283 3300028380 Bacteria 2600
528 Ga0268264_10000037 3300028381 Bacteria 391116
529 Ga0268264_10000040 3300028381 Bacteria 373714
530 Ga0265319_1005754 3300028563 Bacteria 5866
531 Ga0265334_10008603 3300028573 Bacteria 4335
532 Ga0265334_10011594 3300028573 Bacteria 3707
533 Ga0265334_10011837 3300028573 Bacteria 3666
534 Ga0265318_10002977 3300028577 Bacteria 8757
535 Ga0265338_10000006 3300028800 Bacteria 570804
536 Ga0265338_10002483 3300028800 Bacteria 27550
537 Ga0265338_10044259 3300028800 Bacteria 4113
538 Ga0265338_10058659 3300028800 Bacteria 3395
539 Ga0265338_10070019 3300028800 Bacteria 3010
540 Ga0265770_1005470 3300030878 Bacteria 1751
541 Ga0265760_10003762 3300031090 Bacteria 4397
542 Ga0265330_10003121 3300031235 Bacteria 8776
543 Ga0265328_10003515 3300031239 Bacteria 6916
544 Ga0265320_10000097 3300031240 Bacteria 74341
545 Ga0265325_10000003 3300031241 Bacteria 370490
546 Ga0265325_10000288 3300031241 Bacteria 35410
547 Ga0265325_10000743 3300031241 Bacteria 23567
548 Ga0265325_10001279 3300031241 Bacteria 17862
549 Ga0265325_10002615 3300031241 Bacteria 12057
550 Ga0265329_10002699 3300031242 Bacteria 7977
551 Ga0265340_10000024 3300031247 Bacteria 77206
552 Ga0265340_10018922 3300031247 Bacteria 3549
553 Ga0265339_10001397 3300031249 Bacteria 17979
554 Ga0265339_10005993 3300031249 Bacteria 8032
555 Ga0265339_10006155 3300031249 Bacteria 7905
556 Ga0265339_10033971 3300031249 Bacteria 2869
557 Ga0265331_10005229 3300031250 Bacteria 7867
558 Ga0265331_10009466 3300031250 Bacteria 5467
559 Ga0265331_10009969 3300031250 Bacteria 5284
560 Ga0265331_10037946 3300031250 Bacteria 2357
561 Ga0265331_10042384 3300031250 Bacteria 2208
562 Ga0265331_10046524 3300031250 Bacteria 2091
563 Ga0265327_10000277 3300031251 Bacteria 101027
564 Ga0265327_10030959 3300031251 Bacteria 3014
565 Ga0265316_10004163 3300031344 Bacteria 14457
566 Ga0265316_10009472 3300031344 Bacteria 8971
567 Ga0265316_10013314 3300031344 Bacteria 7314
568 Ga0265316_10032753 3300031344 Bacteria 4239
569 Ga0265316_10075730 3300031344 Bacteria 2587
570 Ga0307513_10012412 3300031456 Bacteria 10517
571 Ga0307513_10080907 3300031456 Bacteria 3349
572 Ga0265313_10001888 3300031595 Bacteria 19036
573 Ga0265313_10002246 3300031595 Bacteria 16980
574 Ga0265313_10002257 3300031595 Bacteria 16935
575 Ga0265313_10004451 3300031595 Bacteria 10762
576 Ga0307508_10004809 3300031616 Bacteria 13025
577 Ga0265314_10000127 3300031711 Bacteria 116458
578 Ga0265314_10001042 3300031711 Bacteria 32320
579 Ga0265314_10008305 3300031711 Bacteria 8907
580 Ga0265314_10013481 3300031711 Bacteria 6598
581 Ga0265342_10005393 3300031712 Bacteria 9766
582 Ga0265342_10007568 3300031712 Bacteria 7930
583 Ga0265342_10027644 3300031712 Bacteria 3541
584 Ga0265342_10046675 3300031712 Bacteria 2602
585 Ga0307516_10000131 3300031730 Bacteria 89180
586 Ga0307516_10052680 3300031730 Bacteria 3982
587 Ga0307412_10061306 3300031911 Bacteria 2528
588 Ga0316583_10001947 3300032133 Bacteria 7050
589 Ga0307510_10000018 3300033180 Bacteria 192986
590 Ga0307510_10099455 3300033180 Bacteria 2707
591 Ga0373934_0014566 3300035086 Bacteria 2982
592 Ga0373944_0002685 3300035089 Bacteria 4535
593 Ga0373944_0007486 3300035089 Bacteria 2929
594 Ga0373936_0049284 3300035113 Bacteria 1701
595 Ga0373945_0003970 3300035116 Bacteria 4676
596 Ga0373943_0000765 3300035170 Bacteria 14011
597 Ga0373946_0006882 3300035171 Bacteria 4139
598 Ga0373946_0007215 3300035171 Bacteria 4057
599 Ga0373955_0005661 3300035172 Bacteria 5625
600 Ga0373955_0029658 3300035172 Bacteria 2848
601 Ga0373931_0006910 3300035691 Bacteria 5339
602 Ga0373931_0007877 3300035691 Bacteria 5038
603 Ga0373935_0008313 3300035692 Bacteria 6207
604 Ga0373935_0123494 3300035692 Bacteria 1732
605 Ga0373927_0006832 3300035695 Bacteria 7766
606 Ga0373927_0016267 3300035695 Bacteria 4909
607 Ga0373927_0022373 3300035695 Bacteria 4142
608 Ga0373933_0019397 3300035724 Bacteria 3841
609 Ga0373947_0041128 3300035725 Bacteria 2755
610 Ga0373937_0000403 3300036401 Bacteria 40423
611 Ga0373937_0006777 3300036401 Bacteria 9890
612 Ga0373937_0008757 3300036401 Bacteria 8782
613 Ga0373937_0102928 3300036401 Bacteria 2652
614 Ga0373937_0128278 3300036401 Bacteria 2367
615 Ga0316582_0006770 3300036647 Bacteria 6050
616 Ga0373925_0014594 3300037068 Bacteria 5675
617 Ga0395899_0000026 3300037312 Bacteria 345291
618 Ga0395899_0000083 3300037312 Bacteria 161878
619 Ga0395899_0022292 3300037312 Bacteria 4803
620 Ga0395899_0072225 3300037312 Bacteria 2525
621 Ga0395899_0075040 3300037312 Bacteria 2470
622 Ga0395900_0000004 3300037418 Bacteria 564908
623 Ga0395900_0003046 3300037418 Bacteria 18261
624 Ga0395900_0010154 3300037418 Bacteria 9633
625 Ga0395900_0023413 3300037418 Bacteria 6322
626 Ga0395900_0128485 3300037418 Bacteria 2598
627 Ga0395898_0004887 3300037466 Bacteria 14555
628 Ga0395898_0034151 3300037466 Bacteria 5071
629 Ga0395898_0051126 3300037466 Bacteria 4042
630 Ga0395905_0019066 3300037471 Bacteria 6507
631 Ga0395905_0064055 3300037471 Bacteria 3439
632 Ga0395905_0213067 3300037471 Bacteria 1809
633 Ga0436364_1065372 3300037853 Bacteria 196587
634 Ga0436364_1306621 3300037853 Bacteria 3415
635 Ga0395901_0000005 3300038443 Bacteria 544998
636 Ga0395901_0015348 3300038443 Bacteria 7795
637 Ga0395901_0057745 3300038443 Bacteria 4036
638 Ga0436365_0244982 3300039437 Bacteria 68861
639 Ga0436365_0701004 3300039437 Bacteria 2064
640 Ga0436365_1213514 3300039437 Bacteria 5097
641 Ga0436365_1437123 3300039437 Bacteria 2140
642 Ga0436365_1935932 3300039437 Bacteria 1947
643 Ga0436360_0261193 3300039438 Bacteria 7992
644 Ga0436360_0734790 3300039438 Bacteria 1967
645 Ga0436360_1175238 3300039438 Bacteria 4844
646 Ga0436360_1338455 3300039438 Bacteria 2621
647 Ga0436360_1357105 3300039438 Bacteria 3131
648 Ga0436361_0229100 3300039447 Bacteria 1869
649 Ga0436361_0748837 3300039447 Bacteria 5194
650 Ga0436363_0002125 3300039450 Bacteria 12690
651 Ga0436363_0900450 3300039450 Bacteria 5661
652 Ga0436363_1198730 3300039450 Bacteria 5969
653 Ga0436362_0727973 3300039453 Bacteria 1675
654 Ga0451837_0189484 3300041494 Bacteria 1924
655 Ga0439458_0000258 3300042157 Bacteria 12892
656 Ga0439458_0001938 3300042157 Bacteria 5132
657 Ga0451577_0016304 3300042876 Bacteria 6883
658 Ga0466969_0051939 3300044656 Bacteria 2015
659 Ga0453684_0024242 3300044712 Bacteria 8879
660 Ga0466968_0036450 3300044735 Bacteria 2061
661 Ga0466959_0022270 3300045049 Bacteria 4682
662 Ga0451576_0029838 3300045051 Bacteria 5833
663 Ga0466967_0080454 3300045976 Bacteria 2940
664 Ga0495592_0001006 3300046454 Bacteria 19583
665 Ga0495603_0001429 3300046455 Bacteria 13888
666 Ga0495603_0014354 3300046455 Bacteria 4790
667 Ga0495590_0034778 3300046457 Bacteria 1760
668 Ga0495629_0002180 3300046459 Bacteria 15122
669 Ga0495638_0000332 3300046460 Bacteria 59517
670 Ga0495651_0000185 3300046462 Bacteria 46374
671 Ga0495651_0069203 3300046462 Bacteria 2689
672 Ga0495653_0000831 3300046463 Bacteria 23809
673 Ga0495653_0005900 3300046463 Bacteria 10025
674 Ga0495580_0001325 3300046472 Bacteria 21840
675 Ga0495580_0002566 3300046472 Bacteria 15799
676 Ga0495580_0002924 3300046472 Bacteria 14678
677 Ga0495582_0000901 3300046473 Bacteria 16533
678 Ga0495662_0001229 3300046476 Bacteria 12618
679 Ga0495664_0000375 3300046477 Bacteria 21707
680 Ga0495584_0043759 3300046491 Bacteria 2260
681 Ga0495594_0000585 3300046499 Bacteria 18782
682 Ga0495583_0000030 3300046506 Bacteria 254970
683 Ga0495583_0013465 3300046506 Bacteria 4560
684 Ga0495608_0000598 3300046511 Bacteria 24822
685 Ga0495616_0064221 3300046513 Bacteria 1792
686 Ga0495618_0000619 3300046514 Bacteria 25221
687 Ga0495637_0061012 3300046520 Bacteria 1547
688 Ga0495643_0000991 3300046522 Bacteria 29043
689 Ga0495648_0000750 3300046524 Bacteria 34697
690 Ga0495663_0002995 3300046525 Bacteria 4964
691 Ga0495666_0032543 3300046526 Bacteria 2551
692 Ga0495666_0047429 3300046526 Bacteria 2069
693 Ga0495652_0001337 3300046529 Bacteria 27446
694 Ga0495665_0052331 3300046531 Bacteria 2162
695 Ga0495640_0007724 3300046533 Bacteria 8457
696 Ga0495640_0016879 3300046533 Bacteria 5454
697 Ga0495586_0005186 3300046535 Bacteria 6973
698 Ga0495645_0013392 3300046543 Bacteria 5796
699 Ga0495633_0001042 3300046558 Bacteria 22695
700 Ga0495667_0002126 3300046559 Bacteria 13187
701 Ga0495667_0197559 3300046559 Bacteria 1288
702 Ga0495668_0000007 3300046616 Bacteria 552902
703 Ga0495634_0001639 3300046642 Bacteria 19477
704 Ga0495634_0006401 3300046642 Bacteria 8950
705 Ga0495625_0000264 3300046660 Bacteria 81625
706 Ga0495625_0017790 3300046660 Bacteria 5556
707 Ga0495635_0000952 3300046663 Bacteria 19105
708 Ga0495635_0087499 3300046663 Bacteria 2132
709 Ga0495623_0025306 3300046679 Bacteria 3823
710 Ga0495647_0000615 3300046681 Bacteria 10509
711 Ga0495647_0011876 3300046681 Bacteria 2989
712 Ga0495647_0034798 3300046681 Bacteria 1889
713 Ga0495658_0001383 3300046683 Bacteria 12728
714 Ga0495669_0000197 3300046684 Bacteria 37314
715 Ga0495613_0010038 3300046689 Bacteria 7033
716 Ga0495613_0118510 3300046689 Bacteria 1903
717 Ga0495624_0021857 3300046690 Bacteria 4238
718 Ga0495600_0000663 3300046809 Bacteria 17927
719 Ga0495660_0096138 3300046810 Bacteria 1531
720 Ga0495581_0005956 3300047315 Bacteria 7069
721 Ga0495604_0000478 3300047317 Bacteria 35243
722 Ga0495674_0001761 3300047319 Bacteria 21319
723 Ga0495674_0013013 3300047319 Bacteria 7831
724 Ga0495676_0027380 3300047321 Bacteria 4888
725 Ga0495680_0000640 3300047322 Bacteria 39222
726 Ga0495687_000178 3300047443 Bacteria 93234
727 Ga0495687_000511 3300047443 Bacteria 46733
728 Ga0495673_0018100 3300047469 Bacteria 3562
729 Ga0495681_0005817 3300047470 Bacteria 8192
730 Ga0495684_0017312 3300047471 Bacteria 5547
731 Ga0495684_0093828 3300047471 Bacteria 2273
732 Ga0495686_0000063 3300047472 Bacteria 228575
733 Ga0495686_0000202 3300047472 Bacteria 110778
734 Ga0495686_0000314 3300047472 Bacteria 81139
735 Ga0495686_0002137 3300047472 Bacteria 19318
736 Ga0495686_0002426 3300047472 Bacteria 17624
737 Ga0495686_0004291 3300047472 Bacteria 11807
738 Ga0495593_0000868 3300047673 Bacteria 17512
739 Ga0495593_0003121 3300047673 Bacteria 9957
740 Ga0495602_0007281 3300048088 Bacteria 11583
741 Ga0495614_0011927 3300048089 Bacteria 3819
742 Ga0496101_0017440 3300048904 Bacteria 4870
743 Ga0496101_0052742 3300048904 Bacteria 2933
744 Ga0496102_0000049 3300048905 Bacteria 179480
745 Ga0496102_0039292 3300048905 Bacteria 4275
746 Ga0496103_0000037 3300048906 Bacteria 179474
747 Ga0496103_0000647 3300048906 Bacteria 26335
748 Ga0496103_0001988 3300048906 Bacteria 13196
749 Ga0496103_0002748 3300048906 Bacteria 10979
750 Ga0496103_0029649 3300048906 Bacteria 3325
751 Ga0496103_0056896 3300048906 Bacteria 2428
752 Ga0496104_0000564 3300048907 Bacteria 31627
753 Ga0496104_0002243 3300048907 Bacteria 16675
754 Ga0496104_0013359 3300048907 Bacteria 7399
755 Ga0496104_0013871 3300048907 Bacteria 7270
756 Ga0496104_0016404 3300048907 Bacteria 6728
757 Ga0496104_0032096 3300048907 Bacteria 4888
758 Ga0496104_0081544 3300048907 Bacteria 3085
759 Ga0496104_0134226 3300048907 Bacteria 2378
760 Ga0496104_0140123 3300048907 Bacteria 2324
761 Ga0496105_0000342 3300048908 Bacteria 30591
762 Ga0496105_0000715 3300048908 Bacteria 22456
763 Ga0496105_0006258 3300048908 Bacteria 9140
764 Ga0496105_0006737 3300048908 Bacteria 8833
765 Ga0496105_0036602 3300048908 Bacteria 4043
766 Ga0496106_0012103 3300048909 Bacteria 6367
767 Ga0496106_0029366 3300048909 Bacteria 4097
768 Ga0496106_0034060 3300048909 Bacteria 3803
769 Ga0496106_0040178 3300048909 Bacteria 3503
770 Ga0496107_0001624 3300048910 Bacteria 14007
771 Ga0496107_0007276 3300048910 Bacteria 7627
772 Ga0496107_0095295 3300048910 Bacteria 2178
773 Ga0496108_0001959 3300048911 Bacteria 16485
774 Ga0496108_0020753 3300048911 Bacteria 5400
775 Ga0496109_0000673 3300048912 Bacteria 28328
776 Ga0496109_0038257 3300048912 Bacteria 4337
777 Ga0496109_0041071 3300048912 Bacteria 4191
778 Ga0496110_0003774 3300048913 Bacteria 11666
779 Ga0496110_0060818 3300048913 Bacteria 3332
780 Ga0496111_0000369 3300048914 Bacteria 22401
781 Ga0496111_0067133 3300048914 Bacteria 2605
782 Ga0496112_0000606 3300048915 Bacteria 24671
783 Ga0496112_0017906 3300048915 Bacteria 6666
784 Ga0496112_0215811 3300048915 Bacteria 1875
785 Ga0496113_0001322 3300048916 Bacteria 13703
786 Ga0496113_0067158 3300048916 Bacteria 2718
787 Ga0496113_0084950 3300048916 Bacteria 2431
788 Ga0496114_0000708 3300048917 Bacteria 24844
789 Ga0496114_0058220 3300048917 Bacteria 3226
790 Ga0496115_0000416 3300048918 Bacteria 34725
791 Ga0496115_0001862 3300048918 Bacteria 15087
792 Ga0496115_0007532 3300048918 Bacteria 8017
793 Ga0496115_0050728 3300048918 Bacteria 3325
794 Ga0496115_0174840 3300048918 Bacteria 1775
795 Ga0496116_0003410 3300048919 Bacteria 15719
796 Ga0496116_0023524 3300048919 Bacteria 4586
797 Ga0496117_0000115 3300048920 Bacteria 179488
798 Ga0496117_0000249 3300048920 Bacteria 101472
799 Ga0496117_0001241 3300048920 Bacteria 38164
800 Ga0496117_0030507 3300048920 Bacteria 4136
801 Ga0496118_0000086 3300048921 Bacteria 179488
802 Ga0496118_0000580 3300048921 Bacteria 60421
803 Ga0496118_0000802 3300048921 Bacteria 50216
804 Ga0496118_0011692 3300048921 Bacteria 8531
805 Ga0496118_0017141 3300048921 Bacteria 6609
806 Ga0496119_0001855 3300048922 Bacteria 24389
807 Ga0496120_0000014 3300048923 Bacteria 323163
808 Ga0496120_0010570 3300048923 Bacteria 6424
809 Ga0496120_0014577 3300048923 Bacteria 5232
810 Ga0496121_0000087 3300048924 Bacteria 222451
811 Ga0496121_0000387 3300048924 Bacteria 89835
812 Ga0496121_0000529 3300048924 Bacteria 72533
813 Ga0496121_0000931 3300048924 Bacteria 52909
814 Ga0496121_0001436 3300048924 Bacteria 40248
815 Ga0496121_0003691 3300048924 Bacteria 21490
816 Ga0496121_0028861 3300048924 Bacteria 5152
817 Ga0496122_0009815 3300048925 Bacteria 9998
818 Ga0496122_0011384 3300048925 Bacteria 9017
819 Ga0496123_0000569 3300048926 Bacteria 63009
820 Ga0496123_0001083 3300048926 Bacteria 41036
821 Ga0496124_0000102 3300048927 Bacteria 179488
822 Ga0496124_0000626 3300048927 Bacteria 58823
823 Ga0496125_0001330 3300048928 Bacteria 36490
824 Ga0496125_0005669 3300048928 Bacteria 13779
825 Ga0496125_0157362 3300048928 Bacteria 1550
826 Ga0496126_0000752 3300048929 Bacteria 58828
827 Ga0496126_0001751 3300048929 Bacteria 32139
828 Ga0496126_0028093 3300048929 Bacteria 5364
829 Ga0496126_0066390 3300048929 Bacteria 3225
830 Ga0501032_0117607 3300049569 Bacteria 1758
831 Ga0501033_0017457 3300049570 Bacteria 5421
832 Ga0501033_0025268 3300049570 Bacteria 4474
833 Ga0501033_0042213 3300049570 Bacteria 3401
834 Ga0501034_0000008 3300049571 Bacteria 354712
835 Ga0501034_0029849 3300049571 Bacteria 5541
836 Ga0501036_0002203 3300049572 Bacteria 15235
837 Ga0501038_0018620 3300049574 Bacteria 6272
838 Ga0501039_0000061 3300049575 Bacteria 85455
839 Ga0501039_0049088 3300049575 Bacteria 3262
840 Ga0501040_0001802 3300049576 Bacteria 13756
841 Ga0501040_0134042 3300049576 Bacteria 1743
842 Ga0501042_0010042 3300049578 Bacteria 6330
843 Ga0501046_0009690 3300049580 Bacteria 8308
844 Ga0501046_0011140 3300049580 Bacteria 7702
845 Ga0501047_0000095 3300049581 Bacteria 108671
846 Ga0501047_0004823 3300049581 Bacteria 12672
847 Ga0501047_0008015 3300049581 Bacteria 9963
848 Ga0501047_0069987 3300049581 Bacteria 3378
849 Ga0501048_0026713 3300049582 Bacteria 4202
850 Ga0501048_0112611 3300049582 Bacteria 1922
851 Ga0501067_0003439 3300049583 Bacteria 8716
852 Ga0501067_0036505 3300049583 Bacteria 2728
853 Ga0501072_0000883 3300049588 Bacteria 21971
854 Ga0501072_0005783 3300049588 Bacteria 9418
855 Ga0501073_0013480 3300049589 Bacteria 5946
856 Ga0501075_0000015 3300049591 Bacteria 73176
857 Ga0501076_0000009 3300049592 Bacteria 117970
858 Ga0501077_0018297 3300049593 Bacteria 4434
859 Ga0501080_0000013 3300049742 Bacteria 103178
860 Ga0501081_0002218 3300049743 Bacteria 12224
861 Ga0501035_0000013 3300049822 Bacteria 255756
862 Ga0501044_0000004 3300049823 Bacteria 327475
863 Ga0501044_0044050 3300049823 Bacteria 4634
864 Ga0501044_0076940 3300049823 Bacteria 3385
865 Ga0501044_0143805 3300049823 Bacteria 2372
866 Ga0501045_0136393 3300049824 Bacteria 1824
867 nmdc:mga03683_23_c1 3300050489 Bacteria 80877
868 nmdc:mga03n38_1015_c1 3300050490 Bacteria 7689
869 nmdc:mga00v17_26511_c1 3300050491 Bacteria 3378
870 nmdc:mga00v17_89719_c1 3300050491 Bacteria 1929
871 nmdc:mga0yw44_14861_c1 3300050492 Bacteria 4150
872 nmdc:mga0k408_111780_c1 3300050493 Bacteria 1615
873 nmdc:mga0k408_19_c1 3300050493 Bacteria 112120
874 nmdc:mga07m45_31_c1 3300050496 Bacteria 81959
875 nmdc:mga05p37_10245_c1 3300050507 Bacteria 11130
876 nmdc:mga05p37_129232_c1 3300050507 Bacteria 3101
877 nmdc:mga05p37_172988_c1 3300050507 Bacteria 2633
878 nmdc:mga05p37_18115_c1 3300050507 Bacteria 8508
879 nmdc:mga05p37_2006_c1 3300050507 Bacteria 23767
880 nmdc:mga05p37_245_c1 3300050507 Bacteria 55562
881 nmdc:mga05p37_52807_c1 3300050507 Bacteria 4998
882 nmdc:mga09592_2823_c1 3300050508 Bacteria 14079
883 nmdc:mga09592_30121_c1 3300050508 Bacteria 4516
884 nmdc:mga09592_6212_c1 3300050508 Bacteria 9721
885 nmdc:mga09592_7451_c1 3300050508 Bacteria 8893
886 nmdc:mga0qj67_16758_c1 3300050509 Bacteria 5564
887 nmdc:mga0qj67_232_c1 3300050509 Bacteria 38070
888 nmdc:mga0qj67_69021_c1 3300050509 Bacteria 2818
889 nmdc:mga06r32_33494_c1 3300050510 Bacteria 4839
890 nmdc:mga06r32_36726_c1 3300050510 Bacteria 4632
891 nmdc:mga06r32_45268_c1 3300050510 Bacteria 4194
892 nmdc:mga08y16_15960_c1 3300050511 Bacteria 7896
893 nmdc:mga08y16_29430_c1 3300050511 Bacteria 5787
894 nmdc:mga08y16_42093_c1 3300050511 Bacteria 4784
895 nmdc:mga08y16_468_c1 3300050511 Bacteria 37480
896 nmdc:mga0n895_105232_c1 3300050512 Bacteria 2834
897 nmdc:mga0n895_24439_c1 3300050512 Bacteria 5694
898 nmdc:mga0n895_6448_c1 3300050512 Bacteria 9964
899 nmdc:mga0rr50_151071_c1 3300050513 Bacteria 1877
900 nmdc:mga0rr50_44562_c1 3300050513 Bacteria 3254
901 nmdc:mga0rr50_5665_c1 3300050513 Bacteria 7479
902 nmdc:mga08x19_52_c1 3300050514 Bacteria 123790
903 nmdc:mga0a205_140973_c1 3300050515 Bacteria 2311
904 nmdc:mga0a205_159590_c1 3300050515 Bacteria 2152
905 nmdc:mga0a205_169483_c1 3300050515 Bacteria 2079
906 nmdc:mga0a205_194389_c1 3300050515 Bacteria 1920
907 nmdc:mga0a205_41228_c1 3300050515 Bacteria 4446
908 nmdc:mga0a205_7680_c1 3300050515 Bacteria 9783
909 nmdc:mga0a205_95522_c1 3300050515 Bacteria 2871
910 nmdc:mga0sz30_481_c3 3300050516 Bacteria 6951
911 Ga0495601_0000751 3300053077 Bacteria 17458
912 Ga0495601_0030784 3300053077 Bacteria 3333
913 Ga0495612_0000428 3300053078 Bacteria 16790
914 Ga0495612_0016650 3300053078 Bacteria 2946
915 Ga0500610_0014586 3300053079 Bacteria 3691
916 Ga0495655_0000422 3300053083 Bacteria 7176
917 Ga0495595_0000142 3300053084 Bacteria 29571
918 Ga0495619_0000533 3300053085 Bacteria 25127
919 Ga0495619_0003380 3300053085 Bacteria 10312
920 Ga0495619_0029419 3300053085 Bacteria 3548
921 Ga0495619_0042885 3300053085 Bacteria 2964
922 Ga0500643_001558 3300053087 Bacteria 12980
923 Ga0500651_0007408 3300053093 Bacteria 6408
924 Ga0500556_0000143 3300053104 Bacteria 59621
925 Ga0500592_000884 3300053116 Bacteria 4888
926 Ga0500618_000909 3300053125 Bacteria 15440
927 Ga0500573_0000028 3300053140 Bacteria 142610
928 Ga0500622_0001426 3300053156 Bacteria 19193
929 Ga0500624_000020 3300053157 Bacteria 118392
930 Ga0500645_000011 3300053730 Bacteria 169616
931 Ga0501084_0003161 3300054114 Bacteria 13316
932 Ga0587084_004998 3300059477 Bacteria 1548
933 Ga0501082_0002818 3300060353 Bacteria 15178
934 Ga0501082_0026409 3300060353 Bacteria 5004
935 Ga0530510_0000035 3300061734 Bacteria 61298
936 Ga0530510_0103281 3300061734 Bacteria 2084
937 2585262516 2582581305 Bacteria 4895574
938 2600200913 2599185354 Bacteria 4398675
939 2753765237 2751185897 Bacteria 5322941
940 8057102985 8057101203 Bacteria 5034064
941 Ga0068856_100007818
942 JGI24736J21556_1001509
943 JGI24741J21665_1003682
944 JGI24752J21851_1000027
945 JGI24740J21852_10003653
946 JGI24739J22299_10009686
947 JGI24739J22299_10009980
948 JGI24737J22298_10001928
949 JGI24737J22298_10006746
950 JGI24735J21928_10029735
951 JGI24750J21931_1000041
952 JGI24748J21848_1000096
953 JGI24738J21930_10003555
954 JGI24738J21930_10004883
955 JGI24034J26672_10000028
956 JGI24742J22300_10001008
957 JGI25165J46597_1000008
958 JGI25165J46597_1000297
959 JGI25165J46597_1000489
960 JGI25153J46596_10000113
961 JGI25153J46596_10000672
962 Ga0055525_1000051
963 Ga0055542_1000677
964 Ga0055542_1002995
965 Ga0055529_1000016
966 Ga0058863_11589608
967 Ga0058862_12249235
968 Ga0065165_1009874
969 Ga0065707_10081714
970 Ga0070658_10000116
971 Ga0070658_10002598
972 Ga0070658_10003253
973 Ga0070658_10018921
974 Ga0070658_10027870
975 Ga0070658_10093562
976 Ga0070676_10014080
977 Ga0070690_100000003
978 Ga0070690_100024373
979 Ga0070690_100036723
980 Ga0070670_100005173
981 Ga0070670_100081940
982 Ga0070666_10000006
983 Ga0070666_10000410
984 Ga0070680_100000166
985 Ga0070680_100047651
986 Ga0070680_100078812
987 Ga0070682_100044476
988 Ga0070660_100003168
989 Ga0070660_100040499
990 Ga0070660_100064491
991 Ga0070689_100013461
992 Ga0070689_100032566
993 Ga0070691_10001140
994 Ga0070692_10024711
995 Ga0070668_100029899
996 Ga0070669_100000014
997 Ga0070669_100066282
998 Ga0070671_100035911
999 Ga0070674_100000746
1000 Ga0070674_100018639
1001 Ga0070667_100024894
1002 Ga0070667_100069756
1003 Ga0070667_100143696
1004 Ga0070709_10007492
1005 Ga0070709_10013017
1006 Ga0070714_100000761
1007 Ga0070714_100007392
1008 Ga0070713_100000007
1009 Ga0070713_100010825
1010 Ga0070713_100041897
1011 Ga0070713_100130626
1012 Ga0070711_100003889
1013 Ga0070711_100012918
1014 Ga0070711_100035173
1015 Ga0070711_100047124
1016 Ga0070711_100048812
1017 Ga0070705_100002764
1018 Ga0070705_100093762
1019 Ga0070700_100074742
1020 Ga0070694_100035591
1021 Ga0070694_100050902
1022 Ga0070663_100007242
1023 Ga0070678_100000585
1024 Ga0070678_100094202
1025 Ga0070662_100008234
1026 Ga0070662_100026287
1027 Ga0070681_10000966
1028 Ga0070681_10002890
1029 Ga0070681_10003601
1030 Ga0070681_10020624
1031 Ga0070681_10154665
1032 Ga0070685_10000072
1033 Ga0070685_10021125
1034 Ga0070698_100032083
1035 Ga0070699_100023877
1036 Ga0070679_100008818
1037 Ga0070679_100022694
1038 Ga0070679_100058090
1039 Ga0070679_100067291
1040 Ga0070684_100087173
1041 Ga0070697_100008449
1042 Ga0070697_100101520
1043 Ga0070697_100104358
1044 Ga0070697_100147862
1045 Ga0068853_100004213
1046 Ga0068853_100065265
1047 Ga0070686_100000022
1048 Ga0070695_100018861
1049 Ga0070695_100055638
1050 Ga0070696_100143284
1051 Ga0070693_100006405
1052 Ga0070665_100000019
1053 Ga0070665_100000058
1054 Ga0070665_100002528
1055 Ga0070665_100009420
1056 Ga0070665_100024420
1057 Ga0070665_100035688
1058 Ga0070665_100125292
1059 Ga0070665_100147500
1060 Ga0070665_100221543
1061 Ga0070704_100052902
1062 Ga0070704_100126179
1063 Ga0070704_100181114
1064 Ga0068855_100003048
1065 Ga0068855_100003607
1066 Ga0068855_100032581
1067 Ga0068855_100220888
1068 Ga0068855_100244188
1069 Ga0068857_100023641
1070 Ga0068857_100035743
1071 Ga0068857_100076939
1072 Ga0068857_100154400
1073 Ga0068856_100000142
1074 Ga0068856_100040567
1075 Ga0068856_100060295
1076 Ga0070702_100025238
1077 Ga0070702_100049483
1078 Ga0068852_100000043
1079 Ga0068852_100043311
1080 Ga0068852_100053990
1081 Ga0068852_100081292
1082 Ga0068859_100002673
1083 Ga0068859_100022887
1084 Ga0068859_100047888
1085 Ga0068859_100051845
1086 Ga0068859_100062269
1087 Ga0068859_100064968
1088 Ga0068864_100000565
1089 Ga0068864_100004975
1090 Ga0068864_100010237
1091 Ga0068864_100040174
1092 Ga0068861_100000111
1093 Ga0068861_100008113
1094 Ga0068851_10004282
1095 Ga0068870_10064079
1096 Ga0068863_100000048
1097 Ga0068863_100000051
1098 Ga0068863_100095516
1099 Ga0068858_100000254
1100 Ga0068858_100110985
1101 Ga0068858_100113002
1102 Ga0068858_100161656
1103 Ga0068860_100000014
1104 Ga0068860_100000187
1105 Ga0068860_100083473
1106 Ga0068862_100023072
1107 Ga0068862_100062843
1108 Ga0081455_10000088
1109 Ga0081455_10017022
1110 Ga0081455_10028380
1111 Ga0081538_10052953
1112 Ga0081540_1004937
1113 Ga0081540_1055391
1114 Ga0070717_10004903
1115 Ga0075363_100009459
1116 Ga0075364_10134862
1117 Ga0070716_100012383
1118 Ga0070716_100021723
1119 Ga0070712_100000015
1120 Ga0070712_100001349
1121 Ga0070712_100022267
1122 Ga0075362_10000095
1123 Ga0075369_10002175
1124 Ga0075369_10046940
1125 Ga0075366_10024202
1126 Ga0097621_100000667
1127 Ga0097621_100045788
1128 Ga0075370_10000025
1129 Ga0075370_10099057
1130 Ga0068871_100006814
1131 Ga0068871_100073058
1132 Ga0075428_100000380
1133 Ga0075428_100061682
1134 Ga0075428_100073996
1135 Ga0075428_100142075
1136 Ga0075430_100007128
1137 Ga0075430_100037467
1138 Ga0075430_100055367
1139 Ga0075431_100012379
1140 Ga0075431_100018891
1141 Ga0075431_100053013
1142 Ga0075433_10001374
1143 Ga0075433_10064307
1144 Ga0075433_10070998
1145 Ga0075433_10109601
1146 Ga0075433_10181572
1147 Ga0075434_100000753
1148 Ga0075434_100014278
1149 Ga0075434_100019894
1150 Ga0075434_100030105
1151 Ga0075434_100045158
1152 Ga0075434_100054366
1153 Ga0075434_100111213
1154 Ga0075429_100000097
1155 Ga0075429_100002097
1156 Ga0075429_100012504
1157 Ga0068865_100002716
1158 Ga0075436_100000024
1159 Ga0097620_100002673
1160 Ga0097620_100022887
1161 Ga0097620_100047889
1162 Ga0097620_100051843
1163 Ga0097620_100062268
1164 Ga0097620_100064968
1165 Ga0075435_100020165
1166 Ga0075435_100048993
1167 Ga0075435_100063562
1168 Ga0099794_10004284
1169 Ga0099795_10000617
1170 Ga0099795_10001314
1171 Ga0099795_10001349
1172 Ga0105240_10000733
1173 Ga0105240_10022602
1174 Ga0105240_10023442
1175 Ga0105240_10034962
1176 Ga0105240_10036767
1177 Ga0105240_10055350
1178 Ga0105240_10061130
1179 Ga0105240_10186611
1180 Ga0105240_10350181
1181 Ga0111539_10001385
1182 Ga0111539_10006891
1183 Ga0111539_10007288
1184 Ga0111539_10021041
1185 Ga0111539_10033953
1186 Ga0105245_10001618
1187 Ga0105245_10027313
1188 Ga0105247_10025691
1189 Ga0114129_10000156
1190 Ga0114129_10000625
1191 Ga0114129_10014790
1192 Ga0114129_10021337
1193 Ga0114129_10056170
1194 Ga0114129_10067337
1195 Ga0114129_10098690
1196 Ga0105243_10000782
1197 Ga0105243_10021440
1198 Ga0105243_10047215
1199 Ga0105241_10001365
1200 Ga0105241_10003444
1201 Ga0105241_10007433
1202 Ga0105241_10042106
1203 Ga0105241_10066259
1204 Ga0105242_10029836
1205 Ga0105242_10039657
1206 Ga0105242_10075685
1207 Ga0105248_10002303
1208 Ga0105248_10007409
1209 Ga0105248_10013887
1210 Ga0105248_10044462
1211 Ga0105248_10071941
1212 Ga0105248_10075907
1213 Ga0105248_10096555
1214 Ga0105248_10257644
1215 Ga0105237_10002363
1216 Ga0105237_10030182
1217 Ga0105238_10001921
1218 Ga0105238_10013158
1219 Ga0105238_10060392
1220 Ga0105238_10125721
1221 Ga0105238_10193015
1222 Ga0105249_10000104
1223 Ga0105249_10006192
1224 Ga0099796_10002367
1225 Ga0099796_10003638
1226 Ga0099796_10009676
1227 Ga0105239_10000138
1228 Ga0105239_10024748
1229 Ga0105239_10067661
1230 Ga0105239_10085669
1231 Ga0105239_10097212
1232 Ga0157371_10000146
1233 Ga0157370_10000503
1234 Ga0157370_10001658
1235 Ga0157370_10024422
1236 Ga0157369_10009865
1237 Ga0157369_10038161
1238 Ga0157369_10055615
1239 Ga0157378_10044499
1240 Ga0157378_10059554
1241 Ga0157378_10104103
1242 Ga0163162_10002269
1243 Ga0163162_10014904
1244 Ga0163162_10103353
1245 Ga0163162_10138786
1246 Ga0163162_10180379
1247 Ga0157372_10110327
1248 Ga0157372_10151050
1249 Ga0157372_10234477
1250 Ga0157372_10369694
1251 Ga0157375_10029036
1252 Ga0163163_10000016
1253 Ga0163163_10006398
1254 Ga0163163_10102214
1255 Ga0157380_10000181
1256 Ga0157380_10006753
1257 Ga0157380_10070190
1258 Ga0157379_10019689
1259 Ga0157379_10039312
1260 Ga0157376_10132985
1261 Ga0163161_10000020
1262 Ga0206356_11622843
1263 Ga0213872_10033254
1264 Ga0213872_10056105
1265 Ga0213874_10005997
1266 Ga0213875_10000228
1267 Ga0213871_10003950
1268 Ga0213871_10006546
1269 Ga0207672_1000860
1270 Ga0209674_101931
1271 Ga0209563_100019
1272 Ga0207427_100640
1273 Ga0209437_105888
1274 Ga0209148_1000017
1275 Ga0209148_1000061
1276 Ga0209233_1000006
1277 Ga0209233_1000107
1278 Ga0209233_1000382
1279 Ga0209455_1000005
1280 Ga0209455_1011665
1281 Ga0209758_1000035
1282 Ga0207656_10008826
1283 Ga0207682_10040825
1284 Ga0207642_10013804
1285 Ga0207680_10000011
1286 Ga0207680_10031022
1287 Ga0207647_10000527
1288 Ga0207647_10001094
1289 Ga0207647_10004311
1290 Ga0207647_10046770
1291 Ga0207685_10006206
1292 Ga0207699_10000660
1293 Ga0207699_10006424
1294 Ga0207699_10016427
1295 Ga0207699_10077254
1296 Ga0207643_10029831
1297 Ga0207643_10052068
1298 Ga0207705_10001001
1299 Ga0207705_10001461
1300 Ga0207705_10007867
1301 Ga0207705_10083646
1302 Ga0207684_10014178
1303 Ga0207654_10002077
1304 Ga0207654_10018498
1305 Ga0207654_10043009
1306 Ga0207707_10000489
1307 Ga0207707_10005090
1308 Ga0207707_10013886
1309 Ga0207707_10017985
1310 Ga0207707_10046484
1311 Ga0207707_10091488
1312 Ga0207695_10001560
1313 Ga0207695_10002853
1314 Ga0207695_10005233
1315 Ga0207695_10024058
1316 Ga0207695_10036449
1317 Ga0207695_10047816
1318 Ga0207695_10053266
1319 Ga0207695_10130979
1320 Ga0207695_10218075
1321 Ga0207695_10249326
1322 Ga0207671_10000545
1323 Ga0207671_10001056
1324 Ga0207693_10000048
1325 Ga0207693_10000560
1326 Ga0207693_10001691
1327 Ga0207693_10015924
1328 Ga0207693_10017466
1329 Ga0207663_10007856
1330 Ga0207663_10010584
1331 Ga0207663_10069844
1332 Ga0207660_10083282
1333 Ga0207662_10035528
1334 Ga0207657_10000273
1335 Ga0207657_10004635
1336 Ga0207657_10006527
1337 Ga0207657_10015118
1338 Ga0207657_10020578
1339 Ga0207649_10000110
1340 Ga0207649_10000114
1341 Ga0207649_10000145
1342 Ga0207652_10000684
1343 Ga0207652_10046597
1344 Ga0207652_10061117
1345 Ga0207646_10057041
1346 Ga0207681_10000045
1347 Ga0207681_10010321
1348 Ga0207694_10006559
1349 Ga0207694_10014019
1350 Ga0207694_10018421
1351 Ga0207694_10031100
1352 Ga0207694_10036445
1353 Ga0207694_10037901
1354 Ga0207650_10003631
1355 Ga0207650_10071659
1356 Ga0207659_10108997
1357 Ga0207687_10003650
1358 Ga0207687_10018062
1359 Ga0207700_10000014
1360 Ga0207664_10029137
1361 Ga0207644_10000777
1362 Ga0207644_10080787
1363 Ga0207690_10019724
1364 Ga0207690_10092240
1365 Ga0207706_10015816
1366 Ga0207706_10017873
1367 Ga0207706_10022694
1368 Ga0207706_10111941
1369 Ga0207686_10007035
1370 Ga0207686_10025035
1371 Ga0207709_10000031
1372 Ga0207709_10007200
1373 Ga0207709_10013817
1374 Ga0207670_10001555
1375 Ga0207670_10020384
1376 Ga0207669_10000365
1377 Ga0207669_10008618
1378 Ga0207704_10063934
1379 Ga0207665_10018330
1380 Ga0207711_10000635
1381 Ga0207711_10012614
1382 Ga0207711_10035930
1383 Ga0207711_10038895
1384 Ga0207711_10104798
1385 Ga0207689_10032638
1386 Ga0207689_10099436
1387 Ga0207679_10122118
1388 Ga0207679_10157488
1389 Ga0207667_10003961
1390 Ga0207667_10005502
1391 Ga0207667_10027048
1392 Ga0207712_10000013
1393 Ga0207712_10023320
1394 Ga0207712_10072997
1395 Ga0207668_10010144
1396 Ga0207668_10033681
1397 Ga0207668_10048576
1398 Ga0207658_10008004
1399 Ga0207658_10021603
1400 Ga0207658_10054258
1401 Ga0207677_10093069
1402 Ga0207677_10167759
1403 Ga0207703_10000255
1404 Ga0207703_10003947
1405 Ga0207703_10028124
1406 Ga0207703_10054150
1407 Ga0207703_10066182
1408 Ga0207639_10000516
1409 Ga0207639_10002060
1410 Ga0207678_10003934
1411 Ga0207678_10005571
1412 Ga0207678_10121480
1413 Ga0207678_10216873
1414 Ga0207708_10057466
1415 Ga0207708_10113490
1416 Ga0207702_10000066
1417 Ga0207702_10003870
1418 Ga0207702_10010628
1419 Ga0207702_10021440
1420 Ga0207702_10119280
1421 Ga0207702_10148270
1422 Ga0207641_10000143
1423 Ga0207641_10000675
1424 Ga0207641_10026641
1425 Ga0207641_10167906
1426 Ga0207648_10038998
1427 Ga0207648_10149402
1428 Ga0207648_10194746
1429 Ga0207676_10000214
1430 Ga0207676_10007631
1431 Ga0207676_10008620
1432 Ga0207676_10032822
1433 Ga0207674_10017008
1434 Ga0207674_10027113
1435 Ga0207674_10040487
1436 Ga0207674_10057342
1437 Ga0207674_10078266
1438 Ga0207674_10206874
1439 Ga0207675_100000019
1440 Ga0207675_100007046
1441 Ga0207675_100031913
1442 Ga0207683_10001302
1443 Ga0207683_10031662
1444 Ga0207683_10064514
1445 Ga0207698_10000449
1446 Ga0207698_10042838
1447 Ga0207698_10180578
1448 Ga0207698_10233280
1449 Ga0209179_1002970
1450 Ga0209588_1005047
1451 Ga0209588_1024292
1452 Ga0207428_10000009
1453 Ga0207428_10000199
1454 Ga0207428_10006052
1455 Ga0207428_10011692
1456 Ga0265354_1001119
1457 Ga0265356_1001861
1458 Ga0268266_10000005
1459 Ga0268266_10000025
1460 Ga0268266_10005105
1461 Ga0268266_10022606
1462 Ga0268266_10086830
1463 Ga0268266_10092535
1464 Ga0268266_10130507
1465 Ga0268265_10000546
1466 Ga0268265_10068698
1467 Ga0268265_10078283
1468 Ga0268264_10000037
1469 Ga0268264_10000040
1470 Ga0265319_1005754
1471 Ga0265334_10008603
1472 Ga0265334_10011594
1473 Ga0265334_10011837
1474 Ga0265318_10002977
1475 Ga0265338_10000006
1476 Ga0265338_10002483
1477 Ga0265338_10044259
1478 Ga0265338_10058659
1479 Ga0265338_10070019
1480 Ga0265770_1005470
1481 Ga0265760_10003762
1482 Ga0265330_10003121
1483 Ga0265328_10003515
1484 Ga0265320_10000097
1485 Ga0265325_10000003
1486 Ga0265325_10000288
1487 Ga0265325_10000743
1488 Ga0265325_10001279
1489 Ga0265325_10002615
1490 Ga0265329_10002699
1491 Ga0265340_10000024
1492 Ga0265340_10018922
1493 Ga0265339_10001397
1494 Ga0265339_10005993
1495 Ga0265339_10006155
1496 Ga0265339_10033971
1497 Ga0265331_10005229
1498 Ga0265331_10009466
1499 Ga0265331_10009969
1500 Ga0265331_10037946
1501 Ga0265331_10042384
1502 Ga0265331_10046524
1503 Ga0265327_10000277
1504 Ga0265327_10030959
1505 Ga0265316_10004163
1506 Ga0265316_10009472
1507 Ga0265316_10013314
1508 Ga0265316_10032753
1509 Ga0265316_10075730
1510 Ga0307513_10012412
1511 Ga0307513_10080907
1512 Ga0265313_10001888
1513 Ga0265313_10002246
1514 Ga0265313_10002257
1515 Ga0265313_10004451
1516 Ga0307508_10004809
1517 Ga0265314_10000127
1518 Ga0265314_10001042
1519 Ga0265314_10008305
1520 Ga0265314_10013481
1521 Ga0265342_10005393
1522 Ga0265342_10007568
1523 Ga0265342_10027644
1524 Ga0265342_10046675
1525 Ga0307516_10000131
1526 Ga0307516_10052680
1527 Ga0307412_10061306
1528 Ga0316583_10001947
1529 Ga0307510_10000018
1530 Ga0307510_10099455
1531 Ga0373934_0014566
1532 Ga0373944_0002685
1533 Ga0373944_0007486
1534 Ga0373936_0049284
1535 Ga0373945_0003970
1536 Ga0373943_0000765
1537 Ga0373946_0006882
1538 Ga0373946_0007215
1539 Ga0373955_0005661
1540 Ga0373955_0029658
1541 Ga0373931_0006910
1542 Ga0373931_0007877
1543 Ga0373935_0008313
1544 Ga0373935_0123494
1545 Ga0373927_0006832
1546 Ga0373927_0016267
1547 Ga0373927_0022373
1548 Ga0373933_0019397
1549 Ga0373947_0041128
1550 Ga0373937_0000403
1551 Ga0373937_0006777
1552 Ga0373937_0008757
1553 Ga0373937_0102928
1554 Ga0373937_0128278
1555 Ga0316582_0006770
1556 Ga0373925_0014594
1557 Ga0395899_0000026
1558 Ga0395899_0000083
1559 Ga0395899_0022292
1560 Ga0395899_0072225
1561 Ga0395899_0075040
1562 Ga0395900_0000004
1563 Ga0395900_0003046
1564 Ga0395900_0010154
1565 Ga0395900_0023413
1566 Ga0395900_0128485
1567 Ga0395898_0004887
1568 Ga0395898_0034151
1569 Ga0395898_0051126
1570 Ga0395905_0019066
1571 Ga0395905_0064055
1572 Ga0395905_0213067
1573 Ga0436364_1065372
1574 Ga0436364_1306621
1575 Ga0395901_0000005
1576 Ga0395901_0015348
1577 Ga0395901_0057745
1578 Ga0436365_0244982
1579 Ga0436365_0701004
1580 Ga0436365_1213514
1581 Ga0436365_1437123
1582 Ga0436365_1935932
1583 Ga0436360_0261193
1584 Ga0436360_0734790
1585 Ga0436360_1175238
1586 Ga0436360_1338455
1587 Ga0436360_1357105
1588 Ga0436361_0229100
1589 Ga0436361_0748837
1590 Ga0436363_0002125
1591 Ga0436363_0900450
1592 Ga0436363_1198730
1593 Ga0436362_0727973
1594 Ga0451837_0189484
1595 Ga0439458_0000258
1596 Ga0439458_0001938
1597 Ga0451577_0016304
1598 Ga0466969_0051939
1599 Ga0453684_0024242
1600 Ga0466968_0036450
1601 Ga0466959_0022270
1602 Ga0451576_0029838
1603 Ga0466967_0080454
1604 Ga0495592_0001006
1605 Ga0495603_0001429
1606 Ga0495603_0014354
1607 Ga0495590_0034778
1608 Ga0495629_0002180
1609 Ga0495638_0000332
1610 Ga0495651_0000185
1611 Ga0495651_0069203
1612 Ga0495653_0000831
1613 Ga0495653_0005900
1614 Ga0495580_0001325
1615 Ga0495580_0002566
1616 Ga0495580_0002924
1617 Ga0495582_0000901
1618 Ga0495662_0001229
1619 Ga0495664_0000375
1620 Ga0495584_0043759
1621 Ga0495594_0000585
1622 Ga0495583_0000030
1623 Ga0495583_0013465
1624 Ga0495608_0000598
1625 Ga0495616_0064221
1626 Ga0495618_0000619
1627 Ga0495637_0061012
1628 Ga0495643_0000991
1629 Ga0495648_0000750
1630 Ga0495663_0002995
1631 Ga0495666_0032543
1632 Ga0495666_0047429
1633 Ga0495652_0001337
1634 Ga0495665_0052331
1635 Ga0495640_0007724
1636 Ga0495640_0016879
1637 Ga0495586_0005186
1638 Ga0495645_0013392
1639 Ga0495633_0001042
1640 Ga0495667_0002126
1641 Ga0495667_0197559
1642 Ga0495668_0000007
1643 Ga0495634_0001639
1644 Ga0495634_0006401
1645 Ga0495625_0000264
1646 Ga0495625_0017790
1647 Ga0495635_0000952
1648 Ga0495635_0087499
1649 Ga0495623_0025306
1650 Ga0495647_0000615
1651 Ga0495647_0011876
1652 Ga0495647_0034798
1653 Ga0495658_0001383
1654 Ga0495669_0000197
1655 Ga0495613_0010038
1656 Ga0495613_0118510
1657 Ga0495624_0021857
1658 Ga0495600_0000663
1659 Ga0495660_0096138
1660 Ga0495581_0005956
1661 Ga0495604_0000478
1662 Ga0495674_0001761
1663 Ga0495674_0013013
1664 Ga0495676_0027380
1665 Ga0495680_0000640
1666 Ga0495687_000178
1667 Ga0495687_000511
1668 Ga0495673_0018100
1669 Ga0495681_0005817
1670 Ga0495684_0017312
1671 Ga0495684_0093828
1672 Ga0495686_0000063
1673 Ga0495686_0000202
1674 Ga0495686_0000314
1675 Ga0495686_0002137
1676 Ga0495686_0002426
1677 Ga0495686_0004291
1678 Ga0495593_0000868
1679 Ga0495593_0003121
1680 Ga0495602_0007281
1681 Ga0495614_0011927
1682 Ga0496101_0017440
1683 Ga0496101_0052742
1684 Ga0496102_0000049
1685 Ga0496102_0039292
1686 Ga0496103_0000037
1687 Ga0496103_0000647
1688 Ga0496103_0001988
1689 Ga0496103_0002748
1690 Ga0496103_0029649
1691 Ga0496103_0056896
1692 Ga0496104_0000564
1693 Ga0496104_0002243
1694 Ga0496104_0013359
1695 Ga0496104_0013871
1696 Ga0496104_0016404
1697 Ga0496104_0032096
1698 Ga0496104_0081544
1699 Ga0496104_0134226
1700 Ga0496104_0140123
1701 Ga0496105_0000342
1702 Ga0496105_0000715
1703 Ga0496105_0006258
1704 Ga0496105_0006737
1705 Ga0496105_0036602
1706 Ga0496106_0012103
1707 Ga0496106_0029366
1708 Ga0496106_0034060
1709 Ga0496106_0040178
1710 Ga0496107_0001624
1711 Ga0496107_0007276
1712 Ga0496107_0095295
1713 Ga0496108_0001959
1714 Ga0496108_0020753
1715 Ga0496109_0000673
1716 Ga0496109_0038257
1717 Ga0496109_0041071
1718 Ga0496110_0003774
1719 Ga0496110_0060818
1720 Ga0496111_0000369
1721 Ga0496111_0067133
1722 Ga0496112_0000606
1723 Ga0496112_0017906
1724 Ga0496112_0215811
1725 Ga0496113_0001322
1726 Ga0496113_0067158
1727 Ga0496113_0084950
1728 Ga0496114_0000708
1729 Ga0496114_0058220
1730 Ga0496115_0000416
1731 Ga0496115_0001862
1732 Ga0496115_0007532
1733 Ga0496115_0050728
1734 Ga0496115_0174840
1735 Ga0496116_0003410
1736 Ga0496116_0023524
1737 Ga0496117_0000115
1738 Ga0496117_0000249
1739 Ga0496117_0001241
1740 Ga0496117_0030507
1741 Ga0496118_0000086
1742 Ga0496118_0000580
1743 Ga0496118_0000802
1744 Ga0496118_0011692
1745 Ga0496118_0017141
1746 Ga0496119_0001855
1747 Ga0496120_0000014
1748 Ga0496120_0010570
1749 Ga0496120_0014577
1750 Ga0496121_0000087
1751 Ga0496121_0000387
1752 Ga0496121_0000529
1753 Ga0496121_0000931
1754 Ga0496121_0001436
1755 Ga0496121_0003691
1756 Ga0496121_0028861
1757 Ga0496122_0009815
1758 Ga0496122_0011384
1759 Ga0496123_0000569
1760 Ga0496123_0001083
1761 Ga0496124_0000102
1762 Ga0496124_0000626
1763 Ga0496125_0001330
1764 Ga0496125_0005669
1765 Ga0496125_0157362
1766 Ga0496126_0000752
1767 Ga0496126_0001751
1768 Ga0496126_0028093
1769 Ga0496126_0066390
1770 Ga0501032_0117607
1771 Ga0501033_0017457
1772 Ga0501033_0025268
1773 Ga0501033_0042213
1774 Ga0501034_0000008
1775 Ga0501034_0029849
1776 Ga0501036_0002203
1777 Ga0501038_0018620
1778 Ga0501039_0000061
1779 Ga0501039_0049088
1780 Ga0501040_0001802
1781 Ga0501040_0134042
1782 Ga0501042_0010042
1783 Ga0501046_0009690
1784 Ga0501046_0011140
1785 Ga0501047_0000095
1786 Ga0501047_0004823
1787 Ga0501047_0008015
1788 Ga0501047_0069987
1789 Ga0501048_0026713
1790 Ga0501048_0112611
1791 Ga0501067_0003439
1792 Ga0501067_0036505
1793 Ga0501072_0000883
1794 Ga0501072_0005783
1795 Ga0501073_0013480
1796 Ga0501075_0000015
1797 Ga0501076_0000009
1798 Ga0501077_0018297
1799 Ga0501080_0000013
1800 Ga0501081_0002218
1801 Ga0501035_0000013
1802 Ga0501044_0000004
1803 Ga0501044_0044050
1804 Ga0501044_0076940
1805 Ga0501044_0143805
1806 Ga0501045_0136393
1807 nmdc:mga03683_23_c1
1808 nmdc:mga03n38_1015_c1
1809 nmdc:mga00v17_26511_c1
1810 nmdc:mga00v17_89719_c1
1811 nmdc:mga0yw44_14861_c1
1812 nmdc:mga0k408_111780_c1
1813 nmdc:mga0k408_19_c1
1814 nmdc:mga07m45_31_c1
1815 nmdc:mga05p37_10245_c1
1816 nmdc:mga05p37_129232_c1
1817 nmdc:mga05p37_172988_c1
1818 nmdc:mga05p37_18115_c1
1819 nmdc:mga05p37_2006_c1
1820 nmdc:mga05p37_245_c1
1821 nmdc:mga05p37_52807_c1
1822 nmdc:mga09592_2823_c1
1823 nmdc:mga09592_30121_c1
1824 nmdc:mga09592_6212_c1
1825 nmdc:mga09592_7451_c1
1826 nmdc:mga0qj67_16758_c1
1827 nmdc:mga0qj67_232_c1
1828 nmdc:mga0qj67_69021_c1
1829 nmdc:mga06r32_33494_c1
1830 nmdc:mga06r32_36726_c1
1831 nmdc:mga06r32_45268_c1
1832 nmdc:mga08y16_15960_c1
1833 nmdc:mga08y16_29430_c1
1834 nmdc:mga08y16_42093_c1
1835 nmdc:mga08y16_468_c1
1836 nmdc:mga0n895_105232_c1
1837 nmdc:mga0n895_24439_c1
1838 nmdc:mga0n895_6448_c1
1839 nmdc:mga0rr50_151071_c1
1840 nmdc:mga0rr50_44562_c1
1841 nmdc:mga0rr50_5665_c1
1842 nmdc:mga08x19_52_c1
1843 nmdc:mga0a205_140973_c1
1844 nmdc:mga0a205_159590_c1
1845 nmdc:mga0a205_169483_c1
1846 nmdc:mga0a205_194389_c1
1847 nmdc:mga0a205_41228_c1
1848 nmdc:mga0a205_7680_c1
1849 nmdc:mga0a205_95522_c1
1850 nmdc:mga0sz30_481_c3
1851 Ga0495601_0000751
1852 Ga0495601_0030784
1853 Ga0495612_0000428
1854 Ga0495612_0016650
1855 Ga0500610_0014586
1856 Ga0495655_0000422
1857 Ga0495595_0000142
1858 Ga0495619_0000533
1859 Ga0495619_0003380
1860 Ga0495619_0029419
1861 Ga0495619_0042885
1862 Ga0500643_001558
1863 Ga0500651_0007408
1864 Ga0500556_0000143
1865 Ga0500592_000884
1866 Ga0500618_000909
1867 Ga0500573_0000028
1868 Ga0500622_0001426
1869 Ga0500624_000020
1870 Ga0500645_000011
1871 Ga0501084_0003161
1872 Ga0587084_004998
1873 Ga0501082_0002818
1874 Ga0501082_0026409
1875 Ga0530510_0000035
1876 Ga0530510_0103281
1877 2585262516
1878 2600200913
1879 2753765237
1880 8057102985

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

217

379

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.7835 1 447
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.7768 195 448
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.7728 194 448
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.7611 1 447
5ul2-assembly1.cif.gz_A structure of apo, semet-labeled cobalamin-dependent s-adenosylmethionine radical enzyme oxsb 0.7609 1 370
ID Description Score Start End Superfamily
af_P96395_5_123_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8356 64 146 3.40.50.280
af_F1LV76_14_128_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8354 308 441 3.30.750.200
af_A0A0R0IRV7_127_250_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8343 307 435 3.30.750.200
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8308 309 440 3.30.750.200
af_Q2FZ02_212_444_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.814 197 440 3.80.30.20
ID Description Score Start End GO Terms
AF-F8XP96-F1-model_v4 deleted 0.9611 47 477
AF-F8XP96-F1-model_v4 deleted 0.9567 47 477
AF-A0A1Z4TG91-F1-model_v4 deleted 0.9556 2 480
AF-A0A4Q0T0U1-F1-model_v4 Fe-S oxidoreductase 0.9555 45 480 GO:0003824
GO:0005829
GO:0051539
AF-A0LMZ8-F1-model_v4 Radical SAM domain protein 0.9554 1 480 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051539

Map