F486307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 408 | 1880 | 471 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100007818|Ga0068856_1000078187 |
| Length | 491 |
| Sequence | MERARVHPRALRRRISTMKTLFLHPPSFGGYDGGAGARYQMKREVRSFWYPTWLAQPAALVEGSKLIDAPPHRLQFEDIAPEVHNRDLVVMHTSTPSFNSDVKIAEMIKSLKPDIKIGLIGAKVAVEPEKSLVAAPAVDFVARNEFDFTIKEVADGRAWSDIKGISYRNKEGAIVHNDDREVLENMDALPWVTPVYKRDLTIENYFGGYLKHPYISFYTGRGCKSRCTFCLWPQTVGGHRYRVRSVEDVVAEMQWAMHAFPQVKEYFFDDDTLTDNLPRVEALAKALGKLGVIWSCNAKANVPRRTLEIMKDNGLRLLLVGYESGNQQILFNIKKGMRVEFARRFTKDCHELGIKIHGTFILGLPGETKETIQQTLDFAKEMNPHTIQVSLAAPYPGTFLYRQAKENGWLYNEEIDLLTQEGTQIAPLSYPHLSHGEIFDSVEDFYKKFYFRPTKIAAIVAEMIASPQMMKRRLREGAEFFRFLRTRHDTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 204 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 338 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 339 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 340 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 341 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 394 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 398 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 399 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 405 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 406 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 407 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 408 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 0.64 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.21 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 83.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100007818 | 3300005614 | Bacteria | 10439 |
| 2 | JGI24736J21556_1001509 | 3300001904 | Bacteria | 4250 |
| 3 | JGI24741J21665_1003682 | 3300001915 | Bacteria | 3583 |
| 4 | JGI24752J21851_1000027 | 3300001976 | Bacteria | 17325 |
| 5 | JGI24740J21852_10003653 | 3300001979 | Bacteria | 6700 |
| 6 | JGI24739J22299_10009686 | 3300001989 | Bacteria | 3586 |
| 7 | JGI24739J22299_10009980 | 3300001989 | Bacteria | 3531 |
| 8 | JGI24737J22298_10001928 | 3300001990 | Bacteria | 7416 |
| 9 | JGI24737J22298_10006746 | 3300001990 | Bacteria | 3903 |
| 10 | JGI24735J21928_10029735 | 3300002067 | Bacteria | 1625 |
| 11 | JGI24750J21931_1000041 | 3300002070 | Bacteria | 17174 |
| 12 | JGI24748J21848_1000096 | 3300002074 | Bacteria | 23684 |
| 13 | JGI24738J21930_10003555 | 3300002075 | Bacteria | 3911 |
| 14 | JGI24738J21930_10004883 | 3300002075 | Bacteria | 3254 |
| 15 | JGI24034J26672_10000028 | 3300002239 | Bacteria | 105058 |
| 16 | JGI24742J22300_10001008 | 3300002244 | Bacteria | 4339 |
| 17 | JGI25165J46597_1000008 | 3300003214 | Bacteria | 478603 |
| 18 | JGI25165J46597_1000297 | 3300003214 | Bacteria | 62745 |
| 19 | JGI25165J46597_1000489 | 3300003214 | Bacteria | 38233 |
| 20 | JGI25153J46596_10000113 | 3300003215 | Bacteria | 92345 |
| 21 | JGI25153J46596_10000672 | 3300003215 | Bacteria | 20919 |
| 22 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 23 | Ga0055542_1000677 | 3300003762 | Bacteria | 27414 |
| 24 | Ga0055542_1002995 | 3300003762 | Bacteria | 4926 |
| 25 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 26 | Ga0058863_11589608 | 3300004799 | Bacteria | 1683 |
| 27 | Ga0058862_12249235 | 3300004803 | Bacteria | 1678 |
| 28 | Ga0065165_1009874 | 3300005262 | Bacteria | 4210 |
| 29 | Ga0065707_10081714 | 3300005295 | Bacteria | 75872 |
| 30 | Ga0070658_10000116 | 3300005327 | Bacteria | 71744 |
| 31 | Ga0070658_10002598 | 3300005327 | Bacteria | 15043 |
| 32 | Ga0070658_10003253 | 3300005327 | Bacteria | 13411 |
| 33 | Ga0070658_10018921 | 3300005327 | Bacteria | 5517 |
| 34 | Ga0070658_10027870 | 3300005327 | Bacteria | 4533 |
| 35 | Ga0070658_10093562 | 3300005327 | Bacteria | 2479 |
| 36 | Ga0070676_10014080 | 3300005328 | Bacteria | 4390 |
| 37 | Ga0070690_100000003 | 3300005330 | Bacteria | 144748 |
| 38 | Ga0070690_100024373 | 3300005330 | Bacteria | 3720 |
| 39 | Ga0070690_100036723 | 3300005330 | Bacteria | 3082 |
| 40 | Ga0070670_100005173 | 3300005331 | Bacteria | 10983 |
| 41 | Ga0070670_100081940 | 3300005331 | Bacteria | 2772 |
| 42 | Ga0070666_10000006 | 3300005335 | Bacteria | 319173 |
| 43 | Ga0070666_10000410 | 3300005335 | Bacteria | 26678 |
| 44 | Ga0070680_100000166 | 3300005336 | Bacteria | 41693 |
| 45 | Ga0070680_100047651 | 3300005336 | Bacteria | 3490 |
| 46 | Ga0070680_100078812 | 3300005336 | Bacteria | 2714 |
| 47 | Ga0070682_100044476 | 3300005337 | Bacteria | 2749 |
| 48 | Ga0070660_100003168 | 3300005339 | Bacteria | 11299 |
| 49 | Ga0070660_100040499 | 3300005339 | Bacteria | 3546 |
| 50 | Ga0070660_100064491 | 3300005339 | Bacteria | 2850 |
| 51 | Ga0070689_100013461 | 3300005340 | Bacteria | 5920 |
| 52 | Ga0070689_100032566 | 3300005340 | Bacteria | 3966 |
| 53 | Ga0070691_10001140 | 3300005341 | Bacteria | 11052 |
| 54 | Ga0070692_10024711 | 3300005345 | Bacteria | 2955 |
| 55 | Ga0070668_100029899 | 3300005347 | Bacteria | 4139 |
| 56 | Ga0070669_100000014 | 3300005353 | Bacteria | 206875 |
| 57 | Ga0070669_100066282 | 3300005353 | Bacteria | 2661 |
| 58 | Ga0070671_100035911 | 3300005355 | Bacteria | 4107 |
| 59 | Ga0070674_100000746 | 3300005356 | Bacteria | 16681 |
| 60 | Ga0070674_100018639 | 3300005356 | Bacteria | 4393 |
| 61 | Ga0070667_100024894 | 3300005367 | Bacteria | 4972 |
| 62 | Ga0070667_100069756 | 3300005367 | Bacteria | 2991 |
| 63 | Ga0070667_100143696 | 3300005367 | Bacteria | 2091 |
| 64 | Ga0070709_10007492 | 3300005434 | Bacteria | 5985 |
| 65 | Ga0070709_10013017 | 3300005434 | Bacteria | 4669 |
| 66 | Ga0070714_100000761 | 3300005435 | Bacteria | 22822 |
| 67 | Ga0070714_100007392 | 3300005435 | Bacteria | 8546 |
| 68 | Ga0070713_100000007 | 3300005436 | Bacteria | 186402 |
| 69 | Ga0070713_100010825 | 3300005436 | Bacteria | 6610 |
| 70 | Ga0070713_100041897 | 3300005436 | Bacteria | 3733 |
| 71 | Ga0070713_100130626 | 3300005436 | Bacteria | 2214 |
| 72 | Ga0070711_100003889 | 3300005439 | Bacteria | 8771 |
| 73 | Ga0070711_100012918 | 3300005439 | Bacteria | 5232 |
| 74 | Ga0070711_100035173 | 3300005439 | Bacteria | 3347 |
| 75 | Ga0070711_100047124 | 3300005439 | Bacteria | 2941 |
| 76 | Ga0070711_100048812 | 3300005439 | Bacteria | 2896 |
| 77 | Ga0070705_100002764 | 3300005440 | Bacteria | 8757 |
| 78 | Ga0070705_100093762 | 3300005440 | Bacteria | 1878 |
| 79 | Ga0070700_100074742 | 3300005441 | Bacteria | 2172 |
| 80 | Ga0070694_100035591 | 3300005444 | Bacteria | 3293 |
| 81 | Ga0070694_100050902 | 3300005444 | Bacteria | 2794 |
| 82 | Ga0070663_100007242 | 3300005455 | Bacteria | 6742 |
| 83 | Ga0070678_100000585 | 3300005456 | Bacteria | 17909 |
| 84 | Ga0070678_100094202 | 3300005456 | Bacteria | 2305 |
| 85 | Ga0070662_100008234 | 3300005457 | Bacteria | 6789 |
| 86 | Ga0070662_100026287 | 3300005457 | Bacteria | 4029 |
| 87 | Ga0070681_10000966 | 3300005458 | Bacteria | 24277 |
| 88 | Ga0070681_10002890 | 3300005458 | Bacteria | 15869 |
| 89 | Ga0070681_10003601 | 3300005458 | Bacteria | 14521 |
| 90 | Ga0070681_10020624 | 3300005458 | Bacteria | 6604 |
| 91 | Ga0070681_10154665 | 3300005458 | Bacteria | 2219 |
| 92 | Ga0070685_10000072 | 3300005466 | Bacteria | 59953 |
| 93 | Ga0070685_10021125 | 3300005466 | Bacteria | 3535 |
| 94 | Ga0070698_100032083 | 3300005471 | Bacteria | 5443 |
| 95 | Ga0070699_100023877 | 3300005518 | Bacteria | 5270 |
| 96 | Ga0070679_100008818 | 3300005530 | Bacteria | 9514 |
| 97 | Ga0070679_100022694 | 3300005530 | Bacteria | 6136 |
| 98 | Ga0070679_100058090 | 3300005530 | Bacteria | 3855 |
| 99 | Ga0070679_100067291 | 3300005530 | Bacteria | 3572 |
| 100 | Ga0070684_100087173 | 3300005535 | Bacteria | 2771 |
| 101 | Ga0070697_100008449 | 3300005536 | Bacteria | 8033 |
| 102 | Ga0070697_100101520 | 3300005536 | Bacteria | 2390 |
| 103 | Ga0070697_100104358 | 3300005536 | Bacteria | 2357 |
| 104 | Ga0070697_100147862 | 3300005536 | Bacteria | 1979 |
| 105 | Ga0068853_100004213 | 3300005539 | Bacteria | 11101 |
| 106 | Ga0068853_100065265 | 3300005539 | Bacteria | 3159 |
| 107 | Ga0070686_100000022 | 3300005544 | Bacteria | 131168 |
| 108 | Ga0070695_100018861 | 3300005545 | Bacteria | 4193 |
| 109 | Ga0070695_100055638 | 3300005545 | Bacteria | 2551 |
| 110 | Ga0070696_100143284 | 3300005546 | Bacteria | 1748 |
| 111 | Ga0070693_100006405 | 3300005547 | Bacteria | 5706 |
| 112 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 113 | Ga0070665_100000058 | 3300005548 | Bacteria | 225040 |
| 114 | Ga0070665_100002528 | 3300005548 | Bacteria | 20093 |
| 115 | Ga0070665_100009420 | 3300005548 | Bacteria | 9885 |
| 116 | Ga0070665_100024420 | 3300005548 | Bacteria | 6086 |
| 117 | Ga0070665_100035688 | 3300005548 | Bacteria | 5000 |
| 118 | Ga0070665_100125292 | 3300005548 | Bacteria | 2571 |
| 119 | Ga0070665_100147500 | 3300005548 | Bacteria | 2355 |
| 120 | Ga0070665_100221543 | 3300005548 | Bacteria | 1892 |
| 121 | Ga0070704_100052902 | 3300005549 | Bacteria | 2867 |
| 122 | Ga0070704_100126179 | 3300005549 | Bacteria | 1975 |
| 123 | Ga0070704_100181114 | 3300005549 | Bacteria | 1685 |
| 124 | Ga0068855_100003048 | 3300005563 | Bacteria | 20528 |
| 125 | Ga0068855_100003607 | 3300005563 | Bacteria | 18908 |
| 126 | Ga0068855_100032581 | 3300005563 | Bacteria | 6221 |
| 127 | Ga0068855_100220888 | 3300005563 | Bacteria | 2125 |
| 128 | Ga0068855_100244188 | 3300005563 | Bacteria | 2005 |
| 129 | Ga0068857_100023641 | 3300005577 | Bacteria | 5411 |
| 130 | Ga0068857_100035743 | 3300005577 | Bacteria | 4401 |
| 131 | Ga0068857_100076939 | 3300005577 | Bacteria | 2976 |
| 132 | Ga0068857_100154400 | 3300005577 | Bacteria | 2081 |
| 133 | Ga0068856_100000142 | 3300005614 | Bacteria | 72931 |
| 134 | Ga0068856_100040567 | 3300005614 | Bacteria | 4573 |
| 135 | Ga0068856_100060295 | 3300005614 | Bacteria | 3749 |
| 136 | Ga0070702_100025238 | 3300005615 | Bacteria | 3182 |
| 137 | Ga0070702_100049483 | 3300005615 | Bacteria | 2397 |
| 138 | Ga0068852_100000043 | 3300005616 | Bacteria | 89867 |
| 139 | Ga0068852_100043311 | 3300005616 | Bacteria | 3817 |
| 140 | Ga0068852_100053990 | 3300005616 | Bacteria | 3462 |
| 141 | Ga0068852_100081292 | 3300005616 | Bacteria | 2875 |
| 142 | Ga0068859_100002673 | 3300005617 | Bacteria | 18104 |
| 143 | Ga0068859_100022887 | 3300005617 | Bacteria | 6265 |
| 144 | Ga0068859_100047888 | 3300005617 | Bacteria | 4295 |
| 145 | Ga0068859_100051845 | 3300005617 | Bacteria | 4125 |
| 146 | Ga0068859_100062269 | 3300005617 | Bacteria | 3761 |
| 147 | Ga0068859_100064968 | 3300005617 | Bacteria | 3683 |
| 148 | Ga0068864_100000565 | 3300005618 | Bacteria | 31584 |
| 149 | Ga0068864_100004975 | 3300005618 | Bacteria | 10896 |
| 150 | Ga0068864_100010237 | 3300005618 | Bacteria | 7744 |
| 151 | Ga0068864_100040174 | 3300005618 | Bacteria | 4002 |
| 152 | Ga0068861_100000111 | 3300005719 | Bacteria | 41057 |
| 153 | Ga0068861_100008113 | 3300005719 | Bacteria | 7223 |
| 154 | Ga0068851_10004282 | 3300005834 | Bacteria | 6427 |
| 155 | Ga0068870_10064079 | 3300005840 | Bacteria | 1984 |
| 156 | Ga0068863_100000048 | 3300005841 | Bacteria | 135912 |
| 157 | Ga0068863_100000051 | 3300005841 | Bacteria | 127526 |
| 158 | Ga0068863_100095516 | 3300005841 | Bacteria | 2821 |
| 159 | Ga0068858_100000254 | 3300005842 | Bacteria | 57050 |
| 160 | Ga0068858_100110985 | 3300005842 | Bacteria | 2561 |
| 161 | Ga0068858_100113002 | 3300005842 | Bacteria | 2536 |
| 162 | Ga0068858_100161656 | 3300005842 | Bacteria | 2109 |
| 163 | Ga0068860_100000014 | 3300005843 | Bacteria | 319437 |
| 164 | Ga0068860_100000187 | 3300005843 | Bacteria | 98756 |
| 165 | Ga0068860_100083473 | 3300005843 | Bacteria | 3038 |
| 166 | Ga0068862_100023072 | 3300005844 | Bacteria | 5212 |
| 167 | Ga0068862_100062843 | 3300005844 | Bacteria | 3194 |
| 168 | Ga0081455_10000088 | 3300005937 | Bacteria | 98815 |
| 169 | Ga0081455_10017022 | 3300005937 | Bacteria | 6988 |
| 170 | Ga0081455_10028380 | 3300005937 | Bacteria | 5113 |
| 171 | Ga0081538_10052953 | 3300005981 | Bacteria | 2419 |
| 172 | Ga0081540_1004937 | 3300005983 | Bacteria | 10031 |
| 173 | Ga0081540_1055391 | 3300005983 | Bacteria | 1931 |
| 174 | Ga0070717_10004903 | 3300006028 | Bacteria | 9735 |
| 175 | Ga0075363_100009459 | 3300006048 | Bacteria | 4582 |
| 176 | Ga0075364_10134862 | 3300006051 | Bacteria | 1658 |
| 177 | Ga0070716_100012383 | 3300006173 | Bacteria | 4323 |
| 178 | Ga0070716_100021723 | 3300006173 | Bacteria | 3384 |
| 179 | Ga0070712_100000015 | 3300006175 | Bacteria | 106593 |
| 180 | Ga0070712_100001349 | 3300006175 | Bacteria | 14896 |
| 181 | Ga0070712_100022267 | 3300006175 | Bacteria | 4172 |
| 182 | Ga0075362_10000095 | 3300006177 | Bacteria | 24855 |
| 183 | Ga0075369_10002175 | 3300006186 | Bacteria | 6928 |
| 184 | Ga0075369_10046940 | 3300006186 | Bacteria | 1861 |
| 185 | Ga0075366_10024202 | 3300006195 | Bacteria | 3542 |
| 186 | Ga0097621_100000667 | 3300006237 | Bacteria | 24145 |
| 187 | Ga0097621_100045788 | 3300006237 | Bacteria | 3535 |
| 188 | Ga0075370_10000025 | 3300006353 | Bacteria | 52081 |
| 189 | Ga0075370_10099057 | 3300006353 | Bacteria | 1686 |
| 190 | Ga0068871_100006814 | 3300006358 | Bacteria | 8125 |
| 191 | Ga0068871_100073058 | 3300006358 | Bacteria | 2827 |
| 192 | Ga0075428_100000380 | 3300006844 | Bacteria | 44038 |
| 193 | Ga0075428_100061682 | 3300006844 | Bacteria | 4106 |
| 194 | Ga0075428_100073996 | 3300006844 | Bacteria | 3721 |
| 195 | Ga0075428_100142075 | 3300006844 | Bacteria | 2610 |
| 196 | Ga0075430_100007128 | 3300006846 | Bacteria | 9428 |
| 197 | Ga0075430_100037467 | 3300006846 | Bacteria | 4110 |
| 198 | Ga0075430_100055367 | 3300006846 | Bacteria | 3336 |
| 199 | Ga0075431_100012379 | 3300006847 | Bacteria | 8610 |
| 200 | Ga0075431_100018891 | 3300006847 | Bacteria | 7022 |
| 201 | Ga0075431_100053013 | 3300006847 | Bacteria | 4182 |
| 202 | Ga0075433_10001374 | 3300006852 | Bacteria | 17879 |
| 203 | Ga0075433_10064307 | 3300006852 | Bacteria | 3215 |
| 204 | Ga0075433_10070998 | 3300006852 | Bacteria | 3061 |
| 205 | Ga0075433_10109601 | 3300006852 | Bacteria | 2449 |
| 206 | Ga0075433_10181572 | 3300006852 | Bacteria | 1873 |
| 207 | Ga0075434_100000753 | 3300006871 | Bacteria | 25538 |
| 208 | Ga0075434_100014278 | 3300006871 | Bacteria | 7590 |
| 209 | Ga0075434_100019894 | 3300006871 | Bacteria | 6501 |
| 210 | Ga0075434_100030105 | 3300006871 | Bacteria | 5344 |
| 211 | Ga0075434_100045158 | 3300006871 | Bacteria | 4370 |
| 212 | Ga0075434_100054366 | 3300006871 | Bacteria | 3978 |
| 213 | Ga0075434_100111213 | 3300006871 | Bacteria | 2750 |
| 214 | Ga0075429_100000097 | 3300006880 | Bacteria | 47892 |
| 215 | Ga0075429_100002097 | 3300006880 | Bacteria | 16632 |
| 216 | Ga0075429_100012504 | 3300006880 | Bacteria | 7362 |
| 217 | Ga0068865_100002716 | 3300006881 | Bacteria | 10503 |
| 218 | Ga0075436_100000024 | 3300006914 | Bacteria | 115057 |
| 219 | Ga0097620_100002673 | 3300006931 | Bacteria | 18104 |
| 220 | Ga0097620_100022887 | 3300006931 | Bacteria | 6265 |
| 221 | Ga0097620_100047889 | 3300006931 | Bacteria | 4295 |
| 222 | Ga0097620_100051843 | 3300006931 | Bacteria | 4125 |
| 223 | Ga0097620_100062268 | 3300006931 | Bacteria | 3761 |
| 224 | Ga0097620_100064968 | 3300006931 | Bacteria | 3683 |
| 225 | Ga0075435_100020165 | 3300007076 | Bacteria | 5102 |
| 226 | Ga0075435_100048993 | 3300007076 | Bacteria | 3395 |
| 227 | Ga0075435_100063562 | 3300007076 | Bacteria | 2998 |
| 228 | Ga0099794_10004284 | 3300007265 | Bacteria | 5579 |
| 229 | Ga0099795_10000617 | 3300007788 | Bacteria | 6847 |
| 230 | Ga0099795_10001314 | 3300007788 | Bacteria | 5298 |
| 231 | Ga0099795_10001349 | 3300007788 | Bacteria | 5261 |
| 232 | Ga0105240_10000733 | 3300009093 | Bacteria | 59965 |
| 233 | Ga0105240_10022602 | 3300009093 | Bacteria | 8330 |
| 234 | Ga0105240_10023442 | 3300009093 | Bacteria | 8160 |
| 235 | Ga0105240_10034962 | 3300009093 | Bacteria | 6479 |
| 236 | Ga0105240_10036767 | 3300009093 | Bacteria | 6296 |
| 237 | Ga0105240_10055350 | 3300009093 | Bacteria | 4966 |
| 238 | Ga0105240_10061130 | 3300009093 | Bacteria | 4695 |
| 239 | Ga0105240_10186611 | 3300009093 | Bacteria | 2442 |
| 240 | Ga0105240_10350181 | 3300009093 | Bacteria | 1676 |
| 241 | Ga0111539_10001385 | 3300009094 | Bacteria | 32227 |
| 242 | Ga0111539_10006891 | 3300009094 | Bacteria | 14596 |
| 243 | Ga0111539_10007288 | 3300009094 | Bacteria | 14162 |
| 244 | Ga0111539_10021041 | 3300009094 | Bacteria | 8033 |
| 245 | Ga0111539_10033953 | 3300009094 | Bacteria | 6190 |
| 246 | Ga0105245_10001618 | 3300009098 | Bacteria | 20495 |
| 247 | Ga0105245_10027313 | 3300009098 | Bacteria | 5028 |
| 248 | Ga0105247_10025691 | 3300009101 | Bacteria | 3554 |
| 249 | Ga0114129_10000156 | 3300009147 | Bacteria | 72734 |
| 250 | Ga0114129_10000625 | 3300009147 | Bacteria | 43996 |
| 251 | Ga0114129_10014790 | 3300009147 | Bacteria | 11118 |
| 252 | Ga0114129_10021337 | 3300009147 | Bacteria | 9196 |
| 253 | Ga0114129_10056170 | 3300009147 | Bacteria | 5515 |
| 254 | Ga0114129_10067337 | 3300009147 | Bacteria | 4994 |
| 255 | Ga0114129_10098690 | 3300009147 | Bacteria | 4042 |
| 256 | Ga0105243_10000782 | 3300009148 | Bacteria | 30522 |
| 257 | Ga0105243_10021440 | 3300009148 | Bacteria | 4905 |
| 258 | Ga0105243_10047215 | 3300009148 | Bacteria | 3389 |
| 259 | Ga0105241_10001365 | 3300009174 | Bacteria | 18600 |
| 260 | Ga0105241_10003444 | 3300009174 | Bacteria | 11773 |
| 261 | Ga0105241_10007433 | 3300009174 | Bacteria | 8066 |
| 262 | Ga0105241_10042106 | 3300009174 | Bacteria | 3453 |
| 263 | Ga0105241_10066259 | 3300009174 | Bacteria | 2792 |
| 264 | Ga0105242_10029836 | 3300009176 | Bacteria | 4353 |
| 265 | Ga0105242_10039657 | 3300009176 | Bacteria | 3791 |
| 266 | Ga0105242_10075685 | 3300009176 | Bacteria | 2804 |
| 267 | Ga0105248_10002303 | 3300009177 | Bacteria | 21145 |
| 268 | Ga0105248_10007409 | 3300009177 | Bacteria | 12041 |
| 269 | Ga0105248_10013887 | 3300009177 | Bacteria | 8861 |
| 270 | Ga0105248_10044462 | 3300009177 | Bacteria | 4980 |
| 271 | Ga0105248_10071941 | 3300009177 | Bacteria | 3886 |
| 272 | Ga0105248_10075907 | 3300009177 | Bacteria | 3778 |
| 273 | Ga0105248_10096555 | 3300009177 | Bacteria | 3329 |
| 274 | Ga0105248_10257644 | 3300009177 | Bacteria | 1964 |
| 275 | Ga0105237_10002363 | 3300009545 | Bacteria | 23404 |
| 276 | Ga0105237_10030182 | 3300009545 | Bacteria | 5509 |
| 277 | Ga0105238_10001921 | 3300009551 | Bacteria | 20862 |
| 278 | Ga0105238_10013158 | 3300009551 | Bacteria | 8349 |
| 279 | Ga0105238_10060392 | 3300009551 | Bacteria | 3795 |
| 280 | Ga0105238_10125721 | 3300009551 | Bacteria | 2543 |
| 281 | Ga0105238_10193015 | 3300009551 | Bacteria | 2012 |
| 282 | Ga0105249_10000104 | 3300009553 | Bacteria | 118213 |
| 283 | Ga0105249_10006192 | 3300009553 | Bacteria | 10386 |
| 284 | Ga0099796_10002367 | 3300010159 | Bacteria | 4120 |
| 285 | Ga0099796_10003638 | 3300010159 | Bacteria | 3610 |
| 286 | Ga0099796_10009676 | 3300010159 | Bacteria | 2618 |
| 287 | Ga0105239_10000138 | 3300010375 | Bacteria | 102176 |
| 288 | Ga0105239_10024748 | 3300010375 | Bacteria | 6613 |
| 289 | Ga0105239_10067661 | 3300010375 | Bacteria | 3924 |
| 290 | Ga0105239_10085669 | 3300010375 | Bacteria | 3473 |
| 291 | Ga0105239_10097212 | 3300010375 | Bacteria | 3254 |
| 292 | Ga0157371_10000146 | 3300013102 | Bacteria | 103290 |
| 293 | Ga0157370_10000503 | 3300013104 | Bacteria | 48827 |
| 294 | Ga0157370_10001658 | 3300013104 | Bacteria | 27457 |
| 295 | Ga0157370_10024422 | 3300013104 | Bacteria | 5986 |
| 296 | Ga0157369_10009865 | 3300013105 | Bacteria | 10911 |
| 297 | Ga0157369_10038161 | 3300013105 | Bacteria | 5254 |
| 298 | Ga0157369_10055615 | 3300013105 | Bacteria | 4271 |
| 299 | Ga0157378_10044499 | 3300013297 | Bacteria | 3942 |
| 300 | Ga0157378_10059554 | 3300013297 | Bacteria | 3407 |
| 301 | Ga0157378_10104103 | 3300013297 | Bacteria | 2594 |
| 302 | Ga0163162_10002269 | 3300013306 | Bacteria | 18047 |
| 303 | Ga0163162_10014904 | 3300013306 | Bacteria | 7591 |
| 304 | Ga0163162_10103353 | 3300013306 | Bacteria | 2943 |
| 305 | Ga0163162_10138786 | 3300013306 | Bacteria | 2543 |
| 306 | Ga0163162_10180379 | 3300013306 | Bacteria | 2238 |
| 307 | Ga0157372_10110327 | 3300013307 | Bacteria | 3151 |
| 308 | Ga0157372_10151050 | 3300013307 | Bacteria | 2681 |
| 309 | Ga0157372_10234477 | 3300013307 | Bacteria | 2128 |
| 310 | Ga0157372_10369694 | 3300013307 | Bacteria | 1671 |
| 311 | Ga0157375_10029036 | 3300013308 | Bacteria | 5195 |
| 312 | Ga0163163_10000016 | 3300014325 | Bacteria | 213966 |
| 313 | Ga0163163_10006398 | 3300014325 | Bacteria | 10289 |
| 314 | Ga0163163_10102214 | 3300014325 | Bacteria | 2889 |
| 315 | Ga0157380_10000181 | 3300014326 | Bacteria | 36496 |
| 316 | Ga0157380_10006753 | 3300014326 | Bacteria | 8110 |
| 317 | Ga0157380_10070190 | 3300014326 | Bacteria | 2830 |
| 318 | Ga0157379_10019689 | 3300014968 | Bacteria | 5962 |
| 319 | Ga0157379_10039312 | 3300014968 | Bacteria | 4220 |
| 320 | Ga0157376_10132985 | 3300014969 | Bacteria | 2223 |
| 321 | Ga0163161_10000020 | 3300017792 | Bacteria | 214642 |
| 322 | Ga0206356_11622843 | 3300020070 | Bacteria | 2405 |
| 323 | Ga0213872_10033254 | 3300021361 | Bacteria | 2363 |
| 324 | Ga0213872_10056105 | 3300021361 | Bacteria | 1785 |
| 325 | Ga0213874_10005997 | 3300021377 | Bacteria | 2857 |
| 326 | Ga0213875_10000228 | 3300021388 | Bacteria | 56927 |
| 327 | Ga0213871_10003950 | 3300021441 | Bacteria | 2917 |
| 328 | Ga0213871_10006546 | 3300021441 | Bacteria | 2469 |
| 329 | Ga0207672_1000860 | 3300025223 | Bacteria | 3136 |
| 330 | Ga0209674_101931 | 3300025226 | Bacteria | 4859 |
| 331 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 332 | Ga0207427_100640 | 3300025231 | Bacteria | 16950 |
| 333 | Ga0209437_105888 | 3300025233 | Bacteria | 2067 |
| 334 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 335 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 336 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 337 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 338 | Ga0209233_1000382 | 3300025261 | Bacteria | 38319 |
| 339 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 340 | Ga0209455_1011665 | 3300025272 | Bacteria | 2150 |
| 341 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 342 | Ga0207656_10008826 | 3300025321 | Bacteria | 3729 |
| 343 | Ga0207682_10040825 | 3300025893 | Bacteria | 1892 |
| 344 | Ga0207642_10013804 | 3300025899 | Bacteria | 2959 |
| 345 | Ga0207680_10000011 | 3300025903 | Bacteria | 391225 |
| 346 | Ga0207680_10031022 | 3300025903 | Bacteria | 3024 |
| 347 | Ga0207647_10000527 | 3300025904 | Bacteria | 30498 |
| 348 | Ga0207647_10001094 | 3300025904 | Bacteria | 20910 |
| 349 | Ga0207647_10004311 | 3300025904 | Bacteria | 10549 |
| 350 | Ga0207647_10046770 | 3300025904 | Bacteria | 2695 |
| 351 | Ga0207685_10006206 | 3300025905 | Bacteria | 3234 |
| 352 | Ga0207699_10000660 | 3300025906 | Bacteria | 16579 |
| 353 | Ga0207699_10006424 | 3300025906 | Bacteria | 5690 |
| 354 | Ga0207699_10016427 | 3300025906 | Bacteria | 3872 |
| 355 | Ga0207699_10077254 | 3300025906 | Bacteria | 2054 |
| 356 | Ga0207643_10029831 | 3300025908 | Bacteria | 3034 |
| 357 | Ga0207643_10052068 | 3300025908 | Bacteria | 2324 |
| 358 | Ga0207705_10001001 | 3300025909 | Bacteria | 23017 |
| 359 | Ga0207705_10001461 | 3300025909 | Bacteria | 18836 |
| 360 | Ga0207705_10007867 | 3300025909 | Bacteria | 7827 |
| 361 | Ga0207705_10083646 | 3300025909 | Bacteria | 2328 |
| 362 | Ga0207684_10014178 | 3300025910 | Bacteria | 6880 |
| 363 | Ga0207654_10002077 | 3300025911 | Bacteria | 10270 |
| 364 | Ga0207654_10018498 | 3300025911 | Bacteria | 3657 |
| 365 | Ga0207654_10043009 | 3300025911 | Bacteria | 2558 |
| 366 | Ga0207707_10000489 | 3300025912 | Bacteria | 40959 |
| 367 | Ga0207707_10005090 | 3300025912 | Bacteria | 11527 |
| 368 | Ga0207707_10013886 | 3300025912 | Bacteria | 7022 |
| 369 | Ga0207707_10017985 | 3300025912 | Bacteria | 6161 |
| 370 | Ga0207707_10046484 | 3300025912 | Bacteria | 3781 |
| 371 | Ga0207707_10091488 | 3300025912 | Bacteria | 2658 |
| 372 | Ga0207695_10001560 | 3300025913 | Bacteria | 37557 |
| 373 | Ga0207695_10002853 | 3300025913 | Bacteria | 25128 |
| 374 | Ga0207695_10005233 | 3300025913 | Bacteria | 17336 |
| 375 | Ga0207695_10024058 | 3300025913 | Bacteria | 6865 |
| 376 | Ga0207695_10036449 | 3300025913 | Bacteria | 5317 |
| 377 | Ga0207695_10047816 | 3300025913 | Bacteria | 4523 |
| 378 | Ga0207695_10053266 | 3300025913 | Bacteria | 4233 |
| 379 | Ga0207695_10130979 | 3300025913 | Bacteria | 2466 |
| 380 | Ga0207695_10218075 | 3300025913 | Bacteria | 1816 |
| 381 | Ga0207695_10249326 | 3300025913 | Bacteria | 1675 |
| 382 | Ga0207671_10000545 | 3300025914 | Bacteria | 50856 |
| 383 | Ga0207671_10001056 | 3300025914 | Bacteria | 33385 |
| 384 | Ga0207693_10000048 | 3300025915 | Bacteria | 100685 |
| 385 | Ga0207693_10000560 | 3300025915 | Bacteria | 33567 |
| 386 | Ga0207693_10001691 | 3300025915 | Bacteria | 19437 |
| 387 | Ga0207693_10015924 | 3300025915 | Bacteria | 6020 |
| 388 | Ga0207693_10017466 | 3300025915 | Bacteria | 5723 |
| 389 | Ga0207663_10007856 | 3300025916 | Bacteria | 5559 |
| 390 | Ga0207663_10010584 | 3300025916 | Bacteria | 4917 |
| 391 | Ga0207663_10069844 | 3300025916 | Bacteria | 2261 |
| 392 | Ga0207660_10083282 | 3300025917 | Bacteria | 2355 |
| 393 | Ga0207662_10035528 | 3300025918 | Bacteria | 2911 |
| 394 | Ga0207657_10000273 | 3300025919 | Bacteria | 54891 |
| 395 | Ga0207657_10004635 | 3300025919 | Bacteria | 14525 |
| 396 | Ga0207657_10006527 | 3300025919 | Bacteria | 12082 |
| 397 | Ga0207657_10015118 | 3300025919 | Bacteria | 7495 |
| 398 | Ga0207657_10020578 | 3300025919 | Bacteria | 6231 |
| 399 | Ga0207649_10000110 | 3300025920 | Bacteria | 69018 |
| 400 | Ga0207649_10000114 | 3300025920 | Bacteria | 68080 |
| 401 | Ga0207649_10000145 | 3300025920 | Bacteria | 59071 |
| 402 | Ga0207652_10000684 | 3300025921 | Bacteria | 33128 |
| 403 | Ga0207652_10046597 | 3300025921 | Bacteria | 3699 |
| 404 | Ga0207652_10061117 | 3300025921 | Bacteria | 3253 |
| 405 | Ga0207646_10057041 | 3300025922 | Bacteria | 3489 |
| 406 | Ga0207681_10000045 | 3300025923 | Bacteria | 128454 |
| 407 | Ga0207681_10010321 | 3300025923 | Bacteria | 5713 |
| 408 | Ga0207694_10006559 | 3300025924 | Bacteria | 8845 |
| 409 | Ga0207694_10014019 | 3300025924 | Bacteria | 6044 |
| 410 | Ga0207694_10018421 | 3300025924 | Bacteria | 5278 |
| 411 | Ga0207694_10031100 | 3300025924 | Bacteria | 4076 |
| 412 | Ga0207694_10036445 | 3300025924 | Bacteria | 3776 |
| 413 | Ga0207694_10037901 | 3300025924 | Bacteria | 3705 |
| 414 | Ga0207650_10003631 | 3300025925 | Bacteria | 10570 |
| 415 | Ga0207650_10071659 | 3300025925 | Bacteria | 2607 |
| 416 | Ga0207659_10108997 | 3300025926 | Bacteria | 2101 |
| 417 | Ga0207687_10003650 | 3300025927 | Bacteria | 10372 |
| 418 | Ga0207687_10018062 | 3300025927 | Bacteria | 4653 |
| 419 | Ga0207700_10000014 | 3300025928 | Bacteria | 229475 |
| 420 | Ga0207664_10029137 | 3300025929 | Bacteria | 4203 |
| 421 | Ga0207644_10000777 | 3300025931 | Bacteria | 20242 |
| 422 | Ga0207644_10080787 | 3300025931 | Bacteria | 2401 |
| 423 | Ga0207690_10019724 | 3300025932 | Bacteria | 4157 |
| 424 | Ga0207690_10092240 | 3300025932 | Bacteria | 2143 |
| 425 | Ga0207706_10015816 | 3300025933 | Bacteria | 6821 |
| 426 | Ga0207706_10017873 | 3300025933 | Bacteria | 6385 |
| 427 | Ga0207706_10022694 | 3300025933 | Bacteria | 5634 |
| 428 | Ga0207706_10111941 | 3300025933 | Bacteria | 2402 |
| 429 | Ga0207686_10007035 | 3300025934 | Bacteria | 6054 |
| 430 | Ga0207686_10025035 | 3300025934 | Bacteria | 3466 |
| 431 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 432 | Ga0207709_10007200 | 3300025935 | Bacteria | 6208 |
| 433 | Ga0207709_10013817 | 3300025935 | Bacteria | 4456 |
| 434 | Ga0207670_10001555 | 3300025936 | Bacteria | 12082 |
| 435 | Ga0207670_10020384 | 3300025936 | Bacteria | 4074 |
| 436 | Ga0207669_10000365 | 3300025937 | Bacteria | 20447 |
| 437 | Ga0207669_10008618 | 3300025937 | Bacteria | 4798 |
| 438 | Ga0207704_10063934 | 3300025938 | Bacteria | 2296 |
| 439 | Ga0207665_10018330 | 3300025939 | Bacteria | 4600 |
| 440 | Ga0207711_10000635 | 3300025941 | Bacteria | 35316 |
| 441 | Ga0207711_10012614 | 3300025941 | Bacteria | 7020 |
| 442 | Ga0207711_10035930 | 3300025941 | Bacteria | 4202 |
| 443 | Ga0207711_10038895 | 3300025941 | Bacteria | 4045 |
| 444 | Ga0207711_10104798 | 3300025941 | Bacteria | 2507 |
| 445 | Ga0207689_10032638 | 3300025942 | Bacteria | 4329 |
| 446 | Ga0207689_10099436 | 3300025942 | Bacteria | 2390 |
| 447 | Ga0207679_10122118 | 3300025945 | Bacteria | 2076 |
| 448 | Ga0207679_10157488 | 3300025945 | Bacteria | 1856 |
| 449 | Ga0207667_10003961 | 3300025949 | Bacteria | 18221 |
| 450 | Ga0207667_10005502 | 3300025949 | Bacteria | 15447 |
| 451 | Ga0207667_10027048 | 3300025949 | Bacteria | 6254 |
| 452 | Ga0207712_10000013 | 3300025961 | Bacteria | 391208 |
| 453 | Ga0207712_10023320 | 3300025961 | Bacteria | 4083 |
| 454 | Ga0207712_10072997 | 3300025961 | Bacteria | 2473 |
| 455 | Ga0207668_10010144 | 3300025972 | Bacteria | 5678 |
| 456 | Ga0207668_10033681 | 3300025972 | Bacteria | 3395 |
| 457 | Ga0207668_10048576 | 3300025972 | Bacteria | 2913 |
| 458 | Ga0207658_10008004 | 3300025986 | Bacteria | 7198 |
| 459 | Ga0207658_10021603 | 3300025986 | Bacteria | 4471 |
| 460 | Ga0207658_10054258 | 3300025986 | Bacteria | 2965 |
| 461 | Ga0207677_10093069 | 3300026023 | Bacteria | 2196 |
| 462 | Ga0207677_10167759 | 3300026023 | Bacteria | 1713 |
| 463 | Ga0207703_10000255 | 3300026035 | Bacteria | 60030 |
| 464 | Ga0207703_10003947 | 3300026035 | Bacteria | 12293 |
| 465 | Ga0207703_10028124 | 3300026035 | Bacteria | 4429 |
| 466 | Ga0207703_10054150 | 3300026035 | Bacteria | 3262 |
| 467 | Ga0207703_10066182 | 3300026035 | Bacteria | 2972 |
| 468 | Ga0207639_10000516 | 3300026041 | Bacteria | 26647 |
| 469 | Ga0207639_10002060 | 3300026041 | Bacteria | 13562 |
| 470 | Ga0207678_10003934 | 3300026067 | Bacteria | 13365 |
| 471 | Ga0207678_10005571 | 3300026067 | Bacteria | 11258 |
| 472 | Ga0207678_10121480 | 3300026067 | Bacteria | 2229 |
| 473 | Ga0207678_10216873 | 3300026067 | Bacteria | 1637 |
| 474 | Ga0207708_10057466 | 3300026075 | Bacteria | 2968 |
| 475 | Ga0207708_10113490 | 3300026075 | Bacteria | 2105 |
| 476 | Ga0207702_10000066 | 3300026078 | Bacteria | 117825 |
| 477 | Ga0207702_10003870 | 3300026078 | Bacteria | 13488 |
| 478 | Ga0207702_10010628 | 3300026078 | Bacteria | 7692 |
| 479 | Ga0207702_10021440 | 3300026078 | Bacteria | 5350 |
| 480 | Ga0207702_10119280 | 3300026078 | Bacteria | 2358 |
| 481 | Ga0207702_10148270 | 3300026078 | Bacteria | 2131 |
| 482 | Ga0207641_10000143 | 3300026088 | Bacteria | 102398 |
| 483 | Ga0207641_10000675 | 3300026088 | Bacteria | 37002 |
| 484 | Ga0207641_10026641 | 3300026088 | Bacteria | 4773 |
| 485 | Ga0207641_10167906 | 3300026088 | Bacteria | 2000 |
| 486 | Ga0207648_10038998 | 3300026089 | Bacteria | 4178 |
| 487 | Ga0207648_10149402 | 3300026089 | Bacteria | 2061 |
| 488 | Ga0207648_10194746 | 3300026089 | Bacteria | 1797 |
| 489 | Ga0207676_10000214 | 3300026095 | Bacteria | 49961 |
| 490 | Ga0207676_10007631 | 3300026095 | Bacteria | 7679 |
| 491 | Ga0207676_10008620 | 3300026095 | Bacteria | 7247 |
| 492 | Ga0207676_10032822 | 3300026095 | Bacteria | 3916 |
| 493 | Ga0207674_10017008 | 3300026116 | Bacteria | 7939 |
| 494 | Ga0207674_10027113 | 3300026116 | Bacteria | 6068 |
| 495 | Ga0207674_10040487 | 3300026116 | Bacteria | 4826 |
| 496 | Ga0207674_10057342 | 3300026116 | Bacteria | 3948 |
| 497 | Ga0207674_10078266 | 3300026116 | Bacteria | 3311 |
| 498 | Ga0207674_10206874 | 3300026116 | Bacteria | 1912 |
| 499 | Ga0207675_100000019 | 3300026118 | Bacteria | 122642 |
| 500 | Ga0207675_100007046 | 3300026118 | Bacteria | 10621 |
| 501 | Ga0207675_100031913 | 3300026118 | Bacteria | 4907 |
| 502 | Ga0207683_10001302 | 3300026121 | Bacteria | 22554 |
| 503 | Ga0207683_10031662 | 3300026121 | Bacteria | 4590 |
| 504 | Ga0207683_10064514 | 3300026121 | Bacteria | 3227 |
| 505 | Ga0207698_10000449 | 3300026142 | Bacteria | 23772 |
| 506 | Ga0207698_10042838 | 3300026142 | Bacteria | 3386 |
| 507 | Ga0207698_10180578 | 3300026142 | Bacteria | 1869 |
| 508 | Ga0207698_10233280 | 3300026142 | Bacteria | 1672 |
| 509 | Ga0209179_1002970 | 3300027512 | Bacteria | 2375 |
| 510 | Ga0209588_1005047 | 3300027671 | Bacteria | 3758 |
| 511 | Ga0209588_1024292 | 3300027671 | Bacteria | 1913 |
| 512 | Ga0207428_10000009 | 3300027907 | Bacteria | 410565 |
| 513 | Ga0207428_10000199 | 3300027907 | Bacteria | 83918 |
| 514 | Ga0207428_10006052 | 3300027907 | Bacteria | 11183 |
| 515 | Ga0207428_10011692 | 3300027907 | Bacteria | 7741 |
| 516 | Ga0265354_1001119 | 3300028016 | Bacteria | 4108 |
| 517 | Ga0265356_1001861 | 3300028017 | Bacteria | 2951 |
| 518 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 519 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 520 | Ga0268266_10005105 | 3300028379 | Bacteria | 12373 |
| 521 | Ga0268266_10022606 | 3300028379 | Bacteria | 5354 |
| 522 | Ga0268266_10086830 | 3300028379 | Bacteria | 2735 |
| 523 | Ga0268266_10092535 | 3300028379 | Bacteria | 2653 |
| 524 | Ga0268266_10130507 | 3300028379 | Bacteria | 2247 |
| 525 | Ga0268265_10000546 | 3300028380 | Bacteria | 38362 |
| 526 | Ga0268265_10068698 | 3300028380 | Bacteria | 2749 |
| 527 | Ga0268265_10078283 | 3300028380 | Bacteria | 2600 |
| 528 | Ga0268264_10000037 | 3300028381 | Bacteria | 391116 |
| 529 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 530 | Ga0265319_1005754 | 3300028563 | Bacteria | 5866 |
| 531 | Ga0265334_10008603 | 3300028573 | Bacteria | 4335 |
| 532 | Ga0265334_10011594 | 3300028573 | Bacteria | 3707 |
| 533 | Ga0265334_10011837 | 3300028573 | Bacteria | 3666 |
| 534 | Ga0265318_10002977 | 3300028577 | Bacteria | 8757 |
| 535 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 536 | Ga0265338_10002483 | 3300028800 | Bacteria | 27550 |
| 537 | Ga0265338_10044259 | 3300028800 | Bacteria | 4113 |
| 538 | Ga0265338_10058659 | 3300028800 | Bacteria | 3395 |
| 539 | Ga0265338_10070019 | 3300028800 | Bacteria | 3010 |
| 540 | Ga0265770_1005470 | 3300030878 | Bacteria | 1751 |
| 541 | Ga0265760_10003762 | 3300031090 | Bacteria | 4397 |
| 542 | Ga0265330_10003121 | 3300031235 | Bacteria | 8776 |
| 543 | Ga0265328_10003515 | 3300031239 | Bacteria | 6916 |
| 544 | Ga0265320_10000097 | 3300031240 | Bacteria | 74341 |
| 545 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 546 | Ga0265325_10000288 | 3300031241 | Bacteria | 35410 |
| 547 | Ga0265325_10000743 | 3300031241 | Bacteria | 23567 |
| 548 | Ga0265325_10001279 | 3300031241 | Bacteria | 17862 |
| 549 | Ga0265325_10002615 | 3300031241 | Bacteria | 12057 |
| 550 | Ga0265329_10002699 | 3300031242 | Bacteria | 7977 |
| 551 | Ga0265340_10000024 | 3300031247 | Bacteria | 77206 |
| 552 | Ga0265340_10018922 | 3300031247 | Bacteria | 3549 |
| 553 | Ga0265339_10001397 | 3300031249 | Bacteria | 17979 |
| 554 | Ga0265339_10005993 | 3300031249 | Bacteria | 8032 |
| 555 | Ga0265339_10006155 | 3300031249 | Bacteria | 7905 |
| 556 | Ga0265339_10033971 | 3300031249 | Bacteria | 2869 |
| 557 | Ga0265331_10005229 | 3300031250 | Bacteria | 7867 |
| 558 | Ga0265331_10009466 | 3300031250 | Bacteria | 5467 |
| 559 | Ga0265331_10009969 | 3300031250 | Bacteria | 5284 |
| 560 | Ga0265331_10037946 | 3300031250 | Bacteria | 2357 |
| 561 | Ga0265331_10042384 | 3300031250 | Bacteria | 2208 |
| 562 | Ga0265331_10046524 | 3300031250 | Bacteria | 2091 |
| 563 | Ga0265327_10000277 | 3300031251 | Bacteria | 101027 |
| 564 | Ga0265327_10030959 | 3300031251 | Bacteria | 3014 |
| 565 | Ga0265316_10004163 | 3300031344 | Bacteria | 14457 |
| 566 | Ga0265316_10009472 | 3300031344 | Bacteria | 8971 |
| 567 | Ga0265316_10013314 | 3300031344 | Bacteria | 7314 |
| 568 | Ga0265316_10032753 | 3300031344 | Bacteria | 4239 |
| 569 | Ga0265316_10075730 | 3300031344 | Bacteria | 2587 |
| 570 | Ga0307513_10012412 | 3300031456 | Bacteria | 10517 |
| 571 | Ga0307513_10080907 | 3300031456 | Bacteria | 3349 |
| 572 | Ga0265313_10001888 | 3300031595 | Bacteria | 19036 |
| 573 | Ga0265313_10002246 | 3300031595 | Bacteria | 16980 |
| 574 | Ga0265313_10002257 | 3300031595 | Bacteria | 16935 |
| 575 | Ga0265313_10004451 | 3300031595 | Bacteria | 10762 |
| 576 | Ga0307508_10004809 | 3300031616 | Bacteria | 13025 |
| 577 | Ga0265314_10000127 | 3300031711 | Bacteria | 116458 |
| 578 | Ga0265314_10001042 | 3300031711 | Bacteria | 32320 |
| 579 | Ga0265314_10008305 | 3300031711 | Bacteria | 8907 |
| 580 | Ga0265314_10013481 | 3300031711 | Bacteria | 6598 |
| 581 | Ga0265342_10005393 | 3300031712 | Bacteria | 9766 |
| 582 | Ga0265342_10007568 | 3300031712 | Bacteria | 7930 |
| 583 | Ga0265342_10027644 | 3300031712 | Bacteria | 3541 |
| 584 | Ga0265342_10046675 | 3300031712 | Bacteria | 2602 |
| 585 | Ga0307516_10000131 | 3300031730 | Bacteria | 89180 |
| 586 | Ga0307516_10052680 | 3300031730 | Bacteria | 3982 |
| 587 | Ga0307412_10061306 | 3300031911 | Bacteria | 2528 |
| 588 | Ga0316583_10001947 | 3300032133 | Bacteria | 7050 |
| 589 | Ga0307510_10000018 | 3300033180 | Bacteria | 192986 |
| 590 | Ga0307510_10099455 | 3300033180 | Bacteria | 2707 |
| 591 | Ga0373934_0014566 | 3300035086 | Bacteria | 2982 |
| 592 | Ga0373944_0002685 | 3300035089 | Bacteria | 4535 |
| 593 | Ga0373944_0007486 | 3300035089 | Bacteria | 2929 |
| 594 | Ga0373936_0049284 | 3300035113 | Bacteria | 1701 |
| 595 | Ga0373945_0003970 | 3300035116 | Bacteria | 4676 |
| 596 | Ga0373943_0000765 | 3300035170 | Bacteria | 14011 |
| 597 | Ga0373946_0006882 | 3300035171 | Bacteria | 4139 |
| 598 | Ga0373946_0007215 | 3300035171 | Bacteria | 4057 |
| 599 | Ga0373955_0005661 | 3300035172 | Bacteria | 5625 |
| 600 | Ga0373955_0029658 | 3300035172 | Bacteria | 2848 |
| 601 | Ga0373931_0006910 | 3300035691 | Bacteria | 5339 |
| 602 | Ga0373931_0007877 | 3300035691 | Bacteria | 5038 |
| 603 | Ga0373935_0008313 | 3300035692 | Bacteria | 6207 |
| 604 | Ga0373935_0123494 | 3300035692 | Bacteria | 1732 |
| 605 | Ga0373927_0006832 | 3300035695 | Bacteria | 7766 |
| 606 | Ga0373927_0016267 | 3300035695 | Bacteria | 4909 |
| 607 | Ga0373927_0022373 | 3300035695 | Bacteria | 4142 |
| 608 | Ga0373933_0019397 | 3300035724 | Bacteria | 3841 |
| 609 | Ga0373947_0041128 | 3300035725 | Bacteria | 2755 |
| 610 | Ga0373937_0000403 | 3300036401 | Bacteria | 40423 |
| 611 | Ga0373937_0006777 | 3300036401 | Bacteria | 9890 |
| 612 | Ga0373937_0008757 | 3300036401 | Bacteria | 8782 |
| 613 | Ga0373937_0102928 | 3300036401 | Bacteria | 2652 |
| 614 | Ga0373937_0128278 | 3300036401 | Bacteria | 2367 |
| 615 | Ga0316582_0006770 | 3300036647 | Bacteria | 6050 |
| 616 | Ga0373925_0014594 | 3300037068 | Bacteria | 5675 |
| 617 | Ga0395899_0000026 | 3300037312 | Bacteria | 345291 |
| 618 | Ga0395899_0000083 | 3300037312 | Bacteria | 161878 |
| 619 | Ga0395899_0022292 | 3300037312 | Bacteria | 4803 |
| 620 | Ga0395899_0072225 | 3300037312 | Bacteria | 2525 |
| 621 | Ga0395899_0075040 | 3300037312 | Bacteria | 2470 |
| 622 | Ga0395900_0000004 | 3300037418 | Bacteria | 564908 |
| 623 | Ga0395900_0003046 | 3300037418 | Bacteria | 18261 |
| 624 | Ga0395900_0010154 | 3300037418 | Bacteria | 9633 |
| 625 | Ga0395900_0023413 | 3300037418 | Bacteria | 6322 |
| 626 | Ga0395900_0128485 | 3300037418 | Bacteria | 2598 |
| 627 | Ga0395898_0004887 | 3300037466 | Bacteria | 14555 |
| 628 | Ga0395898_0034151 | 3300037466 | Bacteria | 5071 |
| 629 | Ga0395898_0051126 | 3300037466 | Bacteria | 4042 |
| 630 | Ga0395905_0019066 | 3300037471 | Bacteria | 6507 |
| 631 | Ga0395905_0064055 | 3300037471 | Bacteria | 3439 |
| 632 | Ga0395905_0213067 | 3300037471 | Bacteria | 1809 |
| 633 | Ga0436364_1065372 | 3300037853 | Bacteria | 196587 |
| 634 | Ga0436364_1306621 | 3300037853 | Bacteria | 3415 |
| 635 | Ga0395901_0000005 | 3300038443 | Bacteria | 544998 |
| 636 | Ga0395901_0015348 | 3300038443 | Bacteria | 7795 |
| 637 | Ga0395901_0057745 | 3300038443 | Bacteria | 4036 |
| 638 | Ga0436365_0244982 | 3300039437 | Bacteria | 68861 |
| 639 | Ga0436365_0701004 | 3300039437 | Bacteria | 2064 |
| 640 | Ga0436365_1213514 | 3300039437 | Bacteria | 5097 |
| 641 | Ga0436365_1437123 | 3300039437 | Bacteria | 2140 |
| 642 | Ga0436365_1935932 | 3300039437 | Bacteria | 1947 |
| 643 | Ga0436360_0261193 | 3300039438 | Bacteria | 7992 |
| 644 | Ga0436360_0734790 | 3300039438 | Bacteria | 1967 |
| 645 | Ga0436360_1175238 | 3300039438 | Bacteria | 4844 |
| 646 | Ga0436360_1338455 | 3300039438 | Bacteria | 2621 |
| 647 | Ga0436360_1357105 | 3300039438 | Bacteria | 3131 |
| 648 | Ga0436361_0229100 | 3300039447 | Bacteria | 1869 |
| 649 | Ga0436361_0748837 | 3300039447 | Bacteria | 5194 |
| 650 | Ga0436363_0002125 | 3300039450 | Bacteria | 12690 |
| 651 | Ga0436363_0900450 | 3300039450 | Bacteria | 5661 |
| 652 | Ga0436363_1198730 | 3300039450 | Bacteria | 5969 |
| 653 | Ga0436362_0727973 | 3300039453 | Bacteria | 1675 |
| 654 | Ga0451837_0189484 | 3300041494 | Bacteria | 1924 |
| 655 | Ga0439458_0000258 | 3300042157 | Bacteria | 12892 |
| 656 | Ga0439458_0001938 | 3300042157 | Bacteria | 5132 |
| 657 | Ga0451577_0016304 | 3300042876 | Bacteria | 6883 |
| 658 | Ga0466969_0051939 | 3300044656 | Bacteria | 2015 |
| 659 | Ga0453684_0024242 | 3300044712 | Bacteria | 8879 |
| 660 | Ga0466968_0036450 | 3300044735 | Bacteria | 2061 |
| 661 | Ga0466959_0022270 | 3300045049 | Bacteria | 4682 |
| 662 | Ga0451576_0029838 | 3300045051 | Bacteria | 5833 |
| 663 | Ga0466967_0080454 | 3300045976 | Bacteria | 2940 |
| 664 | Ga0495592_0001006 | 3300046454 | Bacteria | 19583 |
| 665 | Ga0495603_0001429 | 3300046455 | Bacteria | 13888 |
| 666 | Ga0495603_0014354 | 3300046455 | Bacteria | 4790 |
| 667 | Ga0495590_0034778 | 3300046457 | Bacteria | 1760 |
| 668 | Ga0495629_0002180 | 3300046459 | Bacteria | 15122 |
| 669 | Ga0495638_0000332 | 3300046460 | Bacteria | 59517 |
| 670 | Ga0495651_0000185 | 3300046462 | Bacteria | 46374 |
| 671 | Ga0495651_0069203 | 3300046462 | Bacteria | 2689 |
| 672 | Ga0495653_0000831 | 3300046463 | Bacteria | 23809 |
| 673 | Ga0495653_0005900 | 3300046463 | Bacteria | 10025 |
| 674 | Ga0495580_0001325 | 3300046472 | Bacteria | 21840 |
| 675 | Ga0495580_0002566 | 3300046472 | Bacteria | 15799 |
| 676 | Ga0495580_0002924 | 3300046472 | Bacteria | 14678 |
| 677 | Ga0495582_0000901 | 3300046473 | Bacteria | 16533 |
| 678 | Ga0495662_0001229 | 3300046476 | Bacteria | 12618 |
| 679 | Ga0495664_0000375 | 3300046477 | Bacteria | 21707 |
| 680 | Ga0495584_0043759 | 3300046491 | Bacteria | 2260 |
| 681 | Ga0495594_0000585 | 3300046499 | Bacteria | 18782 |
| 682 | Ga0495583_0000030 | 3300046506 | Bacteria | 254970 |
| 683 | Ga0495583_0013465 | 3300046506 | Bacteria | 4560 |
| 684 | Ga0495608_0000598 | 3300046511 | Bacteria | 24822 |
| 685 | Ga0495616_0064221 | 3300046513 | Bacteria | 1792 |
| 686 | Ga0495618_0000619 | 3300046514 | Bacteria | 25221 |
| 687 | Ga0495637_0061012 | 3300046520 | Bacteria | 1547 |
| 688 | Ga0495643_0000991 | 3300046522 | Bacteria | 29043 |
| 689 | Ga0495648_0000750 | 3300046524 | Bacteria | 34697 |
| 690 | Ga0495663_0002995 | 3300046525 | Bacteria | 4964 |
| 691 | Ga0495666_0032543 | 3300046526 | Bacteria | 2551 |
| 692 | Ga0495666_0047429 | 3300046526 | Bacteria | 2069 |
| 693 | Ga0495652_0001337 | 3300046529 | Bacteria | 27446 |
| 694 | Ga0495665_0052331 | 3300046531 | Bacteria | 2162 |
| 695 | Ga0495640_0007724 | 3300046533 | Bacteria | 8457 |
| 696 | Ga0495640_0016879 | 3300046533 | Bacteria | 5454 |
| 697 | Ga0495586_0005186 | 3300046535 | Bacteria | 6973 |
| 698 | Ga0495645_0013392 | 3300046543 | Bacteria | 5796 |
| 699 | Ga0495633_0001042 | 3300046558 | Bacteria | 22695 |
| 700 | Ga0495667_0002126 | 3300046559 | Bacteria | 13187 |
| 701 | Ga0495667_0197559 | 3300046559 | Bacteria | 1288 |
| 702 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 703 | Ga0495634_0001639 | 3300046642 | Bacteria | 19477 |
| 704 | Ga0495634_0006401 | 3300046642 | Bacteria | 8950 |
| 705 | Ga0495625_0000264 | 3300046660 | Bacteria | 81625 |
| 706 | Ga0495625_0017790 | 3300046660 | Bacteria | 5556 |
| 707 | Ga0495635_0000952 | 3300046663 | Bacteria | 19105 |
| 708 | Ga0495635_0087499 | 3300046663 | Bacteria | 2132 |
| 709 | Ga0495623_0025306 | 3300046679 | Bacteria | 3823 |
| 710 | Ga0495647_0000615 | 3300046681 | Bacteria | 10509 |
| 711 | Ga0495647_0011876 | 3300046681 | Bacteria | 2989 |
| 712 | Ga0495647_0034798 | 3300046681 | Bacteria | 1889 |
| 713 | Ga0495658_0001383 | 3300046683 | Bacteria | 12728 |
| 714 | Ga0495669_0000197 | 3300046684 | Bacteria | 37314 |
| 715 | Ga0495613_0010038 | 3300046689 | Bacteria | 7033 |
| 716 | Ga0495613_0118510 | 3300046689 | Bacteria | 1903 |
| 717 | Ga0495624_0021857 | 3300046690 | Bacteria | 4238 |
| 718 | Ga0495600_0000663 | 3300046809 | Bacteria | 17927 |
| 719 | Ga0495660_0096138 | 3300046810 | Bacteria | 1531 |
| 720 | Ga0495581_0005956 | 3300047315 | Bacteria | 7069 |
| 721 | Ga0495604_0000478 | 3300047317 | Bacteria | 35243 |
| 722 | Ga0495674_0001761 | 3300047319 | Bacteria | 21319 |
| 723 | Ga0495674_0013013 | 3300047319 | Bacteria | 7831 |
| 724 | Ga0495676_0027380 | 3300047321 | Bacteria | 4888 |
| 725 | Ga0495680_0000640 | 3300047322 | Bacteria | 39222 |
| 726 | Ga0495687_000178 | 3300047443 | Bacteria | 93234 |
| 727 | Ga0495687_000511 | 3300047443 | Bacteria | 46733 |
| 728 | Ga0495673_0018100 | 3300047469 | Bacteria | 3562 |
| 729 | Ga0495681_0005817 | 3300047470 | Bacteria | 8192 |
| 730 | Ga0495684_0017312 | 3300047471 | Bacteria | 5547 |
| 731 | Ga0495684_0093828 | 3300047471 | Bacteria | 2273 |
| 732 | Ga0495686_0000063 | 3300047472 | Bacteria | 228575 |
| 733 | Ga0495686_0000202 | 3300047472 | Bacteria | 110778 |
| 734 | Ga0495686_0000314 | 3300047472 | Bacteria | 81139 |
| 735 | Ga0495686_0002137 | 3300047472 | Bacteria | 19318 |
| 736 | Ga0495686_0002426 | 3300047472 | Bacteria | 17624 |
| 737 | Ga0495686_0004291 | 3300047472 | Bacteria | 11807 |
| 738 | Ga0495593_0000868 | 3300047673 | Bacteria | 17512 |
| 739 | Ga0495593_0003121 | 3300047673 | Bacteria | 9957 |
| 740 | Ga0495602_0007281 | 3300048088 | Bacteria | 11583 |
| 741 | Ga0495614_0011927 | 3300048089 | Bacteria | 3819 |
| 742 | Ga0496101_0017440 | 3300048904 | Bacteria | 4870 |
| 743 | Ga0496101_0052742 | 3300048904 | Bacteria | 2933 |
| 744 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 745 | Ga0496102_0039292 | 3300048905 | Bacteria | 4275 |
| 746 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 747 | Ga0496103_0000647 | 3300048906 | Bacteria | 26335 |
| 748 | Ga0496103_0001988 | 3300048906 | Bacteria | 13196 |
| 749 | Ga0496103_0002748 | 3300048906 | Bacteria | 10979 |
| 750 | Ga0496103_0029649 | 3300048906 | Bacteria | 3325 |
| 751 | Ga0496103_0056896 | 3300048906 | Bacteria | 2428 |
| 752 | Ga0496104_0000564 | 3300048907 | Bacteria | 31627 |
| 753 | Ga0496104_0002243 | 3300048907 | Bacteria | 16675 |
| 754 | Ga0496104_0013359 | 3300048907 | Bacteria | 7399 |
| 755 | Ga0496104_0013871 | 3300048907 | Bacteria | 7270 |
| 756 | Ga0496104_0016404 | 3300048907 | Bacteria | 6728 |
| 757 | Ga0496104_0032096 | 3300048907 | Bacteria | 4888 |
| 758 | Ga0496104_0081544 | 3300048907 | Bacteria | 3085 |
| 759 | Ga0496104_0134226 | 3300048907 | Bacteria | 2378 |
| 760 | Ga0496104_0140123 | 3300048907 | Bacteria | 2324 |
| 761 | Ga0496105_0000342 | 3300048908 | Bacteria | 30591 |
| 762 | Ga0496105_0000715 | 3300048908 | Bacteria | 22456 |
| 763 | Ga0496105_0006258 | 3300048908 | Bacteria | 9140 |
| 764 | Ga0496105_0006737 | 3300048908 | Bacteria | 8833 |
| 765 | Ga0496105_0036602 | 3300048908 | Bacteria | 4043 |
| 766 | Ga0496106_0012103 | 3300048909 | Bacteria | 6367 |
| 767 | Ga0496106_0029366 | 3300048909 | Bacteria | 4097 |
| 768 | Ga0496106_0034060 | 3300048909 | Bacteria | 3803 |
| 769 | Ga0496106_0040178 | 3300048909 | Bacteria | 3503 |
| 770 | Ga0496107_0001624 | 3300048910 | Bacteria | 14007 |
| 771 | Ga0496107_0007276 | 3300048910 | Bacteria | 7627 |
| 772 | Ga0496107_0095295 | 3300048910 | Bacteria | 2178 |
| 773 | Ga0496108_0001959 | 3300048911 | Bacteria | 16485 |
| 774 | Ga0496108_0020753 | 3300048911 | Bacteria | 5400 |
| 775 | Ga0496109_0000673 | 3300048912 | Bacteria | 28328 |
| 776 | Ga0496109_0038257 | 3300048912 | Bacteria | 4337 |
| 777 | Ga0496109_0041071 | 3300048912 | Bacteria | 4191 |
| 778 | Ga0496110_0003774 | 3300048913 | Bacteria | 11666 |
| 779 | Ga0496110_0060818 | 3300048913 | Bacteria | 3332 |
| 780 | Ga0496111_0000369 | 3300048914 | Bacteria | 22401 |
| 781 | Ga0496111_0067133 | 3300048914 | Bacteria | 2605 |
| 782 | Ga0496112_0000606 | 3300048915 | Bacteria | 24671 |
| 783 | Ga0496112_0017906 | 3300048915 | Bacteria | 6666 |
| 784 | Ga0496112_0215811 | 3300048915 | Bacteria | 1875 |
| 785 | Ga0496113_0001322 | 3300048916 | Bacteria | 13703 |
| 786 | Ga0496113_0067158 | 3300048916 | Bacteria | 2718 |
| 787 | Ga0496113_0084950 | 3300048916 | Bacteria | 2431 |
| 788 | Ga0496114_0000708 | 3300048917 | Bacteria | 24844 |
| 789 | Ga0496114_0058220 | 3300048917 | Bacteria | 3226 |
| 790 | Ga0496115_0000416 | 3300048918 | Bacteria | 34725 |
| 791 | Ga0496115_0001862 | 3300048918 | Bacteria | 15087 |
| 792 | Ga0496115_0007532 | 3300048918 | Bacteria | 8017 |
| 793 | Ga0496115_0050728 | 3300048918 | Bacteria | 3325 |
| 794 | Ga0496115_0174840 | 3300048918 | Bacteria | 1775 |
| 795 | Ga0496116_0003410 | 3300048919 | Bacteria | 15719 |
| 796 | Ga0496116_0023524 | 3300048919 | Bacteria | 4586 |
| 797 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 798 | Ga0496117_0000249 | 3300048920 | Bacteria | 101472 |
| 799 | Ga0496117_0001241 | 3300048920 | Bacteria | 38164 |
| 800 | Ga0496117_0030507 | 3300048920 | Bacteria | 4136 |
| 801 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 802 | Ga0496118_0000580 | 3300048921 | Bacteria | 60421 |
| 803 | Ga0496118_0000802 | 3300048921 | Bacteria | 50216 |
| 804 | Ga0496118_0011692 | 3300048921 | Bacteria | 8531 |
| 805 | Ga0496118_0017141 | 3300048921 | Bacteria | 6609 |
| 806 | Ga0496119_0001855 | 3300048922 | Bacteria | 24389 |
| 807 | Ga0496120_0000014 | 3300048923 | Bacteria | 323163 |
| 808 | Ga0496120_0010570 | 3300048923 | Bacteria | 6424 |
| 809 | Ga0496120_0014577 | 3300048923 | Bacteria | 5232 |
| 810 | Ga0496121_0000087 | 3300048924 | Bacteria | 222451 |
| 811 | Ga0496121_0000387 | 3300048924 | Bacteria | 89835 |
| 812 | Ga0496121_0000529 | 3300048924 | Bacteria | 72533 |
| 813 | Ga0496121_0000931 | 3300048924 | Bacteria | 52909 |
| 814 | Ga0496121_0001436 | 3300048924 | Bacteria | 40248 |
| 815 | Ga0496121_0003691 | 3300048924 | Bacteria | 21490 |
| 816 | Ga0496121_0028861 | 3300048924 | Bacteria | 5152 |
| 817 | Ga0496122_0009815 | 3300048925 | Bacteria | 9998 |
| 818 | Ga0496122_0011384 | 3300048925 | Bacteria | 9017 |
| 819 | Ga0496123_0000569 | 3300048926 | Bacteria | 63009 |
| 820 | Ga0496123_0001083 | 3300048926 | Bacteria | 41036 |
| 821 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 822 | Ga0496124_0000626 | 3300048927 | Bacteria | 58823 |
| 823 | Ga0496125_0001330 | 3300048928 | Bacteria | 36490 |
| 824 | Ga0496125_0005669 | 3300048928 | Bacteria | 13779 |
| 825 | Ga0496125_0157362 | 3300048928 | Bacteria | 1550 |
| 826 | Ga0496126_0000752 | 3300048929 | Bacteria | 58828 |
| 827 | Ga0496126_0001751 | 3300048929 | Bacteria | 32139 |
| 828 | Ga0496126_0028093 | 3300048929 | Bacteria | 5364 |
| 829 | Ga0496126_0066390 | 3300048929 | Bacteria | 3225 |
| 830 | Ga0501032_0117607 | 3300049569 | Bacteria | 1758 |
| 831 | Ga0501033_0017457 | 3300049570 | Bacteria | 5421 |
| 832 | Ga0501033_0025268 | 3300049570 | Bacteria | 4474 |
| 833 | Ga0501033_0042213 | 3300049570 | Bacteria | 3401 |
| 834 | Ga0501034_0000008 | 3300049571 | Bacteria | 354712 |
| 835 | Ga0501034_0029849 | 3300049571 | Bacteria | 5541 |
| 836 | Ga0501036_0002203 | 3300049572 | Bacteria | 15235 |
| 837 | Ga0501038_0018620 | 3300049574 | Bacteria | 6272 |
| 838 | Ga0501039_0000061 | 3300049575 | Bacteria | 85455 |
| 839 | Ga0501039_0049088 | 3300049575 | Bacteria | 3262 |
| 840 | Ga0501040_0001802 | 3300049576 | Bacteria | 13756 |
| 841 | Ga0501040_0134042 | 3300049576 | Bacteria | 1743 |
| 842 | Ga0501042_0010042 | 3300049578 | Bacteria | 6330 |
| 843 | Ga0501046_0009690 | 3300049580 | Bacteria | 8308 |
| 844 | Ga0501046_0011140 | 3300049580 | Bacteria | 7702 |
| 845 | Ga0501047_0000095 | 3300049581 | Bacteria | 108671 |
| 846 | Ga0501047_0004823 | 3300049581 | Bacteria | 12672 |
| 847 | Ga0501047_0008015 | 3300049581 | Bacteria | 9963 |
| 848 | Ga0501047_0069987 | 3300049581 | Bacteria | 3378 |
| 849 | Ga0501048_0026713 | 3300049582 | Bacteria | 4202 |
| 850 | Ga0501048_0112611 | 3300049582 | Bacteria | 1922 |
| 851 | Ga0501067_0003439 | 3300049583 | Bacteria | 8716 |
| 852 | Ga0501067_0036505 | 3300049583 | Bacteria | 2728 |
| 853 | Ga0501072_0000883 | 3300049588 | Bacteria | 21971 |
| 854 | Ga0501072_0005783 | 3300049588 | Bacteria | 9418 |
| 855 | Ga0501073_0013480 | 3300049589 | Bacteria | 5946 |
| 856 | Ga0501075_0000015 | 3300049591 | Bacteria | 73176 |
| 857 | Ga0501076_0000009 | 3300049592 | Bacteria | 117970 |
| 858 | Ga0501077_0018297 | 3300049593 | Bacteria | 4434 |
| 859 | Ga0501080_0000013 | 3300049742 | Bacteria | 103178 |
| 860 | Ga0501081_0002218 | 3300049743 | Bacteria | 12224 |
| 861 | Ga0501035_0000013 | 3300049822 | Bacteria | 255756 |
| 862 | Ga0501044_0000004 | 3300049823 | Bacteria | 327475 |
| 863 | Ga0501044_0044050 | 3300049823 | Bacteria | 4634 |
| 864 | Ga0501044_0076940 | 3300049823 | Bacteria | 3385 |
| 865 | Ga0501044_0143805 | 3300049823 | Bacteria | 2372 |
| 866 | Ga0501045_0136393 | 3300049824 | Bacteria | 1824 |
| 867 | nmdc:mga03683_23_c1 | 3300050489 | Bacteria | 80877 |
| 868 | nmdc:mga03n38_1015_c1 | 3300050490 | Bacteria | 7689 |
| 869 | nmdc:mga00v17_26511_c1 | 3300050491 | Bacteria | 3378 |
| 870 | nmdc:mga00v17_89719_c1 | 3300050491 | Bacteria | 1929 |
| 871 | nmdc:mga0yw44_14861_c1 | 3300050492 | Bacteria | 4150 |
| 872 | nmdc:mga0k408_111780_c1 | 3300050493 | Bacteria | 1615 |
| 873 | nmdc:mga0k408_19_c1 | 3300050493 | Bacteria | 112120 |
| 874 | nmdc:mga07m45_31_c1 | 3300050496 | Bacteria | 81959 |
| 875 | nmdc:mga05p37_10245_c1 | 3300050507 | Bacteria | 11130 |
| 876 | nmdc:mga05p37_129232_c1 | 3300050507 | Bacteria | 3101 |
| 877 | nmdc:mga05p37_172988_c1 | 3300050507 | Bacteria | 2633 |
| 878 | nmdc:mga05p37_18115_c1 | 3300050507 | Bacteria | 8508 |
| 879 | nmdc:mga05p37_2006_c1 | 3300050507 | Bacteria | 23767 |
| 880 | nmdc:mga05p37_245_c1 | 3300050507 | Bacteria | 55562 |
| 881 | nmdc:mga05p37_52807_c1 | 3300050507 | Bacteria | 4998 |
| 882 | nmdc:mga09592_2823_c1 | 3300050508 | Bacteria | 14079 |
| 883 | nmdc:mga09592_30121_c1 | 3300050508 | Bacteria | 4516 |
| 884 | nmdc:mga09592_6212_c1 | 3300050508 | Bacteria | 9721 |
| 885 | nmdc:mga09592_7451_c1 | 3300050508 | Bacteria | 8893 |
| 886 | nmdc:mga0qj67_16758_c1 | 3300050509 | Bacteria | 5564 |
| 887 | nmdc:mga0qj67_232_c1 | 3300050509 | Bacteria | 38070 |
| 888 | nmdc:mga0qj67_69021_c1 | 3300050509 | Bacteria | 2818 |
| 889 | nmdc:mga06r32_33494_c1 | 3300050510 | Bacteria | 4839 |
| 890 | nmdc:mga06r32_36726_c1 | 3300050510 | Bacteria | 4632 |
| 891 | nmdc:mga06r32_45268_c1 | 3300050510 | Bacteria | 4194 |
| 892 | nmdc:mga08y16_15960_c1 | 3300050511 | Bacteria | 7896 |
| 893 | nmdc:mga08y16_29430_c1 | 3300050511 | Bacteria | 5787 |
| 894 | nmdc:mga08y16_42093_c1 | 3300050511 | Bacteria | 4784 |
| 895 | nmdc:mga08y16_468_c1 | 3300050511 | Bacteria | 37480 |
| 896 | nmdc:mga0n895_105232_c1 | 3300050512 | Bacteria | 2834 |
| 897 | nmdc:mga0n895_24439_c1 | 3300050512 | Bacteria | 5694 |
| 898 | nmdc:mga0n895_6448_c1 | 3300050512 | Bacteria | 9964 |
| 899 | nmdc:mga0rr50_151071_c1 | 3300050513 | Bacteria | 1877 |
| 900 | nmdc:mga0rr50_44562_c1 | 3300050513 | Bacteria | 3254 |
| 901 | nmdc:mga0rr50_5665_c1 | 3300050513 | Bacteria | 7479 |
| 902 | nmdc:mga08x19_52_c1 | 3300050514 | Bacteria | 123790 |
| 903 | nmdc:mga0a205_140973_c1 | 3300050515 | Bacteria | 2311 |
| 904 | nmdc:mga0a205_159590_c1 | 3300050515 | Bacteria | 2152 |
| 905 | nmdc:mga0a205_169483_c1 | 3300050515 | Bacteria | 2079 |
| 906 | nmdc:mga0a205_194389_c1 | 3300050515 | Bacteria | 1920 |
| 907 | nmdc:mga0a205_41228_c1 | 3300050515 | Bacteria | 4446 |
| 908 | nmdc:mga0a205_7680_c1 | 3300050515 | Bacteria | 9783 |
| 909 | nmdc:mga0a205_95522_c1 | 3300050515 | Bacteria | 2871 |
| 910 | nmdc:mga0sz30_481_c3 | 3300050516 | Bacteria | 6951 |
| 911 | Ga0495601_0000751 | 3300053077 | Bacteria | 17458 |
| 912 | Ga0495601_0030784 | 3300053077 | Bacteria | 3333 |
| 913 | Ga0495612_0000428 | 3300053078 | Bacteria | 16790 |
| 914 | Ga0495612_0016650 | 3300053078 | Bacteria | 2946 |
| 915 | Ga0500610_0014586 | 3300053079 | Bacteria | 3691 |
| 916 | Ga0495655_0000422 | 3300053083 | Bacteria | 7176 |
| 917 | Ga0495595_0000142 | 3300053084 | Bacteria | 29571 |
| 918 | Ga0495619_0000533 | 3300053085 | Bacteria | 25127 |
| 919 | Ga0495619_0003380 | 3300053085 | Bacteria | 10312 |
| 920 | Ga0495619_0029419 | 3300053085 | Bacteria | 3548 |
| 921 | Ga0495619_0042885 | 3300053085 | Bacteria | 2964 |
| 922 | Ga0500643_001558 | 3300053087 | Bacteria | 12980 |
| 923 | Ga0500651_0007408 | 3300053093 | Bacteria | 6408 |
| 924 | Ga0500556_0000143 | 3300053104 | Bacteria | 59621 |
| 925 | Ga0500592_000884 | 3300053116 | Bacteria | 4888 |
| 926 | Ga0500618_000909 | 3300053125 | Bacteria | 15440 |
| 927 | Ga0500573_0000028 | 3300053140 | Bacteria | 142610 |
| 928 | Ga0500622_0001426 | 3300053156 | Bacteria | 19193 |
| 929 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 930 | Ga0500645_000011 | 3300053730 | Bacteria | 169616 |
| 931 | Ga0501084_0003161 | 3300054114 | Bacteria | 13316 |
| 932 | Ga0587084_004998 | 3300059477 | Bacteria | 1548 |
| 933 | Ga0501082_0002818 | 3300060353 | Bacteria | 15178 |
| 934 | Ga0501082_0026409 | 3300060353 | Bacteria | 5004 |
| 935 | Ga0530510_0000035 | 3300061734 | Bacteria | 61298 |
| 936 | Ga0530510_0103281 | 3300061734 | Bacteria | 2084 |
| 937 | 2585262516 | 2582581305 | Bacteria | 4895574 |
| 938 | 2600200913 | 2599185354 | Bacteria | 4398675 |
| 939 | 2753765237 | 2751185897 | Bacteria | 5322941 |
| 940 | 8057102985 | 8057101203 | Bacteria | 5034064 |
| 941 | Ga0068856_100007818 | |||
| 942 | JGI24736J21556_1001509 | |||
| 943 | JGI24741J21665_1003682 | |||
| 944 | JGI24752J21851_1000027 | |||
| 945 | JGI24740J21852_10003653 | |||
| 946 | JGI24739J22299_10009686 | |||
| 947 | JGI24739J22299_10009980 | |||
| 948 | JGI24737J22298_10001928 | |||
| 949 | JGI24737J22298_10006746 | |||
| 950 | JGI24735J21928_10029735 | |||
| 951 | JGI24750J21931_1000041 | |||
| 952 | JGI24748J21848_1000096 | |||
| 953 | JGI24738J21930_10003555 | |||
| 954 | JGI24738J21930_10004883 | |||
| 955 | JGI24034J26672_10000028 | |||
| 956 | JGI24742J22300_10001008 | |||
| 957 | JGI25165J46597_1000008 | |||
| 958 | JGI25165J46597_1000297 | |||
| 959 | JGI25165J46597_1000489 | |||
| 960 | JGI25153J46596_10000113 | |||
| 961 | JGI25153J46596_10000672 | |||
| 962 | Ga0055525_1000051 | |||
| 963 | Ga0055542_1000677 | |||
| 964 | Ga0055542_1002995 | |||
| 965 | Ga0055529_1000016 | |||
| 966 | Ga0058863_11589608 | |||
| 967 | Ga0058862_12249235 | |||
| 968 | Ga0065165_1009874 | |||
| 969 | Ga0065707_10081714 | |||
| 970 | Ga0070658_10000116 | |||
| 971 | Ga0070658_10002598 | |||
| 972 | Ga0070658_10003253 | |||
| 973 | Ga0070658_10018921 | |||
| 974 | Ga0070658_10027870 | |||
| 975 | Ga0070658_10093562 | |||
| 976 | Ga0070676_10014080 | |||
| 977 | Ga0070690_100000003 | |||
| 978 | Ga0070690_100024373 | |||
| 979 | Ga0070690_100036723 | |||
| 980 | Ga0070670_100005173 | |||
| 981 | Ga0070670_100081940 | |||
| 982 | Ga0070666_10000006 | |||
| 983 | Ga0070666_10000410 | |||
| 984 | Ga0070680_100000166 | |||
| 985 | Ga0070680_100047651 | |||
| 986 | Ga0070680_100078812 | |||
| 987 | Ga0070682_100044476 | |||
| 988 | Ga0070660_100003168 | |||
| 989 | Ga0070660_100040499 | |||
| 990 | Ga0070660_100064491 | |||
| 991 | Ga0070689_100013461 | |||
| 992 | Ga0070689_100032566 | |||
| 993 | Ga0070691_10001140 | |||
| 994 | Ga0070692_10024711 | |||
| 995 | Ga0070668_100029899 | |||
| 996 | Ga0070669_100000014 | |||
| 997 | Ga0070669_100066282 | |||
| 998 | Ga0070671_100035911 | |||
| 999 | Ga0070674_100000746 | |||
| 1000 | Ga0070674_100018639 | |||
| 1001 | Ga0070667_100024894 | |||
| 1002 | Ga0070667_100069756 | |||
| 1003 | Ga0070667_100143696 | |||
| 1004 | Ga0070709_10007492 | |||
| 1005 | Ga0070709_10013017 | |||
| 1006 | Ga0070714_100000761 | |||
| 1007 | Ga0070714_100007392 | |||
| 1008 | Ga0070713_100000007 | |||
| 1009 | Ga0070713_100010825 | |||
| 1010 | Ga0070713_100041897 | |||
| 1011 | Ga0070713_100130626 | |||
| 1012 | Ga0070711_100003889 | |||
| 1013 | Ga0070711_100012918 | |||
| 1014 | Ga0070711_100035173 | |||
| 1015 | Ga0070711_100047124 | |||
| 1016 | Ga0070711_100048812 | |||
| 1017 | Ga0070705_100002764 | |||
| 1018 | Ga0070705_100093762 | |||
| 1019 | Ga0070700_100074742 | |||
| 1020 | Ga0070694_100035591 | |||
| 1021 | Ga0070694_100050902 | |||
| 1022 | Ga0070663_100007242 | |||
| 1023 | Ga0070678_100000585 | |||
| 1024 | Ga0070678_100094202 | |||
| 1025 | Ga0070662_100008234 | |||
| 1026 | Ga0070662_100026287 | |||
| 1027 | Ga0070681_10000966 | |||
| 1028 | Ga0070681_10002890 | |||
| 1029 | Ga0070681_10003601 | |||
| 1030 | Ga0070681_10020624 | |||
| 1031 | Ga0070681_10154665 | |||
| 1032 | Ga0070685_10000072 | |||
| 1033 | Ga0070685_10021125 | |||
| 1034 | Ga0070698_100032083 | |||
| 1035 | Ga0070699_100023877 | |||
| 1036 | Ga0070679_100008818 | |||
| 1037 | Ga0070679_100022694 | |||
| 1038 | Ga0070679_100058090 | |||
| 1039 | Ga0070679_100067291 | |||
| 1040 | Ga0070684_100087173 | |||
| 1041 | Ga0070697_100008449 | |||
| 1042 | Ga0070697_100101520 | |||
| 1043 | Ga0070697_100104358 | |||
| 1044 | Ga0070697_100147862 | |||
| 1045 | Ga0068853_100004213 | |||
| 1046 | Ga0068853_100065265 | |||
| 1047 | Ga0070686_100000022 | |||
| 1048 | Ga0070695_100018861 | |||
| 1049 | Ga0070695_100055638 | |||
| 1050 | Ga0070696_100143284 | |||
| 1051 | Ga0070693_100006405 | |||
| 1052 | Ga0070665_100000019 | |||
| 1053 | Ga0070665_100000058 | |||
| 1054 | Ga0070665_100002528 | |||
| 1055 | Ga0070665_100009420 | |||
| 1056 | Ga0070665_100024420 | |||
| 1057 | Ga0070665_100035688 | |||
| 1058 | Ga0070665_100125292 | |||
| 1059 | Ga0070665_100147500 | |||
| 1060 | Ga0070665_100221543 | |||
| 1061 | Ga0070704_100052902 | |||
| 1062 | Ga0070704_100126179 | |||
| 1063 | Ga0070704_100181114 | |||
| 1064 | Ga0068855_100003048 | |||
| 1065 | Ga0068855_100003607 | |||
| 1066 | Ga0068855_100032581 | |||
| 1067 | Ga0068855_100220888 | |||
| 1068 | Ga0068855_100244188 | |||
| 1069 | Ga0068857_100023641 | |||
| 1070 | Ga0068857_100035743 | |||
| 1071 | Ga0068857_100076939 | |||
| 1072 | Ga0068857_100154400 | |||
| 1073 | Ga0068856_100000142 | |||
| 1074 | Ga0068856_100040567 | |||
| 1075 | Ga0068856_100060295 | |||
| 1076 | Ga0070702_100025238 | |||
| 1077 | Ga0070702_100049483 | |||
| 1078 | Ga0068852_100000043 | |||
| 1079 | Ga0068852_100043311 | |||
| 1080 | Ga0068852_100053990 | |||
| 1081 | Ga0068852_100081292 | |||
| 1082 | Ga0068859_100002673 | |||
| 1083 | Ga0068859_100022887 | |||
| 1084 | Ga0068859_100047888 | |||
| 1085 | Ga0068859_100051845 | |||
| 1086 | Ga0068859_100062269 | |||
| 1087 | Ga0068859_100064968 | |||
| 1088 | Ga0068864_100000565 | |||
| 1089 | Ga0068864_100004975 | |||
| 1090 | Ga0068864_100010237 | |||
| 1091 | Ga0068864_100040174 | |||
| 1092 | Ga0068861_100000111 | |||
| 1093 | Ga0068861_100008113 | |||
| 1094 | Ga0068851_10004282 | |||
| 1095 | Ga0068870_10064079 | |||
| 1096 | Ga0068863_100000048 | |||
| 1097 | Ga0068863_100000051 | |||
| 1098 | Ga0068863_100095516 | |||
| 1099 | Ga0068858_100000254 | |||
| 1100 | Ga0068858_100110985 | |||
| 1101 | Ga0068858_100113002 | |||
| 1102 | Ga0068858_100161656 | |||
| 1103 | Ga0068860_100000014 | |||
| 1104 | Ga0068860_100000187 | |||
| 1105 | Ga0068860_100083473 | |||
| 1106 | Ga0068862_100023072 | |||
| 1107 | Ga0068862_100062843 | |||
| 1108 | Ga0081455_10000088 | |||
| 1109 | Ga0081455_10017022 | |||
| 1110 | Ga0081455_10028380 | |||
| 1111 | Ga0081538_10052953 | |||
| 1112 | Ga0081540_1004937 | |||
| 1113 | Ga0081540_1055391 | |||
| 1114 | Ga0070717_10004903 | |||
| 1115 | Ga0075363_100009459 | |||
| 1116 | Ga0075364_10134862 | |||
| 1117 | Ga0070716_100012383 | |||
| 1118 | Ga0070716_100021723 | |||
| 1119 | Ga0070712_100000015 | |||
| 1120 | Ga0070712_100001349 | |||
| 1121 | Ga0070712_100022267 | |||
| 1122 | Ga0075362_10000095 | |||
| 1123 | Ga0075369_10002175 | |||
| 1124 | Ga0075369_10046940 | |||
| 1125 | Ga0075366_10024202 | |||
| 1126 | Ga0097621_100000667 | |||
| 1127 | Ga0097621_100045788 | |||
| 1128 | Ga0075370_10000025 | |||
| 1129 | Ga0075370_10099057 | |||
| 1130 | Ga0068871_100006814 | |||
| 1131 | Ga0068871_100073058 | |||
| 1132 | Ga0075428_100000380 | |||
| 1133 | Ga0075428_100061682 | |||
| 1134 | Ga0075428_100073996 | |||
| 1135 | Ga0075428_100142075 | |||
| 1136 | Ga0075430_100007128 | |||
| 1137 | Ga0075430_100037467 | |||
| 1138 | Ga0075430_100055367 | |||
| 1139 | Ga0075431_100012379 | |||
| 1140 | Ga0075431_100018891 | |||
| 1141 | Ga0075431_100053013 | |||
| 1142 | Ga0075433_10001374 | |||
| 1143 | Ga0075433_10064307 | |||
| 1144 | Ga0075433_10070998 | |||
| 1145 | Ga0075433_10109601 | |||
| 1146 | Ga0075433_10181572 | |||
| 1147 | Ga0075434_100000753 | |||
| 1148 | Ga0075434_100014278 | |||
| 1149 | Ga0075434_100019894 | |||
| 1150 | Ga0075434_100030105 | |||
| 1151 | Ga0075434_100045158 | |||
| 1152 | Ga0075434_100054366 | |||
| 1153 | Ga0075434_100111213 | |||
| 1154 | Ga0075429_100000097 | |||
| 1155 | Ga0075429_100002097 | |||
| 1156 | Ga0075429_100012504 | |||
| 1157 | Ga0068865_100002716 | |||
| 1158 | Ga0075436_100000024 | |||
| 1159 | Ga0097620_100002673 | |||
| 1160 | Ga0097620_100022887 | |||
| 1161 | Ga0097620_100047889 | |||
| 1162 | Ga0097620_100051843 | |||
| 1163 | Ga0097620_100062268 | |||
| 1164 | Ga0097620_100064968 | |||
| 1165 | Ga0075435_100020165 | |||
| 1166 | Ga0075435_100048993 | |||
| 1167 | Ga0075435_100063562 | |||
| 1168 | Ga0099794_10004284 | |||
| 1169 | Ga0099795_10000617 | |||
| 1170 | Ga0099795_10001314 | |||
| 1171 | Ga0099795_10001349 | |||
| 1172 | Ga0105240_10000733 | |||
| 1173 | Ga0105240_10022602 | |||
| 1174 | Ga0105240_10023442 | |||
| 1175 | Ga0105240_10034962 | |||
| 1176 | Ga0105240_10036767 | |||
| 1177 | Ga0105240_10055350 | |||
| 1178 | Ga0105240_10061130 | |||
| 1179 | Ga0105240_10186611 | |||
| 1180 | Ga0105240_10350181 | |||
| 1181 | Ga0111539_10001385 | |||
| 1182 | Ga0111539_10006891 | |||
| 1183 | Ga0111539_10007288 | |||
| 1184 | Ga0111539_10021041 | |||
| 1185 | Ga0111539_10033953 | |||
| 1186 | Ga0105245_10001618 | |||
| 1187 | Ga0105245_10027313 | |||
| 1188 | Ga0105247_10025691 | |||
| 1189 | Ga0114129_10000156 | |||
| 1190 | Ga0114129_10000625 | |||
| 1191 | Ga0114129_10014790 | |||
| 1192 | Ga0114129_10021337 | |||
| 1193 | Ga0114129_10056170 | |||
| 1194 | Ga0114129_10067337 | |||
| 1195 | Ga0114129_10098690 | |||
| 1196 | Ga0105243_10000782 | |||
| 1197 | Ga0105243_10021440 | |||
| 1198 | Ga0105243_10047215 | |||
| 1199 | Ga0105241_10001365 | |||
| 1200 | Ga0105241_10003444 | |||
| 1201 | Ga0105241_10007433 | |||
| 1202 | Ga0105241_10042106 | |||
| 1203 | Ga0105241_10066259 | |||
| 1204 | Ga0105242_10029836 | |||
| 1205 | Ga0105242_10039657 | |||
| 1206 | Ga0105242_10075685 | |||
| 1207 | Ga0105248_10002303 | |||
| 1208 | Ga0105248_10007409 | |||
| 1209 | Ga0105248_10013887 | |||
| 1210 | Ga0105248_10044462 | |||
| 1211 | Ga0105248_10071941 | |||
| 1212 | Ga0105248_10075907 | |||
| 1213 | Ga0105248_10096555 | |||
| 1214 | Ga0105248_10257644 | |||
| 1215 | Ga0105237_10002363 | |||
| 1216 | Ga0105237_10030182 | |||
| 1217 | Ga0105238_10001921 | |||
| 1218 | Ga0105238_10013158 | |||
| 1219 | Ga0105238_10060392 | |||
| 1220 | Ga0105238_10125721 | |||
| 1221 | Ga0105238_10193015 | |||
| 1222 | Ga0105249_10000104 | |||
| 1223 | Ga0105249_10006192 | |||
| 1224 | Ga0099796_10002367 | |||
| 1225 | Ga0099796_10003638 | |||
| 1226 | Ga0099796_10009676 | |||
| 1227 | Ga0105239_10000138 | |||
| 1228 | Ga0105239_10024748 | |||
| 1229 | Ga0105239_10067661 | |||
| 1230 | Ga0105239_10085669 | |||
| 1231 | Ga0105239_10097212 | |||
| 1232 | Ga0157371_10000146 | |||
| 1233 | Ga0157370_10000503 | |||
| 1234 | Ga0157370_10001658 | |||
| 1235 | Ga0157370_10024422 | |||
| 1236 | Ga0157369_10009865 | |||
| 1237 | Ga0157369_10038161 | |||
| 1238 | Ga0157369_10055615 | |||
| 1239 | Ga0157378_10044499 | |||
| 1240 | Ga0157378_10059554 | |||
| 1241 | Ga0157378_10104103 | |||
| 1242 | Ga0163162_10002269 | |||
| 1243 | Ga0163162_10014904 | |||
| 1244 | Ga0163162_10103353 | |||
| 1245 | Ga0163162_10138786 | |||
| 1246 | Ga0163162_10180379 | |||
| 1247 | Ga0157372_10110327 | |||
| 1248 | Ga0157372_10151050 | |||
| 1249 | Ga0157372_10234477 | |||
| 1250 | Ga0157372_10369694 | |||
| 1251 | Ga0157375_10029036 | |||
| 1252 | Ga0163163_10000016 | |||
| 1253 | Ga0163163_10006398 | |||
| 1254 | Ga0163163_10102214 | |||
| 1255 | Ga0157380_10000181 | |||
| 1256 | Ga0157380_10006753 | |||
| 1257 | Ga0157380_10070190 | |||
| 1258 | Ga0157379_10019689 | |||
| 1259 | Ga0157379_10039312 | |||
| 1260 | Ga0157376_10132985 | |||
| 1261 | Ga0163161_10000020 | |||
| 1262 | Ga0206356_11622843 | |||
| 1263 | Ga0213872_10033254 | |||
| 1264 | Ga0213872_10056105 | |||
| 1265 | Ga0213874_10005997 | |||
| 1266 | Ga0213875_10000228 | |||
| 1267 | Ga0213871_10003950 | |||
| 1268 | Ga0213871_10006546 | |||
| 1269 | Ga0207672_1000860 | |||
| 1270 | Ga0209674_101931 | |||
| 1271 | Ga0209563_100019 | |||
| 1272 | Ga0207427_100640 | |||
| 1273 | Ga0209437_105888 | |||
| 1274 | Ga0209148_1000017 | |||
| 1275 | Ga0209148_1000061 | |||
| 1276 | Ga0209233_1000006 | |||
| 1277 | Ga0209233_1000107 | |||
| 1278 | Ga0209233_1000382 | |||
| 1279 | Ga0209455_1000005 | |||
| 1280 | Ga0209455_1011665 | |||
| 1281 | Ga0209758_1000035 | |||
| 1282 | Ga0207656_10008826 | |||
| 1283 | Ga0207682_10040825 | |||
| 1284 | Ga0207642_10013804 | |||
| 1285 | Ga0207680_10000011 | |||
| 1286 | Ga0207680_10031022 | |||
| 1287 | Ga0207647_10000527 | |||
| 1288 | Ga0207647_10001094 | |||
| 1289 | Ga0207647_10004311 | |||
| 1290 | Ga0207647_10046770 | |||
| 1291 | Ga0207685_10006206 | |||
| 1292 | Ga0207699_10000660 | |||
| 1293 | Ga0207699_10006424 | |||
| 1294 | Ga0207699_10016427 | |||
| 1295 | Ga0207699_10077254 | |||
| 1296 | Ga0207643_10029831 | |||
| 1297 | Ga0207643_10052068 | |||
| 1298 | Ga0207705_10001001 | |||
| 1299 | Ga0207705_10001461 | |||
| 1300 | Ga0207705_10007867 | |||
| 1301 | Ga0207705_10083646 | |||
| 1302 | Ga0207684_10014178 | |||
| 1303 | Ga0207654_10002077 | |||
| 1304 | Ga0207654_10018498 | |||
| 1305 | Ga0207654_10043009 | |||
| 1306 | Ga0207707_10000489 | |||
| 1307 | Ga0207707_10005090 | |||
| 1308 | Ga0207707_10013886 | |||
| 1309 | Ga0207707_10017985 | |||
| 1310 | Ga0207707_10046484 | |||
| 1311 | Ga0207707_10091488 | |||
| 1312 | Ga0207695_10001560 | |||
| 1313 | Ga0207695_10002853 | |||
| 1314 | Ga0207695_10005233 | |||
| 1315 | Ga0207695_10024058 | |||
| 1316 | Ga0207695_10036449 | |||
| 1317 | Ga0207695_10047816 | |||
| 1318 | Ga0207695_10053266 | |||
| 1319 | Ga0207695_10130979 | |||
| 1320 | Ga0207695_10218075 | |||
| 1321 | Ga0207695_10249326 | |||
| 1322 | Ga0207671_10000545 | |||
| 1323 | Ga0207671_10001056 | |||
| 1324 | Ga0207693_10000048 | |||
| 1325 | Ga0207693_10000560 | |||
| 1326 | Ga0207693_10001691 | |||
| 1327 | Ga0207693_10015924 | |||
| 1328 | Ga0207693_10017466 | |||
| 1329 | Ga0207663_10007856 | |||
| 1330 | Ga0207663_10010584 | |||
| 1331 | Ga0207663_10069844 | |||
| 1332 | Ga0207660_10083282 | |||
| 1333 | Ga0207662_10035528 | |||
| 1334 | Ga0207657_10000273 | |||
| 1335 | Ga0207657_10004635 | |||
| 1336 | Ga0207657_10006527 | |||
| 1337 | Ga0207657_10015118 | |||
| 1338 | Ga0207657_10020578 | |||
| 1339 | Ga0207649_10000110 | |||
| 1340 | Ga0207649_10000114 | |||
| 1341 | Ga0207649_10000145 | |||
| 1342 | Ga0207652_10000684 | |||
| 1343 | Ga0207652_10046597 | |||
| 1344 | Ga0207652_10061117 | |||
| 1345 | Ga0207646_10057041 | |||
| 1346 | Ga0207681_10000045 | |||
| 1347 | Ga0207681_10010321 | |||
| 1348 | Ga0207694_10006559 | |||
| 1349 | Ga0207694_10014019 | |||
| 1350 | Ga0207694_10018421 | |||
| 1351 | Ga0207694_10031100 | |||
| 1352 | Ga0207694_10036445 | |||
| 1353 | Ga0207694_10037901 | |||
| 1354 | Ga0207650_10003631 | |||
| 1355 | Ga0207650_10071659 | |||
| 1356 | Ga0207659_10108997 | |||
| 1357 | Ga0207687_10003650 | |||
| 1358 | Ga0207687_10018062 | |||
| 1359 | Ga0207700_10000014 | |||
| 1360 | Ga0207664_10029137 | |||
| 1361 | Ga0207644_10000777 | |||
| 1362 | Ga0207644_10080787 | |||
| 1363 | Ga0207690_10019724 | |||
| 1364 | Ga0207690_10092240 | |||
| 1365 | Ga0207706_10015816 | |||
| 1366 | Ga0207706_10017873 | |||
| 1367 | Ga0207706_10022694 | |||
| 1368 | Ga0207706_10111941 | |||
| 1369 | Ga0207686_10007035 | |||
| 1370 | Ga0207686_10025035 | |||
| 1371 | Ga0207709_10000031 | |||
| 1372 | Ga0207709_10007200 | |||
| 1373 | Ga0207709_10013817 | |||
| 1374 | Ga0207670_10001555 | |||
| 1375 | Ga0207670_10020384 | |||
| 1376 | Ga0207669_10000365 | |||
| 1377 | Ga0207669_10008618 | |||
| 1378 | Ga0207704_10063934 | |||
| 1379 | Ga0207665_10018330 | |||
| 1380 | Ga0207711_10000635 | |||
| 1381 | Ga0207711_10012614 | |||
| 1382 | Ga0207711_10035930 | |||
| 1383 | Ga0207711_10038895 | |||
| 1384 | Ga0207711_10104798 | |||
| 1385 | Ga0207689_10032638 | |||
| 1386 | Ga0207689_10099436 | |||
| 1387 | Ga0207679_10122118 | |||
| 1388 | Ga0207679_10157488 | |||
| 1389 | Ga0207667_10003961 | |||
| 1390 | Ga0207667_10005502 | |||
| 1391 | Ga0207667_10027048 | |||
| 1392 | Ga0207712_10000013 | |||
| 1393 | Ga0207712_10023320 | |||
| 1394 | Ga0207712_10072997 | |||
| 1395 | Ga0207668_10010144 | |||
| 1396 | Ga0207668_10033681 | |||
| 1397 | Ga0207668_10048576 | |||
| 1398 | Ga0207658_10008004 | |||
| 1399 | Ga0207658_10021603 | |||
| 1400 | Ga0207658_10054258 | |||
| 1401 | Ga0207677_10093069 | |||
| 1402 | Ga0207677_10167759 | |||
| 1403 | Ga0207703_10000255 | |||
| 1404 | Ga0207703_10003947 | |||
| 1405 | Ga0207703_10028124 | |||
| 1406 | Ga0207703_10054150 | |||
| 1407 | Ga0207703_10066182 | |||
| 1408 | Ga0207639_10000516 | |||
| 1409 | Ga0207639_10002060 | |||
| 1410 | Ga0207678_10003934 | |||
| 1411 | Ga0207678_10005571 | |||
| 1412 | Ga0207678_10121480 | |||
| 1413 | Ga0207678_10216873 | |||
| 1414 | Ga0207708_10057466 | |||
| 1415 | Ga0207708_10113490 | |||
| 1416 | Ga0207702_10000066 | |||
| 1417 | Ga0207702_10003870 | |||
| 1418 | Ga0207702_10010628 | |||
| 1419 | Ga0207702_10021440 | |||
| 1420 | Ga0207702_10119280 | |||
| 1421 | Ga0207702_10148270 | |||
| 1422 | Ga0207641_10000143 | |||
| 1423 | Ga0207641_10000675 | |||
| 1424 | Ga0207641_10026641 | |||
| 1425 | Ga0207641_10167906 | |||
| 1426 | Ga0207648_10038998 | |||
| 1427 | Ga0207648_10149402 | |||
| 1428 | Ga0207648_10194746 | |||
| 1429 | Ga0207676_10000214 | |||
| 1430 | Ga0207676_10007631 | |||
| 1431 | Ga0207676_10008620 | |||
| 1432 | Ga0207676_10032822 | |||
| 1433 | Ga0207674_10017008 | |||
| 1434 | Ga0207674_10027113 | |||
| 1435 | Ga0207674_10040487 | |||
| 1436 | Ga0207674_10057342 | |||
| 1437 | Ga0207674_10078266 | |||
| 1438 | Ga0207674_10206874 | |||
| 1439 | Ga0207675_100000019 | |||
| 1440 | Ga0207675_100007046 | |||
| 1441 | Ga0207675_100031913 | |||
| 1442 | Ga0207683_10001302 | |||
| 1443 | Ga0207683_10031662 | |||
| 1444 | Ga0207683_10064514 | |||
| 1445 | Ga0207698_10000449 | |||
| 1446 | Ga0207698_10042838 | |||
| 1447 | Ga0207698_10180578 | |||
| 1448 | Ga0207698_10233280 | |||
| 1449 | Ga0209179_1002970 | |||
| 1450 | Ga0209588_1005047 | |||
| 1451 | Ga0209588_1024292 | |||
| 1452 | Ga0207428_10000009 | |||
| 1453 | Ga0207428_10000199 | |||
| 1454 | Ga0207428_10006052 | |||
| 1455 | Ga0207428_10011692 | |||
| 1456 | Ga0265354_1001119 | |||
| 1457 | Ga0265356_1001861 | |||
| 1458 | Ga0268266_10000005 | |||
| 1459 | Ga0268266_10000025 | |||
| 1460 | Ga0268266_10005105 | |||
| 1461 | Ga0268266_10022606 | |||
| 1462 | Ga0268266_10086830 | |||
| 1463 | Ga0268266_10092535 | |||
| 1464 | Ga0268266_10130507 | |||
| 1465 | Ga0268265_10000546 | |||
| 1466 | Ga0268265_10068698 | |||
| 1467 | Ga0268265_10078283 | |||
| 1468 | Ga0268264_10000037 | |||
| 1469 | Ga0268264_10000040 | |||
| 1470 | Ga0265319_1005754 | |||
| 1471 | Ga0265334_10008603 | |||
| 1472 | Ga0265334_10011594 | |||
| 1473 | Ga0265334_10011837 | |||
| 1474 | Ga0265318_10002977 | |||
| 1475 | Ga0265338_10000006 | |||
| 1476 | Ga0265338_10002483 | |||
| 1477 | Ga0265338_10044259 | |||
| 1478 | Ga0265338_10058659 | |||
| 1479 | Ga0265338_10070019 | |||
| 1480 | Ga0265770_1005470 | |||
| 1481 | Ga0265760_10003762 | |||
| 1482 | Ga0265330_10003121 | |||
| 1483 | Ga0265328_10003515 | |||
| 1484 | Ga0265320_10000097 | |||
| 1485 | Ga0265325_10000003 | |||
| 1486 | Ga0265325_10000288 | |||
| 1487 | Ga0265325_10000743 | |||
| 1488 | Ga0265325_10001279 | |||
| 1489 | Ga0265325_10002615 | |||
| 1490 | Ga0265329_10002699 | |||
| 1491 | Ga0265340_10000024 | |||
| 1492 | Ga0265340_10018922 | |||
| 1493 | Ga0265339_10001397 | |||
| 1494 | Ga0265339_10005993 | |||
| 1495 | Ga0265339_10006155 | |||
| 1496 | Ga0265339_10033971 | |||
| 1497 | Ga0265331_10005229 | |||
| 1498 | Ga0265331_10009466 | |||
| 1499 | Ga0265331_10009969 | |||
| 1500 | Ga0265331_10037946 | |||
| 1501 | Ga0265331_10042384 | |||
| 1502 | Ga0265331_10046524 | |||
| 1503 | Ga0265327_10000277 | |||
| 1504 | Ga0265327_10030959 | |||
| 1505 | Ga0265316_10004163 | |||
| 1506 | Ga0265316_10009472 | |||
| 1507 | Ga0265316_10013314 | |||
| 1508 | Ga0265316_10032753 | |||
| 1509 | Ga0265316_10075730 | |||
| 1510 | Ga0307513_10012412 | |||
| 1511 | Ga0307513_10080907 | |||
| 1512 | Ga0265313_10001888 | |||
| 1513 | Ga0265313_10002246 | |||
| 1514 | Ga0265313_10002257 | |||
| 1515 | Ga0265313_10004451 | |||
| 1516 | Ga0307508_10004809 | |||
| 1517 | Ga0265314_10000127 | |||
| 1518 | Ga0265314_10001042 | |||
| 1519 | Ga0265314_10008305 | |||
| 1520 | Ga0265314_10013481 | |||
| 1521 | Ga0265342_10005393 | |||
| 1522 | Ga0265342_10007568 | |||
| 1523 | Ga0265342_10027644 | |||
| 1524 | Ga0265342_10046675 | |||
| 1525 | Ga0307516_10000131 | |||
| 1526 | Ga0307516_10052680 | |||
| 1527 | Ga0307412_10061306 | |||
| 1528 | Ga0316583_10001947 | |||
| 1529 | Ga0307510_10000018 | |||
| 1530 | Ga0307510_10099455 | |||
| 1531 | Ga0373934_0014566 | |||
| 1532 | Ga0373944_0002685 | |||
| 1533 | Ga0373944_0007486 | |||
| 1534 | Ga0373936_0049284 | |||
| 1535 | Ga0373945_0003970 | |||
| 1536 | Ga0373943_0000765 | |||
| 1537 | Ga0373946_0006882 | |||
| 1538 | Ga0373946_0007215 | |||
| 1539 | Ga0373955_0005661 | |||
| 1540 | Ga0373955_0029658 | |||
| 1541 | Ga0373931_0006910 | |||
| 1542 | Ga0373931_0007877 | |||
| 1543 | Ga0373935_0008313 | |||
| 1544 | Ga0373935_0123494 | |||
| 1545 | Ga0373927_0006832 | |||
| 1546 | Ga0373927_0016267 | |||
| 1547 | Ga0373927_0022373 | |||
| 1548 | Ga0373933_0019397 | |||
| 1549 | Ga0373947_0041128 | |||
| 1550 | Ga0373937_0000403 | |||
| 1551 | Ga0373937_0006777 | |||
| 1552 | Ga0373937_0008757 | |||
| 1553 | Ga0373937_0102928 | |||
| 1554 | Ga0373937_0128278 | |||
| 1555 | Ga0316582_0006770 | |||
| 1556 | Ga0373925_0014594 | |||
| 1557 | Ga0395899_0000026 | |||
| 1558 | Ga0395899_0000083 | |||
| 1559 | Ga0395899_0022292 | |||
| 1560 | Ga0395899_0072225 | |||
| 1561 | Ga0395899_0075040 | |||
| 1562 | Ga0395900_0000004 | |||
| 1563 | Ga0395900_0003046 | |||
| 1564 | Ga0395900_0010154 | |||
| 1565 | Ga0395900_0023413 | |||
| 1566 | Ga0395900_0128485 | |||
| 1567 | Ga0395898_0004887 | |||
| 1568 | Ga0395898_0034151 | |||
| 1569 | Ga0395898_0051126 | |||
| 1570 | Ga0395905_0019066 | |||
| 1571 | Ga0395905_0064055 | |||
| 1572 | Ga0395905_0213067 | |||
| 1573 | Ga0436364_1065372 | |||
| 1574 | Ga0436364_1306621 | |||
| 1575 | Ga0395901_0000005 | |||
| 1576 | Ga0395901_0015348 | |||
| 1577 | Ga0395901_0057745 | |||
| 1578 | Ga0436365_0244982 | |||
| 1579 | Ga0436365_0701004 | |||
| 1580 | Ga0436365_1213514 | |||
| 1581 | Ga0436365_1437123 | |||
| 1582 | Ga0436365_1935932 | |||
| 1583 | Ga0436360_0261193 | |||
| 1584 | Ga0436360_0734790 | |||
| 1585 | Ga0436360_1175238 | |||
| 1586 | Ga0436360_1338455 | |||
| 1587 | Ga0436360_1357105 | |||
| 1588 | Ga0436361_0229100 | |||
| 1589 | Ga0436361_0748837 | |||
| 1590 | Ga0436363_0002125 | |||
| 1591 | Ga0436363_0900450 | |||
| 1592 | Ga0436363_1198730 | |||
| 1593 | Ga0436362_0727973 | |||
| 1594 | Ga0451837_0189484 | |||
| 1595 | Ga0439458_0000258 | |||
| 1596 | Ga0439458_0001938 | |||
| 1597 | Ga0451577_0016304 | |||
| 1598 | Ga0466969_0051939 | |||
| 1599 | Ga0453684_0024242 | |||
| 1600 | Ga0466968_0036450 | |||
| 1601 | Ga0466959_0022270 | |||
| 1602 | Ga0451576_0029838 | |||
| 1603 | Ga0466967_0080454 | |||
| 1604 | Ga0495592_0001006 | |||
| 1605 | Ga0495603_0001429 | |||
| 1606 | Ga0495603_0014354 | |||
| 1607 | Ga0495590_0034778 | |||
| 1608 | Ga0495629_0002180 | |||
| 1609 | Ga0495638_0000332 | |||
| 1610 | Ga0495651_0000185 | |||
| 1611 | Ga0495651_0069203 | |||
| 1612 | Ga0495653_0000831 | |||
| 1613 | Ga0495653_0005900 | |||
| 1614 | Ga0495580_0001325 | |||
| 1615 | Ga0495580_0002566 | |||
| 1616 | Ga0495580_0002924 | |||
| 1617 | Ga0495582_0000901 | |||
| 1618 | Ga0495662_0001229 | |||
| 1619 | Ga0495664_0000375 | |||
| 1620 | Ga0495584_0043759 | |||
| 1621 | Ga0495594_0000585 | |||
| 1622 | Ga0495583_0000030 | |||
| 1623 | Ga0495583_0013465 | |||
| 1624 | Ga0495608_0000598 | |||
| 1625 | Ga0495616_0064221 | |||
| 1626 | Ga0495618_0000619 | |||
| 1627 | Ga0495637_0061012 | |||
| 1628 | Ga0495643_0000991 | |||
| 1629 | Ga0495648_0000750 | |||
| 1630 | Ga0495663_0002995 | |||
| 1631 | Ga0495666_0032543 | |||
| 1632 | Ga0495666_0047429 | |||
| 1633 | Ga0495652_0001337 | |||
| 1634 | Ga0495665_0052331 | |||
| 1635 | Ga0495640_0007724 | |||
| 1636 | Ga0495640_0016879 | |||
| 1637 | Ga0495586_0005186 | |||
| 1638 | Ga0495645_0013392 | |||
| 1639 | Ga0495633_0001042 | |||
| 1640 | Ga0495667_0002126 | |||
| 1641 | Ga0495667_0197559 | |||
| 1642 | Ga0495668_0000007 | |||
| 1643 | Ga0495634_0001639 | |||
| 1644 | Ga0495634_0006401 | |||
| 1645 | Ga0495625_0000264 | |||
| 1646 | Ga0495625_0017790 | |||
| 1647 | Ga0495635_0000952 | |||
| 1648 | Ga0495635_0087499 | |||
| 1649 | Ga0495623_0025306 | |||
| 1650 | Ga0495647_0000615 | |||
| 1651 | Ga0495647_0011876 | |||
| 1652 | Ga0495647_0034798 | |||
| 1653 | Ga0495658_0001383 | |||
| 1654 | Ga0495669_0000197 | |||
| 1655 | Ga0495613_0010038 | |||
| 1656 | Ga0495613_0118510 | |||
| 1657 | Ga0495624_0021857 | |||
| 1658 | Ga0495600_0000663 | |||
| 1659 | Ga0495660_0096138 | |||
| 1660 | Ga0495581_0005956 | |||
| 1661 | Ga0495604_0000478 | |||
| 1662 | Ga0495674_0001761 | |||
| 1663 | Ga0495674_0013013 | |||
| 1664 | Ga0495676_0027380 | |||
| 1665 | Ga0495680_0000640 | |||
| 1666 | Ga0495687_000178 | |||
| 1667 | Ga0495687_000511 | |||
| 1668 | Ga0495673_0018100 | |||
| 1669 | Ga0495681_0005817 | |||
| 1670 | Ga0495684_0017312 | |||
| 1671 | Ga0495684_0093828 | |||
| 1672 | Ga0495686_0000063 | |||
| 1673 | Ga0495686_0000202 | |||
| 1674 | Ga0495686_0000314 | |||
| 1675 | Ga0495686_0002137 | |||
| 1676 | Ga0495686_0002426 | |||
| 1677 | Ga0495686_0004291 | |||
| 1678 | Ga0495593_0000868 | |||
| 1679 | Ga0495593_0003121 | |||
| 1680 | Ga0495602_0007281 | |||
| 1681 | Ga0495614_0011927 | |||
| 1682 | Ga0496101_0017440 | |||
| 1683 | Ga0496101_0052742 | |||
| 1684 | Ga0496102_0000049 | |||
| 1685 | Ga0496102_0039292 | |||
| 1686 | Ga0496103_0000037 | |||
| 1687 | Ga0496103_0000647 | |||
| 1688 | Ga0496103_0001988 | |||
| 1689 | Ga0496103_0002748 | |||
| 1690 | Ga0496103_0029649 | |||
| 1691 | Ga0496103_0056896 | |||
| 1692 | Ga0496104_0000564 | |||
| 1693 | Ga0496104_0002243 | |||
| 1694 | Ga0496104_0013359 | |||
| 1695 | Ga0496104_0013871 | |||
| 1696 | Ga0496104_0016404 | |||
| 1697 | Ga0496104_0032096 | |||
| 1698 | Ga0496104_0081544 | |||
| 1699 | Ga0496104_0134226 | |||
| 1700 | Ga0496104_0140123 | |||
| 1701 | Ga0496105_0000342 | |||
| 1702 | Ga0496105_0000715 | |||
| 1703 | Ga0496105_0006258 | |||
| 1704 | Ga0496105_0006737 | |||
| 1705 | Ga0496105_0036602 | |||
| 1706 | Ga0496106_0012103 | |||
| 1707 | Ga0496106_0029366 | |||
| 1708 | Ga0496106_0034060 | |||
| 1709 | Ga0496106_0040178 | |||
| 1710 | Ga0496107_0001624 | |||
| 1711 | Ga0496107_0007276 | |||
| 1712 | Ga0496107_0095295 | |||
| 1713 | Ga0496108_0001959 | |||
| 1714 | Ga0496108_0020753 | |||
| 1715 | Ga0496109_0000673 | |||
| 1716 | Ga0496109_0038257 | |||
| 1717 | Ga0496109_0041071 | |||
| 1718 | Ga0496110_0003774 | |||
| 1719 | Ga0496110_0060818 | |||
| 1720 | Ga0496111_0000369 | |||
| 1721 | Ga0496111_0067133 | |||
| 1722 | Ga0496112_0000606 | |||
| 1723 | Ga0496112_0017906 | |||
| 1724 | Ga0496112_0215811 | |||
| 1725 | Ga0496113_0001322 | |||
| 1726 | Ga0496113_0067158 | |||
| 1727 | Ga0496113_0084950 | |||
| 1728 | Ga0496114_0000708 | |||
| 1729 | Ga0496114_0058220 | |||
| 1730 | Ga0496115_0000416 | |||
| 1731 | Ga0496115_0001862 | |||
| 1732 | Ga0496115_0007532 | |||
| 1733 | Ga0496115_0050728 | |||
| 1734 | Ga0496115_0174840 | |||
| 1735 | Ga0496116_0003410 | |||
| 1736 | Ga0496116_0023524 | |||
| 1737 | Ga0496117_0000115 | |||
| 1738 | Ga0496117_0000249 | |||
| 1739 | Ga0496117_0001241 | |||
| 1740 | Ga0496117_0030507 | |||
| 1741 | Ga0496118_0000086 | |||
| 1742 | Ga0496118_0000580 | |||
| 1743 | Ga0496118_0000802 | |||
| 1744 | Ga0496118_0011692 | |||
| 1745 | Ga0496118_0017141 | |||
| 1746 | Ga0496119_0001855 | |||
| 1747 | Ga0496120_0000014 | |||
| 1748 | Ga0496120_0010570 | |||
| 1749 | Ga0496120_0014577 | |||
| 1750 | Ga0496121_0000087 | |||
| 1751 | Ga0496121_0000387 | |||
| 1752 | Ga0496121_0000529 | |||
| 1753 | Ga0496121_0000931 | |||
| 1754 | Ga0496121_0001436 | |||
| 1755 | Ga0496121_0003691 | |||
| 1756 | Ga0496121_0028861 | |||
| 1757 | Ga0496122_0009815 | |||
| 1758 | Ga0496122_0011384 | |||
| 1759 | Ga0496123_0000569 | |||
| 1760 | Ga0496123_0001083 | |||
| 1761 | Ga0496124_0000102 | |||
| 1762 | Ga0496124_0000626 | |||
| 1763 | Ga0496125_0001330 | |||
| 1764 | Ga0496125_0005669 | |||
| 1765 | Ga0496125_0157362 | |||
| 1766 | Ga0496126_0000752 | |||
| 1767 | Ga0496126_0001751 | |||
| 1768 | Ga0496126_0028093 | |||
| 1769 | Ga0496126_0066390 | |||
| 1770 | Ga0501032_0117607 | |||
| 1771 | Ga0501033_0017457 | |||
| 1772 | Ga0501033_0025268 | |||
| 1773 | Ga0501033_0042213 | |||
| 1774 | Ga0501034_0000008 | |||
| 1775 | Ga0501034_0029849 | |||
| 1776 | Ga0501036_0002203 | |||
| 1777 | Ga0501038_0018620 | |||
| 1778 | Ga0501039_0000061 | |||
| 1779 | Ga0501039_0049088 | |||
| 1780 | Ga0501040_0001802 | |||
| 1781 | Ga0501040_0134042 | |||
| 1782 | Ga0501042_0010042 | |||
| 1783 | Ga0501046_0009690 | |||
| 1784 | Ga0501046_0011140 | |||
| 1785 | Ga0501047_0000095 | |||
| 1786 | Ga0501047_0004823 | |||
| 1787 | Ga0501047_0008015 | |||
| 1788 | Ga0501047_0069987 | |||
| 1789 | Ga0501048_0026713 | |||
| 1790 | Ga0501048_0112611 | |||
| 1791 | Ga0501067_0003439 | |||
| 1792 | Ga0501067_0036505 | |||
| 1793 | Ga0501072_0000883 | |||
| 1794 | Ga0501072_0005783 | |||
| 1795 | Ga0501073_0013480 | |||
| 1796 | Ga0501075_0000015 | |||
| 1797 | Ga0501076_0000009 | |||
| 1798 | Ga0501077_0018297 | |||
| 1799 | Ga0501080_0000013 | |||
| 1800 | Ga0501081_0002218 | |||
| 1801 | Ga0501035_0000013 | |||
| 1802 | Ga0501044_0000004 | |||
| 1803 | Ga0501044_0044050 | |||
| 1804 | Ga0501044_0076940 | |||
| 1805 | Ga0501044_0143805 | |||
| 1806 | Ga0501045_0136393 | |||
| 1807 | nmdc:mga03683_23_c1 | |||
| 1808 | nmdc:mga03n38_1015_c1 | |||
| 1809 | nmdc:mga00v17_26511_c1 | |||
| 1810 | nmdc:mga00v17_89719_c1 | |||
| 1811 | nmdc:mga0yw44_14861_c1 | |||
| 1812 | nmdc:mga0k408_111780_c1 | |||
| 1813 | nmdc:mga0k408_19_c1 | |||
| 1814 | nmdc:mga07m45_31_c1 | |||
| 1815 | nmdc:mga05p37_10245_c1 | |||
| 1816 | nmdc:mga05p37_129232_c1 | |||
| 1817 | nmdc:mga05p37_172988_c1 | |||
| 1818 | nmdc:mga05p37_18115_c1 | |||
| 1819 | nmdc:mga05p37_2006_c1 | |||
| 1820 | nmdc:mga05p37_245_c1 | |||
| 1821 | nmdc:mga05p37_52807_c1 | |||
| 1822 | nmdc:mga09592_2823_c1 | |||
| 1823 | nmdc:mga09592_30121_c1 | |||
| 1824 | nmdc:mga09592_6212_c1 | |||
| 1825 | nmdc:mga09592_7451_c1 | |||
| 1826 | nmdc:mga0qj67_16758_c1 | |||
| 1827 | nmdc:mga0qj67_232_c1 | |||
| 1828 | nmdc:mga0qj67_69021_c1 | |||
| 1829 | nmdc:mga06r32_33494_c1 | |||
| 1830 | nmdc:mga06r32_36726_c1 | |||
| 1831 | nmdc:mga06r32_45268_c1 | |||
| 1832 | nmdc:mga08y16_15960_c1 | |||
| 1833 | nmdc:mga08y16_29430_c1 | |||
| 1834 | nmdc:mga08y16_42093_c1 | |||
| 1835 | nmdc:mga08y16_468_c1 | |||
| 1836 | nmdc:mga0n895_105232_c1 | |||
| 1837 | nmdc:mga0n895_24439_c1 | |||
| 1838 | nmdc:mga0n895_6448_c1 | |||
| 1839 | nmdc:mga0rr50_151071_c1 | |||
| 1840 | nmdc:mga0rr50_44562_c1 | |||
| 1841 | nmdc:mga0rr50_5665_c1 | |||
| 1842 | nmdc:mga08x19_52_c1 | |||
| 1843 | nmdc:mga0a205_140973_c1 | |||
| 1844 | nmdc:mga0a205_159590_c1 | |||
| 1845 | nmdc:mga0a205_169483_c1 | |||
| 1846 | nmdc:mga0a205_194389_c1 | |||
| 1847 | nmdc:mga0a205_41228_c1 | |||
| 1848 | nmdc:mga0a205_7680_c1 | |||
| 1849 | nmdc:mga0a205_95522_c1 | |||
| 1850 | nmdc:mga0sz30_481_c3 | |||
| 1851 | Ga0495601_0000751 | |||
| 1852 | Ga0495601_0030784 | |||
| 1853 | Ga0495612_0000428 | |||
| 1854 | Ga0495612_0016650 | |||
| 1855 | Ga0500610_0014586 | |||
| 1856 | Ga0495655_0000422 | |||
| 1857 | Ga0495595_0000142 | |||
| 1858 | Ga0495619_0000533 | |||
| 1859 | Ga0495619_0003380 | |||
| 1860 | Ga0495619_0029419 | |||
| 1861 | Ga0495619_0042885 | |||
| 1862 | Ga0500643_001558 | |||
| 1863 | Ga0500651_0007408 | |||
| 1864 | Ga0500556_0000143 | |||
| 1865 | Ga0500592_000884 | |||
| 1866 | Ga0500618_000909 | |||
| 1867 | Ga0500573_0000028 | |||
| 1868 | Ga0500622_0001426 | |||
| 1869 | Ga0500624_000020 | |||
| 1870 | Ga0500645_000011 | |||
| 1871 | Ga0501084_0003161 | |||
| 1872 | Ga0587084_004998 | |||
| 1873 | Ga0501082_0002818 | |||
| 1874 | Ga0501082_0026409 | |||
| 1875 | Ga0530510_0000035 | |||
| 1876 | Ga0530510_0103281 | |||
| 1877 | 2585262516 | |||
| 1878 | 2600200913 | |||
| 1879 | 2753765237 | |||
| 1880 | 8057102985 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fd2-assembly1.cif.gz_B | radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine | 0.7835 | 1 | 447 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.7768 | 195 | 448 |
| 2qgq-assembly4.cif.gz_D | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.7728 | 194 | 448 |
| 6fd2-assembly1.cif.gz_B | radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine | 0.7611 | 1 | 447 |
| 5ul2-assembly1.cif.gz_A | structure of apo, semet-labeled cobalamin-dependent s-adenosylmethionine radical enzyme oxsb | 0.7609 | 1 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96395_5_123_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.8356 | 64 | 146 | 3.40.50.280 |
| af_F1LV76_14_128_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8354 | 308 | 441 | 3.30.750.200 |
| af_A0A0R0IRV7_127_250_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8343 | 307 | 435 | 3.30.750.200 |
| 4jc0B03 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8308 | 309 | 440 | 3.30.750.200 |
| af_Q2FZ02_212_444_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.814 | 197 | 440 | 3.80.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F8XP96-F1-model_v4 | deleted | 0.9611 | 47 | 477 |
|
| AF-F8XP96-F1-model_v4 | deleted | 0.9567 | 47 | 477 |
|
| AF-A0A1Z4TG91-F1-model_v4 | deleted | 0.9556 | 2 | 480 |
|
| AF-A0A4Q0T0U1-F1-model_v4 | Fe-S oxidoreductase | 0.9555 | 45 | 480 |
GO:0003824
GO:0005829 GO:0051539 |
| AF-A0LMZ8-F1-model_v4 | Radical SAM domain protein | 0.9554 | 1 | 480 |
GO:0003824
GO:0005829 GO:0031419 GO:0046872 GO:0051539 |