F486322

General Info

Members Datasets Scaffolds Average Seq Length
940 409 1880 254

Family's Representative Sequence

Representative Sequence 3300053117|Ga0500593_029496|Ga0500593_029496_813_1625
Length 270
Sequence MSEAMSDTMAAPTASNTAVPALEVRGVNKNFGALQVARDVNLTLERGARRALIGPNGAGKTSLVNLITGVLKPSSGQVLLGGEDITSWSSAHRARRGLARTFQINQLFRGLSVLENVCLAIGERRGESYNLWRPAGSKAAVIDEALDHLNSLRLVDDALKLVSELPYGRQRLVEIAIALAQKPKVLLLDEPAAGVPSHESHVILDVVASLDPDIAILIIEHDMDVVFRFAQSITVLVAGAVLTEGSPQQILADERVRAVYLGQEADRGHG

Samples

Sample ID Description Type Environment
1 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
394 2841760612 Bosea sp. Tri-49 Isolate Nodule
395 2844104063 Bosea sp. Tri-39 Isolate Nodule
396 2851246043 Bosea sp. Tri-54 Isolate Nodule
397 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
398 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
399 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
400 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
401 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
402 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
403 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
404 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
405 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
406 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
407 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
408 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
409 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.43
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 1.7
Rhizoplane 6.17
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500593_029496 3300053117 Bacteria 2451
2 ARcpr5oldR_c000028 3300000041 Bacteria 29588
3 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
4 JGI24737J22298_10000458 3300001990 Bacteria 14018
5 JGI24737J22298_10003428 3300001990 Bacteria 5606
6 Ga0065704_10104383 3300005289 Bacteria 2142
7 Ga0065712_10072517 3300005290 Bacteria 4722
8 Ga0065712_10087111 3300005290 Bacteria 2597
9 Ga0065715_10001564 3300005293 Bacteria 10196
10 Ga0070658_10011642 3300005327 Bacteria 7056
11 Ga0070658_10033788 3300005327 Bacteria 4115
12 Ga0070690_100147733 3300005330 Bacteria 1601
13 Ga0070690_100291039 3300005330 Bacteria 1168
14 Ga0070690_100293859 3300005330 Bacteria 1163
15 Ga0070670_100000437 3300005331 Bacteria 34047
16 Ga0070670_100107537 3300005331 Bacteria 2403
17 Ga0070666_10006881 3300005335 Bacteria 7005
18 Ga0070666_10075867 3300005335 Bacteria 2293
19 Ga0070680_100010932 3300005336 Bacteria 7015
20 Ga0070680_100023460 3300005336 Bacteria 4920
21 Ga0070680_100032247 3300005336 Bacteria 4216
22 Ga0070680_100126715 3300005336 Bacteria 2134
23 Ga0070680_100347009 3300005336 Bacteria 1262
24 Ga0070682_100013961 3300005337 Bacteria 4634
25 Ga0070682_100079462 3300005337 Bacteria 2118
26 Ga0068868_100120853 3300005338 Bacteria 2136
27 Ga0068868_100423853 3300005338 Bacteria 1152
28 Ga0070660_100008614 3300005339 Bacteria 7139
29 Ga0070660_100277606 3300005339 Bacteria 1371
30 Ga0070689_100051873 3300005340 Bacteria 3171
31 Ga0070689_100122333 3300005340 Bacteria 2079
32 Ga0070691_10152228 3300005341 Bacteria 1187
33 Ga0070687_100180124 3300005343 Bacteria 1265
34 Ga0070692_10000008 3300005345 Bacteria 47438
35 Ga0070692_10027989 3300005345 Bacteria 2798
36 Ga0070669_100058695 3300005353 Bacteria 2824
37 Ga0070675_100016085 3300005354 Bacteria 5930
38 Ga0070675_100096738 3300005354 Bacteria 2481
39 Ga0070671_100033139 3300005355 Bacteria 4271
40 Ga0070671_100100134 3300005355 Bacteria 2431
41 Ga0070671_100496951 3300005355 Bacteria 1049
42 Ga0070671_100616961 3300005355 Bacteria 938
43 Ga0070674_100000456 3300005356 Bacteria 20586
44 Ga0070674_100179631 3300005356 Bacteria 1620
45 Ga0070673_100037972 3300005364 Bacteria 3674
46 Ga0070673_100328753 3300005364 Bacteria 1352
47 Ga0070688_100008112 3300005365 Bacteria 5690
48 Ga0070688_100035477 3300005365 Bacteria 3030
49 Ga0070688_100407982 3300005365 Bacteria 1007
50 Ga0070659_100009561 3300005366 Bacteria 7124
51 Ga0070659_100120197 3300005366 Bacteria 2127
52 Ga0070659_100205586 3300005366 Bacteria 1622
53 Ga0070667_100041051 3300005367 Bacteria 3882
54 Ga0070667_100067811 3300005367 Bacteria 3035
55 Ga0070667_100565571 3300005367 Bacteria 1046
56 Ga0070703_10003001 3300005406 Bacteria 4821
57 Ga0070703_10050284 3300005406 Bacteria 1330
58 Ga0070709_10008980 3300005434 Bacteria 5505
59 Ga0070709_10036382 3300005434 Bacteria 2999
60 Ga0070709_10037312 3300005434 Bacteria 2967
61 Ga0070709_10045792 3300005434 Bacteria 2717
62 Ga0070709_10121863 3300005434 Bacteria 1769
63 Ga0070709_10463575 3300005434 Bacteria 956
64 Ga0070714_100035035 3300005435 Bacteria 4205
65 Ga0070714_100057751 3300005435 Bacteria 3322
66 Ga0070714_100137227 3300005435 Bacteria 2192
67 Ga0070713_100020676 3300005436 Bacteria 5050
68 Ga0070713_100258275 3300005436 Bacteria 1591
69 Ga0070710_10053671 3300005437 Bacteria 2271
70 Ga0070701_10217497 3300005438 Bacteria 1138
71 Ga0070711_100043656 3300005439 Bacteria 3038
72 Ga0070711_100102762 3300005439 Bacteria 2082
73 Ga0070711_100163490 3300005439 Bacteria 1690
74 Ga0070711_100214283 3300005439 Bacteria 1493
75 Ga0070705_100048399 3300005440 Bacteria 2463
76 Ga0070705_100158202 3300005440 Bacteria 1511
77 Ga0070705_100165663 3300005440 Bacteria 1482
78 Ga0070705_100174827 3300005440 Bacteria 1449
79 Ga0070700_100005017 3300005441 Bacteria 6979
80 Ga0070694_100011811 3300005444 Bacteria 5415
81 Ga0070694_100060362 3300005444 Bacteria 2585
82 Ga0070694_100069947 3300005444 Bacteria 2415
83 Ga0070708_100025847 3300005445 Bacteria 5021
84 Ga0070663_100036543 3300005455 Bacteria 3413
85 Ga0070678_100061496 3300005456 Bacteria 2768
86 Ga0070662_100009709 3300005457 Bacteria 6298
87 Ga0070662_100121499 3300005457 Bacteria 2003
88 Ga0070681_10087410 3300005458 Bacteria 3070
89 Ga0070681_10214217 3300005458 Bacteria 1842
90 Ga0070681_10440376 3300005458 Bacteria 1215
91 Ga0070681_10639002 3300005458 Bacteria 979
92 Ga0068867_100059792 3300005459 Bacteria 2825
93 Ga0070685_10009054 3300005466 Bacteria 5136
94 Ga0070685_10066335 3300005466 Bacteria 2126
95 Ga0070707_100069965 3300005468 Bacteria 3380
96 Ga0070707_100251491 3300005468 Bacteria 1720
97 Ga0070707_100524883 3300005468 Bacteria 1146
98 Ga0070698_100929307 3300005471 Bacteria 816
99 Ga0070679_100052860 3300005530 Bacteria 4044
100 Ga0070679_100174006 3300005530 Bacteria 2125
101 Ga0070679_100254195 3300005530 Bacteria 1713
102 Ga0070679_100254589 3300005530 Bacteria 1711
103 Ga0070684_100322239 3300005535 Bacteria 1420
104 Ga0068853_100023115 3300005539 Bacteria 5203
105 Ga0070672_100233162 3300005543 Bacteria 1547
106 Ga0070672_100268521 3300005543 Bacteria 1440
107 Ga0070686_100022223 3300005544 Bacteria 3775
108 Ga0070686_100203350 3300005544 Bacteria 1421
109 Ga0070695_100011865 3300005545 Bacteria 5215
110 Ga0070695_100014581 3300005545 Bacteria 4738
111 Ga0070695_100026690 3300005545 Bacteria 3575
112 Ga0070695_100375927 3300005545 Bacteria 1071
113 Ga0070695_100451580 3300005545 Bacteria 985
114 Ga0070696_100024640 3300005546 Bacteria 4090
115 Ga0070696_100091787 3300005546 Bacteria 2163
116 Ga0070696_100115984 3300005546 Bacteria 1933
117 Ga0070693_100011715 3300005547 Bacteria 4421
118 Ga0070693_100047229 3300005547 Bacteria 2449
119 Ga0070704_100003857 3300005549 Bacteria 8632
120 Ga0070704_100030432 3300005549 Bacteria 3617
121 Ga0070704_100140760 3300005549 Bacteria 1883
122 Ga0070704_100744635 3300005549 Bacteria 872
123 Ga0068855_100067277 3300005563 Bacteria 4174
124 Ga0068855_100093341 3300005563 Bacteria 3470
125 Ga0068855_100132246 3300005563 Bacteria 2848
126 Ga0068855_100200073 3300005563 Bacteria 2249
127 Ga0070664_100058305 3300005564 Bacteria 3284
128 Ga0070664_100359893 3300005564 Bacteria 1325
129 Ga0068857_100259640 3300005577 Bacteria 1594
130 Ga0068857_100277508 3300005577 Bacteria 1541
131 Ga0068857_100392680 3300005577 Bacteria 1290
132 Ga0068854_100080568 3300005578 Bacteria 2403
133 Ga0068856_100041527 3300005614 Bacteria 4521
134 Ga0068856_100137973 3300005614 Bacteria 2445
135 Ga0068856_100262757 3300005614 Bacteria 1742
136 Ga0068856_100373940 3300005614 Bacteria 1444
137 Ga0070702_100071323 3300005615 Bacteria 2053
138 Ga0068852_100042613 3300005616 Bacteria 3843
139 Ga0068852_100282026 3300005616 Bacteria 1602
140 Ga0068852_100398951 3300005616 Bacteria 1353
141 Ga0068859_100036332 3300005617 Bacteria 4946
142 Ga0068859_100115780 3300005617 Bacteria 2745
143 Ga0068859_100150189 3300005617 Bacteria 2405
144 Ga0068864_100079171 3300005618 Bacteria 2877
145 Ga0068864_100181923 3300005618 Bacteria 1922
146 Ga0068866_10070764 3300005718 Bacteria 1843
147 Ga0068861_100098948 3300005719 Bacteria 2316
148 Ga0068863_100111336 3300005841 Bacteria 2608
149 Ga0068863_100295529 3300005841 Bacteria 1570
150 Ga0068863_100471954 3300005841 Bacteria 1233
151 Ga0068858_100000512 3300005842 Bacteria 40596
152 Ga0068858_100065166 3300005842 Bacteria 3371
153 Ga0068858_100113862 3300005842 Bacteria 2526
154 Ga0068858_100157576 3300005842 Bacteria 2137
155 Ga0068858_100276198 3300005842 Bacteria 1599
156 Ga0068860_100040149 3300005843 Bacteria 4474
157 Ga0068860_100181065 3300005843 Bacteria 2036
158 Ga0068862_100000557 3300005844 Bacteria 38898
159 Ga0068862_100021018 3300005844 Bacteria 5453
160 Ga0068862_100552056 3300005844 Bacteria 1100
161 Ga0081455_10000035 3300005937 Bacteria 136366
162 Ga0081455_10069074 3300005937 Bacteria 2939
163 Ga0070717_10003781 3300006028 Bacteria 10877
164 Ga0070717_10348501 3300006028 Bacteria 1324
165 Ga0070717_10587645 3300006028 Bacteria 1010
166 Ga0070715_10035594 3300006163 Bacteria 2049
167 Ga0070716_100046614 3300006173 Bacteria 2440
168 Ga0070716_100067257 3300006173 Bacteria 2093
169 Ga0070716_100301529 3300006173 Bacteria 1115
170 Ga0070712_100003673 3300006175 Bacteria 9460
171 Ga0070712_100057204 3300006175 Bacteria 2738
172 Ga0070712_100175892 3300006175 Bacteria 1664
173 Ga0075427_10001188 3300006194 Bacteria 3308
174 Ga0097621_100092009 3300006237 Bacteria 2539
175 Ga0068871_100159997 3300006358 Bacteria 1925
176 Ga0075428_100015574 3300006844 Bacteria 8429
177 Ga0075428_100091010 3300006844 Bacteria 3328
178 Ga0075430_100003545 3300006846 Bacteria 13067
179 Ga0075430_100007795 3300006846 Bacteria 9046
180 Ga0075430_100142740 3300006846 Bacteria 1994
181 Ga0075431_100012917 3300006847 Bacteria 8429
182 Ga0075431_100029273 3300006847 Bacteria 5667
183 Ga0075433_10004405 3300006852 Bacteria 10960
184 Ga0075433_10066986 3300006852 Bacteria 3151
185 Ga0075433_10252959 3300006852 Bacteria 1563
186 Ga0075434_100001135 3300006871 Bacteria 21932
187 Ga0075434_100045346 3300006871 Bacteria 4361
188 Ga0075434_100102139 3300006871 Bacteria 2875
189 Ga0075434_100299100 3300006871 Bacteria 1630
190 Ga0075434_100814204 3300006871 Bacteria 950
191 Ga0075429_100000008 3300006880 Bacteria 86739
192 Ga0075429_100001354 3300006880 Bacteria 20025
193 Ga0068865_100000119 3300006881 Bacteria 39895
194 Ga0068865_100117671 3300006881 Bacteria 1970
195 Ga0075436_100010766 3300006914 Bacteria 6274
196 Ga0075436_100019478 3300006914 Bacteria 4650
197 Ga0075436_100052595 3300006914 Bacteria 2812
198 Ga0097620_100036331 3300006931 Bacteria 4946
199 Ga0097620_100115777 3300006931 Bacteria 2745
200 Ga0097620_100150183 3300006931 Bacteria 2405
201 Ga0075435_100042204 3300007076 Bacteria 3649
202 Ga0075435_100045146 3300007076 Bacteria 3531
203 Ga0075435_100047158 3300007076 Bacteria 3459
204 Ga0075435_100213941 3300007076 Bacteria 1636
205 Ga0075435_100219849 3300007076 Bacteria 1613
206 Ga0075435_100267505 3300007076 Bacteria 1457
207 Ga0099795_10007316 3300007788 Bacteria 3073
208 Ga0105251_10024945 3300009011 Bacteria 3064
209 Ga0105240_10035786 3300009093 Bacteria 6394
210 Ga0111539_10001512 3300009094 Bacteria 31036
211 Ga0111539_10019347 3300009094 Bacteria 8406
212 Ga0111539_11143595 3300009094 Bacteria 904
213 Ga0105245_10128369 3300009098 Bacteria 2376
214 Ga0105245_10218347 3300009098 Bacteria 1838
215 Ga0105247_10191744 3300009101 Bacteria 1369
216 Ga0105247_10255653 3300009101 Bacteria 1199
217 Ga0114129_10056907 3300009147 Bacteria 5474
218 Ga0114129_10066967 3300009147 Bacteria 5008
219 Ga0114129_10175903 3300009147 Bacteria 2915
220 Ga0105243_10020499 3300009148 Bacteria 5012
221 Ga0105243_10146344 3300009148 Bacteria 2022
222 Ga0105242_10002839 3300009176 Bacteria 13572
223 Ga0105248_10190862 3300009177 Bacteria 2309
224 Ga0105248_10240117 3300009177 Bacteria 2039
225 Ga0105248_10372572 3300009177 Bacteria 1607
226 Ga0105248_10633902 3300009177 Bacteria 1206
227 Ga0105237_10265205 3300009545 Bacteria 1720
228 Ga0105238_10085262 3300009551 Bacteria 3147
229 Ga0105249_10000215 3300009553 Bacteria 66439
230 Ga0105249_10009891 3300009553 Bacteria 8360
231 Ga0105249_10115843 3300009553 Bacteria 2540
232 Ga0105249_10133900 3300009553 Bacteria 2369
233 Ga0105249_10688926 3300009553 Bacteria 1081
234 Ga0099796_10005784 3300010159 Bacteria 3112
235 Ga0105239_10028262 3300010375 Bacteria 6169
236 Ga0105239_10319600 3300010375 Bacteria 1750
237 Ga0105239_10414397 3300010375 Bacteria 1526
238 Ga0105239_10525955 3300010375 Bacteria 1346
239 Ga0105246_10000019 3300011119 Bacteria 62666
240 Ga0105246_10145180 3300011119 Bacteria 1789
241 Ga0105246_10225498 3300011119 Bacteria 1472
242 Ga0157370_10051700 3300013104 Bacteria 3924
243 Ga0157370_10263703 3300013104 Bacteria 1592
244 Ga0157370_10319230 3300013104 Bacteria 1433
245 Ga0157369_10004736 3300013105 Bacteria 15983
246 Ga0157374_10326771 3300013296 Unclassified 1521
247 Ga0157374_10539711 3300013296 Bacteria 1173
248 Ga0157378_10002701 3300013297 Bacteria 15807
249 Ga0157378_10240375 3300013297 Bacteria 1729
250 Ga0157378_10246363 3300013297 Bacteria 1709
251 Ga0163162_10001187 3300013306 Bacteria 24299
252 Ga0163162_10087104 3300013306 Bacteria 3201
253 Ga0163162_10306353 3300013306 Bacteria 1721
254 Ga0163162_10570722 3300013306 Bacteria 1259
255 Ga0157372_10701660 3300013307 Bacteria 1177
256 Ga0157372_10992013 3300013307 Bacteria 973
257 Ga0157375_10010957 3300013308 Bacteria 7996
258 Ga0157375_10228605 3300013308 Bacteria 2019
259 Ga0157375_10493174 3300013308 Bacteria 1389
260 Ga0157375_10499742 3300013308 Bacteria 1380
261 Ga0163163_10019264 3300014325 Bacteria 6406
262 Ga0163163_10263527 3300014325 Bacteria 1774
263 Ga0163163_10393967 3300014325 Bacteria 1443
264 Ga0157380_10000284 3300014326 Bacteria 30507
265 Ga0157380_10578608 3300014326 Bacteria 1107
266 Ga0182008_10017977 3300014497 Bacteria 3662
267 Ga0182008_10131793 3300014497 Bacteria 1246
268 Ga0157379_10208769 3300014968 Bacteria 1767
269 Ga0157379_10320881 3300014968 Bacteria 1414
270 Ga0157376_10363081 3300014969 Bacteria 1389
271 Ga0163161_10100882 3300017792 Bacteria 2149
272 Ga0163161_10274660 3300017792 Bacteria 1320
273 Ga0206354_10285912 3300020081 Bacteria 1614
274 Ga0206353_10528377 3300020082 Bacteria 2063
275 Ga0206353_11144301 3300020082 Bacteria 1886
276 Ga0213876_10033890 3300021384 Bacteria 2692
277 Ga0213875_10000165 3300021388 Bacteria 68805
278 Ga0207666_1000744 3300025271 Bacteria 3908
279 Ga0207697_10003696 3300025315 Bacteria 7483
280 Ga0207653_10001699 3300025885 Bacteria 7037
281 Ga0207692_10040821 3300025898 Bacteria 2292
282 Ga0207692_10052375 3300025898 Bacteria 2074
283 Ga0207692_10092149 3300025898 Bacteria 1646
284 Ga0207710_10004914 3300025900 Bacteria 5794
285 Ga0207688_10034764 3300025901 Bacteria 2790
286 Ga0207688_10155127 3300025901 Bacteria 1355
287 Ga0207680_10101178 3300025903 Bacteria 1852
288 Ga0207647_10043164 3300025904 Bacteria 2823
289 Ga0207685_10013800 3300025905 Bacteria 2510
290 Ga0207685_10016988 3300025905 Bacteria 2341
291 Ga0207699_10061149 3300025906 Bacteria 2265
292 Ga0207699_10068983 3300025906 Bacteria 2154
293 Ga0207699_10106676 3300025906 Bacteria 1788
294 Ga0207699_10160123 3300025906 Bacteria 1497
295 Ga0207699_10318315 3300025906 Bacteria 1090
296 Ga0207645_10053476 3300025907 Bacteria 2581
297 Ga0207705_10203974 3300025909 Bacteria 1498
298 Ga0207707_10009645 3300025912 Bacteria 8375
299 Ga0207707_10211145 3300025912 Bacteria 1691
300 Ga0207707_10256086 3300025912 Bacteria 1519
301 Ga0207693_10009873 3300025915 Bacteria 7764
302 Ga0207693_10017770 3300025915 Bacteria 5671
303 Ga0207693_10209191 3300025915 Bacteria 1533
304 Ga0207663_10043923 3300025916 Bacteria 2740
305 Ga0207663_10194238 3300025916 Bacteria 1460
306 Ga0207660_10174634 3300025917 Bacteria 1665
307 Ga0207660_10314724 3300025917 Bacteria 1249
308 Ga0207657_10010318 3300025919 Bacteria 9328
309 Ga0207657_10074179 3300025919 Bacteria 2874
310 Ga0207657_10120100 3300025919 Bacteria 2163
311 Ga0207649_10293675 3300025920 Bacteria 1186
312 Ga0207652_10026006 3300025921 Bacteria 4871
313 Ga0207652_10153018 3300025921 Bacteria 2066
314 Ga0207652_10209758 3300025921 Bacteria 1754
315 Ga0207646_10085210 3300025922 Bacteria 2827
316 Ga0207646_10446086 3300025922 Bacteria 1168
317 Ga0207681_10277169 3300025923 Bacteria 1319
318 Ga0207694_10244276 3300025924 Bacteria 1468
319 Ga0207650_10603563 3300025925 Bacteria 923
320 Ga0207659_10028682 3300025926 Bacteria 3784
321 Ga0207687_10006850 3300025927 Bacteria 7503
322 Ga0207687_10179633 3300025927 Bacteria 1639
323 Ga0207700_10004694 3300025928 Bacteria 8096
324 Ga0207700_10018933 3300025928 Bacteria 4640
325 Ga0207700_10426199 3300025928 Bacteria 1166
326 Ga0207664_10041800 3300025929 Bacteria 3573
327 Ga0207664_10098805 3300025929 Bacteria 2408
328 Ga0207664_10410093 3300025929 Bacteria 1206
329 Ga0207644_10120276 3300025931 Bacteria 1998
330 Ga0207644_10312897 3300025931 Bacteria 1268
331 Ga0207644_10432814 3300025931 Bacteria 1079
332 Ga0207690_10040362 3300025932 Bacteria 3051
333 Ga0207690_10231023 3300025932 Bacteria 1420
334 Ga0207706_10017526 3300025933 Bacteria 6456
335 Ga0207706_10088991 3300025933 Bacteria 2714
336 Ga0207686_10035002 3300025934 Bacteria 3011
337 Ga0207686_10038994 3300025934 Bacteria 2879
338 Ga0207709_10070620 3300025935 Bacteria 2215
339 Ga0207670_10112784 3300025936 Bacteria 1962
340 Ga0207669_10026526 3300025937 Bacteria 3153
341 Ga0207669_10119421 3300025937 Bacteria 1786
342 Ga0207704_10024045 3300025938 Bacteria 3295
343 Ga0207665_10000631 3300025939 Bacteria 23652
344 Ga0207665_10265993 3300025939 Bacteria 1272
345 Ga0207665_10267406 3300025939 Bacteria 1268
346 Ga0207665_10480970 3300025939 Bacteria 957
347 Ga0207691_10055482 3300025940 Bacteria 3611
348 Ga0207691_10285128 3300025940 Bacteria 1421
349 Ga0207711_10016598 3300025941 Bacteria 6115
350 Ga0207711_10054868 3300025941 Bacteria 3420
351 Ga0207711_10455513 3300025941 Bacteria 1191
352 Ga0207689_10036982 3300025942 Bacteria 4052
353 Ga0207679_10066279 3300025945 Bacteria 2705
354 Ga0207679_10126399 3300025945 Bacteria 2044
355 Ga0207667_10099491 3300025949 Bacteria 3000
356 Ga0207667_10220282 3300025949 Bacteria 1944
357 Ga0207651_10037972 3300025960 Bacteria 3160
358 Ga0207651_10691524 3300025960 Bacteria 898
359 Ga0207712_10037284 3300025961 Bacteria 3316
360 Ga0207712_10073558 3300025961 Bacteria 2465
361 Ga0207712_10126500 3300025961 Bacteria 1941
362 Ga0207712_10535035 3300025961 Bacteria 1006
363 Ga0207668_10090761 3300025972 Bacteria 2243
364 Ga0207640_10061221 3300025981 Bacteria 2492
365 Ga0207658_10015437 3300025986 Bacteria 5240
366 Ga0207658_10399165 3300025986 Bacteria 1208
367 Ga0207677_10578127 3300026023 Bacteria 983
368 Ga0207639_10092709 3300026041 Bacteria 2421
369 Ga0207678_10014489 3300026067 Bacteria 6931
370 Ga0207678_10027526 3300026067 Bacteria 4961
371 Ga0207678_10036968 3300026067 Bacteria 4250
372 Ga0207708_10002641 3300026075 Bacteria 13186
373 Ga0207708_10281192 3300026075 Bacteria 1348
374 Ga0207702_10101298 3300026078 Bacteria 2543
375 Ga0207702_10204902 3300026078 Bacteria 1831
376 Ga0207702_10281850 3300026078 Bacteria 1571
377 Ga0207641_10118183 3300026088 Bacteria 2361
378 Ga0207641_10161900 3300026088 Bacteria 2035
379 Ga0207641_10190827 3300026088 Bacteria 1883
380 Ga0207648_10038868 3300026089 Bacteria 4187
381 Ga0207648_10289894 3300026089 Bacteria 1465
382 Ga0207676_10072633 3300026095 Bacteria 2766
383 Ga0207674_10235913 3300026116 Bacteria 1777
384 Ga0207674_10266694 3300026116 Bacteria 1660
385 Ga0207674_10301720 3300026116 Bacteria 1550
386 Ga0207675_100028481 3300026118 Bacteria 5201
387 Ga0207683_10045639 3300026121 Bacteria 3832
388 Ga0207683_10054532 3300026121 Bacteria 3505
389 Ga0207683_10141858 3300026121 Bacteria 2165
390 Ga0207698_10126915 3300026142 Bacteria 2172
391 Ga0207698_10158228 3300026142 Bacteria 1977
392 Ga0209966_1001251 3300027695 Bacteria 4513
393 Ga0209966_1001450 3300027695 Bacteria 4112
394 Ga0209966_1008347 3300027695 Bacteria 1837
395 Ga0209998_10000949 3300027717 Bacteria 7357
396 Ga0209998_10009395 3300027717 Bacteria 2030
397 Ga0209974_10001910 3300027876 Bacteria 7600
398 Ga0209974_10087552 3300027876 Bacteria 1077
399 Ga0207428_10000308 3300027907 Bacteria 64810
400 Ga0207428_10000474 3300027907 Bacteria 48360
401 Ga0268266_10051110 3300028379 Bacteria 3547
402 Ga0268266_10294300 3300028379 Bacteria 1513
403 Ga0268265_10026332 3300028380 Bacteria 4137
404 Ga0268265_10612441 3300028380 Bacteria 1042
405 Ga0268264_10159321 3300028381 Bacteria 2031
406 Ga0268264_10359016 3300028381 Bacteria 1389
407 Ga0268264_10476480 3300028381 Bacteria 1213
408 Ga0265338_10002492 3300028800 Bacteria 27463
409 Ga0265338_10064148 3300028800 Bacteria 3197
410 Ga0265762_1006598 3300030760 Bacteria 2074
411 Ga0265330_10003043 3300031235 Bacteria 8895
412 Ga0265332_10001070 3300031238 Bacteria 15993
413 Ga0265325_10000352 3300031241 Bacteria 32405
414 Ga0265325_10052644 3300031241 Bacteria 2089
415 Ga0265325_10165057 3300031241 Bacteria 1039
416 Ga0265340_10006050 3300031247 Bacteria 6672
417 Ga0265340_10034466 3300031247 Bacteria 2518
418 Ga0265340_10100770 3300031247 Bacteria 1342
419 Ga0265339_10000979 3300031249 Bacteria 21883
420 Ga0265339_10005391 3300031249 Bacteria 8520
421 Ga0265339_10012730 3300031249 Bacteria 5120
422 Ga0265339_10015364 3300031249 Bacteria 4590
423 Ga0265316_10044436 3300031344 Bacteria 3534
424 Ga0265316_10084271 3300031344 Bacteria 2434
425 Ga0265313_10000686 3300031595 Bacteria 34918
426 Ga0316579_10024922 3300031691 Bacteria 2696
427 Ga0265314_10003780 3300031711 Bacteria 14466
428 Ga0265314_10005573 3300031711 Bacteria 11319
429 Ga0265342_10000031 3300031712 Bacteria 152577
430 Ga0265342_10000882 3300031712 Bacteria 29894
431 Ga0265342_10004819 3300031712 Bacteria 10468
432 Ga0316583_10000161 3300032133 Bacteria 16491
433 Ga0373930_0000020 3300034816 Bacteria 15356
434 Ga0373930_0012248 3300034816 Bacteria 1562
435 Ga0373948_0000371 3300034817 Bacteria 5533
436 Ga0373948_0012850 3300034817 Bacteria 1502
437 Ga0373950_0000266 3300034818 Bacteria 6589
438 Ga0373958_0000533 3300034819 Bacteria 4759
439 Ga0373959_0000539 3300034820 Bacteria 6764
440 Ga0373938_0000748 3300034957 Bacteria 5254
441 Ga0373926_0004368 3300035083 Bacteria 4639
442 Ga0373926_0016309 3300035083 Bacteria 2539
443 Ga0373926_0106149 3300035083 Bacteria 1053
444 Ga0373928_0004305 3300035084 Bacteria 2718
445 Ga0373929_0000042 3300035085 Bacteria 29236
446 Ga0373934_0013885 3300035086 Bacteria 3047
447 Ga0373934_0042312 3300035086 Bacteria 1799
448 Ga0373934_0054287 3300035086 Bacteria 1591
449 Ga0373940_0000325 3300035088 Bacteria 7005
450 Ga0373944_0019405 3300035089 Bacteria 1950
451 Ga0373949_0001117 3300035090 Bacteria 8122
452 Ga0373951_0000547 3300035091 Bacteria 10574
453 Ga0373952_0000713 3300035092 Bacteria 5943
454 Ga0373952_0008868 3300035092 Bacteria 1914
455 Ga0373952_0021568 3300035092 Bacteria 1361
456 Ga0373923_0002274 3300035111 Bacteria 5855
457 Ga0373923_0041700 3300035111 Bacteria 1893
458 Ga0373932_0001186 3300035112 Bacteria 7459
459 Ga0373932_0002300 3300035112 Bacteria 4857
460 Ga0373936_0001104 3300035113 Bacteria 9672
461 Ga0373936_0019802 3300035113 Bacteria 2610
462 Ga0373936_0084800 3300035113 Bacteria 1322
463 Ga0373939_0000360 3300035114 Bacteria 11493
464 Ga0373939_0011935 3300035114 Bacteria 2205
465 Ga0373941_0001805 3300035115 Bacteria 4608
466 Ga0373941_0005933 3300035115 Bacteria 2911
467 Ga0373945_0000503 3300035116 Bacteria 11108
468 Ga0373953_0000488 3300035117 Bacteria 10969
469 Ga0373953_0048465 3300035117 Bacteria 1712
470 Ga0373954_0004286 3300035118 Bacteria 6131
471 Ga0373954_0057832 3300035118 Bacteria 1826
472 Ga0373956_0014464 3300035119 Bacteria 3298
473 Ga0373956_0024246 3300035119 Bacteria 2611
474 Ga0373957_0005912 3300035120 Bacteria 3826
475 Ga0373957_0016648 3300035120 Bacteria 2548
476 Ga0373957_0052263 3300035120 Bacteria 1565
477 Ga0373957_0133632 3300035120 Bacteria 1011
478 Ga0373960_0003891 3300035121 Bacteria 3403
479 Ga0373960_0019041 3300035121 Bacteria 1798
480 Ga0373960_0036289 3300035121 Bacteria 1403
481 Ga0373943_0003705 3300035170 Bacteria 6950
482 Ga0373943_0010637 3300035170 Bacteria 4128
483 Ga0373943_0027110 3300035170 Bacteria 2689
484 Ga0373946_0001059 3300035171 Bacteria 9481
485 Ga0373946_0002277 3300035171 Bacteria 6784
486 Ga0373955_0000425 3300035172 Bacteria 17797
487 Ga0373955_0129552 3300035172 Bacteria 1472
488 Ga0373955_0139733 3300035172 Bacteria 1419
489 Ga0373942_0001477 3300035207 Bacteria 6050
490 Ga0373942_0003320 3300035207 Bacteria 3782
491 Ga0373942_0018232 3300035207 Bacteria 1740
492 Ga0373961_0003189 3300035241 Bacteria 4093
493 Ga0373962_0000354 3300035242 Bacteria 10085
494 Ga0373962_0013857 3300035242 Bacteria 2048
495 Ga0373924_0049494 3300035410 Bacteria 1739
496 Ga0373931_0030133 3300035691 Bacteria 2791
497 Ga0373931_0053231 3300035691 Bacteria 2159
498 Ga0373931_0252020 3300035691 Bacteria 1074
499 Ga0373935_0000337 3300035692 Bacteria 23756
500 Ga0373935_0003255 3300035692 Bacteria 9390
501 Ga0373935_0036252 3300035692 Bacteria 3083
502 Ga0373935_0040667 3300035692 Bacteria 2918
503 Ga0373935_0076945 3300035692 Bacteria 2161
504 Ga0373927_0011982 3300035695 Bacteria 5768
505 Ga0373927_0039586 3300035695 Bacteria 3060
506 Ga0373927_0039898 3300035695 Bacteria 3046
507 Ga0373927_0043067 3300035695 Bacteria 2924
508 Ga0373927_0071590 3300035695 Bacteria 2244
509 Ga0373933_0002475 3300035724 Bacteria 10393
510 Ga0373933_0010438 3300035724 Bacteria 5091
511 Ga0373933_0019109 3300035724 Bacteria 3864
512 Ga0373933_0024531 3300035724 Bacteria 3452
513 Ga0373933_0071924 3300035724 Bacteria 2106
514 Ga0373933_0344860 3300035724 Bacteria 967
515 Ga0373947_0001536 3300035725 Bacteria 14154
516 Ga0373947_0012712 3300035725 Bacteria 4827
517 Ga0373947_0030383 3300035725 Bacteria 3174
518 Ga0373947_0053434 3300035725 Bacteria 2436
519 Ga0373947_0494248 3300035725 Bacteria 831
520 Ga0373937_0000223 3300036401 Bacteria 54957
521 Ga0373937_0005292 3300036401 Bacteria 11025
522 Ga0373937_0011036 3300036401 Bacteria 7921
523 Ga0373937_0027077 3300036401 Bacteria 5182
524 Ga0373937_0043671 3300036401 Bacteria 4093
525 Ga0373937_0073445 3300036401 Bacteria 3155
526 Ga0373925_0000741 3300037068 Bacteria 29997
527 Ga0373925_0008940 3300037068 Bacteria 7298
528 Ga0373925_0150446 3300037068 Bacteria 1828
529 Ga0373925_0179833 3300037068 Bacteria 1673
530 Ga0373925_0351784 3300037068 Bacteria 1196
531 Ga0395899_0036755 3300037312 Bacteria 3672
532 Ga0395900_0005074 3300037418 Bacteria 13816
533 Ga0395900_0008149 3300037418 Bacteria 10783
534 Ga0395900_0424802 3300037418 Bacteria 1289
535 Ga0395898_0032574 3300037466 Bacteria 5203
536 Ga0395898_0110478 3300037466 Bacteria 2635
537 Ga0395898_0121248 3300037466 Bacteria 2505
538 Ga0436364_1070861 3300037853 Bacteria 2778
539 Ga0436364_1177974 3300037853 Bacteria 47646
540 Ga0395901_0009281 3300038443 Bacteria 9972
541 Ga0395901_0014372 3300038443 Bacteria 8058
542 Ga0436365_0380370 3300039437 Bacteria 3101
543 Ga0436365_0442321 3300039437 Bacteria 3409
544 Ga0436365_0592364 3300039437 Bacteria 2713
545 Ga0436361_0189320 3300039447 Bacteria 1174
546 Ga0436361_0944607 3300039447 Bacteria 2274
547 Ga0436363_0323907 3300039450 Bacteria 2156
548 Ga0436362_0454806 3300039453 Bacteria 1227
549 Ga0436362_1243395 3300039453 Bacteria 1501
550 Ga0439441_006313 3300042001 Bacteria 1876
551 Ga0439441_020180 3300042001 Bacteria 1219
552 Ga0439460_0014322 3300042461 Bacteria 2084
553 Ga0466966_0125083 3300044684 Bacteria 1577
554 Ga0466963_0121732 3300044694 Bacteria 1796
555 Ga0466971_0180933 3300044719 Bacteria 991
556 Ga0466957_0066173 3300044842 Bacteria 2227
557 Ga0466957_0187463 3300044842 Bacteria 1353
558 Ga0451576_0023021 3300045051 Bacteria 6751
559 Ga0451576_0056338 3300045051 Bacteria 4111
560 Ga0466958_0067366 3300045836 Bacteria 2187
561 Ga0466958_0320245 3300045836 Bacteria 996
562 Ga0466967_0022504 3300045976 Bacteria 5144
563 Ga0466967_0450012 3300045976 Bacteria 1258
564 Ga0495592_0000188 3300046454 Bacteria 54485
565 Ga0495592_0007677 3300046454 Bacteria 8074
566 Ga0495592_0060198 3300046454 Bacteria 2794
567 Ga0495592_0067404 3300046454 Bacteria 2615
568 Ga0495592_0180560 3300046454 Bacteria 1438
569 Ga0495603_0015554 3300046455 Bacteria 4605
570 Ga0495603_0091022 3300046455 Bacteria 1783
571 Ga0495591_033479 3300046458 Bacteria 1520
572 Ga0495629_0000222 3300046459 Bacteria 50600
573 Ga0495629_0002114 3300046459 Bacteria 15386
574 Ga0495629_0092397 3300046459 Bacteria 2112
575 Ga0495629_0101992 3300046459 Bacteria 2002
576 Ga0495629_0139671 3300046459 Bacteria 1686
577 Ga0495629_0158420 3300046459 Bacteria 1572
578 Ga0495641_0013226 3300046461 Bacteria 4551
579 Ga0495651_0001439 3300046462 Bacteria 18418
580 Ga0495651_0014733 3300046462 Bacteria 6046
581 Ga0495651_0101853 3300046462 Bacteria 2136
582 Ga0495651_0142149 3300046462 Bacteria 1739
583 Ga0495651_0149293 3300046462 Bacteria 1687
584 Ga0495651_0164873 3300046462 Bacteria 1584
585 Ga0495651_0248429 3300046462 Bacteria 1216
586 Ga0495653_0000198 3300046463 Bacteria 49009
587 Ga0495653_0027955 3300046463 Bacteria 4514
588 Ga0495653_0037313 3300046463 Bacteria 3819
589 Ga0495653_0140058 3300046463 Bacteria 1703
590 Ga0495580_0022328 3300046472 Bacteria 4657
591 Ga0495580_0120836 3300046472 Bacteria 1819
592 Ga0495582_0040673 3300046473 Bacteria 2560
593 Ga0495605_0151191 3300046474 Bacteria 1036
594 Ga0495639_0008708 3300046475 Bacteria 4350
595 Ga0495639_0137851 3300046475 Bacteria 1171
596 Ga0495662_0000720 3300046476 Bacteria 15794
597 Ga0495662_0009876 3300046476 Bacteria 4688
598 Ga0495662_0096654 3300046476 Bacteria 1443
599 Ga0495664_0000002 3300046477 Bacteria 625183
600 Ga0495664_0003233 3300046477 Bacteria 8850
601 Ga0495584_0077382 3300046491 Bacteria 1673
602 Ga0495585_0001425 3300046492 Bacteria 18789
603 Ga0495594_0091858 3300046499 Bacteria 1701
604 Ga0495608_0000009 3300046511 Bacteria 266614
605 Ga0495608_0002323 3300046511 Bacteria 13726
606 Ga0495608_0014885 3300046511 Bacteria 5398
607 Ga0495608_0423360 3300046511 Bacteria 812
608 Ga0495618_0000005 3300046514 Bacteria 230421
609 Ga0495618_0060945 3300046514 Bacteria 2393
610 Ga0495628_0000002 3300046516 Bacteria 589399
611 Ga0495628_0011343 3300046516 Bacteria 7543
612 Ga0495628_0014516 3300046516 Bacteria 6598
613 Ga0495628_0372241 3300046516 Bacteria 1047
614 Ga0495630_0000614 3300046517 Bacteria 25848
615 Ga0495630_0057444 3300046517 Bacteria 2916
616 Ga0495630_0065524 3300046517 Bacteria 2730
617 Ga0495630_0117096 3300046517 Bacteria 2020
618 Ga0495630_0213547 3300046517 Bacteria 1472
619 Ga0495644_0000656 3300046523 Bacteria 14496
620 Ga0495663_0011247 3300046525 Bacteria 2491
621 Ga0495666_0008769 3300046526 Bacteria 5065
622 Ga0495666_0033500 3300046526 Bacteria 2509
623 Ga0495652_0000004 3300046529 Bacteria 588877
624 Ga0495652_0020572 3300046529 Bacteria 5865
625 Ga0495652_0098442 3300046529 Bacteria 2377
626 Ga0495665_0003071 3300046531 Bacteria 9032
627 Ga0495665_0052758 3300046531 Bacteria 2152
628 Ga0495640_0000005 3300046533 Bacteria 318271
629 Ga0495640_0022097 3300046533 Bacteria 4659
630 Ga0495640_0082608 3300046533 Bacteria 2133
631 Ga0495640_0090755 3300046533 Bacteria 2016
632 Ga0495640_0317171 3300046533 Bacteria 966
633 Ga0495640_0438369 3300046533 Bacteria 799
634 Ga0495586_0016023 3300046535 Bacteria 3988
635 Ga0495586_0039975 3300046535 Bacteria 2522
636 Ga0495586_0090372 3300046535 Bacteria 1691
637 Ga0495587_0000007 3300046536 Bacteria 290788
638 Ga0495587_0006576 3300046536 Bacteria 7568
639 Ga0495609_0107194 3300046538 Bacteria 1208
640 Ga0495645_0000003 3300046543 Bacteria 570133
641 Ga0495645_0049212 3300046543 Bacteria 3070
642 Ga0495645_0070637 3300046543 Bacteria 2519
643 Ga0495622_0006136 3300046557 Bacteria 5584
644 Ga0495633_0009720 3300046558 Bacteria 5287
645 Ga0495667_0000002 3300046559 Bacteria 437535
646 Ga0495667_0002675 3300046559 Bacteria 11909
647 Ga0495667_0022163 3300046559 Bacteria 4280
648 Ga0495667_0034249 3300046559 Bacteria 3396
649 Ga0495667_0132571 3300046559 Bacteria 1607
650 Ga0495656_0000262 3300046615 Bacteria 18537
651 Ga0495634_0000129 3300046642 Bacteria 65082
652 Ga0495634_0131359 3300046642 Bacteria 1596
653 Ga0495634_0135142 3300046642 Bacteria 1569
654 Ga0495634_0190723 3300046642 Bacteria 1278
655 Ga0495634_0216474 3300046642 Bacteria 1184
656 Ga0495611_0010698 3300046648 Bacteria 3885
657 Ga0495635_0000289 3300046663 Bacteria 32189
658 Ga0495635_0002537 3300046663 Bacteria 12495
659 Ga0495635_0225378 3300046663 Bacteria 1267
660 Ga0495659_0006163 3300046664 Bacteria 3790
661 Ga0495661_0053372 3300046665 Bacteria 2431
662 Ga0495588_0009638 3300046674 Bacteria 4471
663 Ga0495588_0093201 3300046674 Bacteria 1579
664 Ga0495657_0000781 3300046675 Bacteria 28299
665 Ga0495657_0004771 3300046675 Bacteria 10810
666 Ga0495599_0000001 3300046678 Bacteria 537563
667 Ga0495599_0025159 3300046678 Bacteria 3725
668 Ga0495599_0063998 3300046678 Bacteria 2297
669 Ga0495623_0000001 3300046679 Bacteria 313861
670 Ga0495623_0001394 3300046679 Bacteria 16421
671 Ga0495623_0119546 3300046679 Bacteria 1587
672 Ga0495646_0000013 3300046680 Bacteria 159700
673 Ga0495646_0001135 3300046680 Bacteria 15537
674 Ga0495646_0005931 3300046680 Bacteria 7743
675 Ga0495647_0003047 3300046681 Bacteria 5340
676 Ga0495647_0003641 3300046681 Bacteria 4947
677 Ga0495658_0000656 3300046683 Bacteria 18755
678 Ga0495658_0013420 3300046683 Bacteria 4171
679 Ga0495658_0085832 3300046683 Bacteria 1856
680 Ga0495613_0004890 3300046689 Bacteria 10065
681 Ga0495613_0031920 3300046689 Bacteria 3912
682 Ga0495613_0044829 3300046689 Bacteria 3271
683 Ga0495613_0074197 3300046689 Bacteria 2477
684 Ga0495613_0132259 3300046689 Bacteria 1786
685 Ga0495613_0157754 3300046689 Bacteria 1616
686 Ga0495624_0015796 3300046690 Bacteria 5085
687 Ga0495624_0024272 3300046690 Bacteria 3991
688 Ga0495624_0073691 3300046690 Bacteria 2122
689 Ga0495670_0001048 3300046691 Bacteria 13379
690 Ga0495671_0045891 3300046692 Bacteria 2186
691 Ga0495600_0000233 3300046809 Bacteria 30755
692 Ga0495600_0000708 3300046809 Bacteria 17501
693 Ga0495600_0003719 3300046809 Bacteria 9018
694 Ga0495581_0006809 3300047315 Bacteria 6627
695 Ga0495581_0025414 3300047315 Bacteria 3433
696 Ga0495581_0052490 3300047315 Bacteria 2355
697 Ga0495604_0000005 3300047317 Bacteria 424516
698 Ga0495604_0017043 3300047317 Bacteria 5811
699 Ga0495604_0127058 3300047317 Bacteria 1837
700 Ga0495674_0000003 3300047319 Bacteria 562126
701 Ga0495674_0002023 3300047319 Bacteria 19947
702 Ga0495674_0007365 3300047319 Bacteria 10524
703 Ga0495674_0061512 3300047319 Bacteria 3272
704 Ga0495674_0249218 3300047319 Bacteria 1462
705 Ga0495676_0042309 3300047321 Bacteria 3741
706 Ga0495676_0224287 3300047321 Bacteria 1293
707 Ga0495680_0000002 3300047322 Bacteria 197533
708 Ga0495680_0005048 3300047322 Bacteria 12467
709 Ga0495680_0008971 3300047322 Bacteria 9036
710 Ga0495680_0009889 3300047322 Bacteria 8550
711 Ga0495680_0042831 3300047322 Bacteria 3588
712 Ga0495680_0095117 3300047322 Bacteria 2228
713 Ga0495675_0000437 3300047444 Bacteria 27820
714 Ga0495675_0003495 3300047444 Bacteria 9466
715 Ga0495675_0017856 3300047444 Bacteria 4498
716 Ga0495684_0000020 3300047471 Bacteria 148507
717 Ga0495684_0181447 3300047471 Bacteria 1560
718 Ga0495684_0295581 3300047471 Bacteria 1164
719 Ga0495593_0001400 3300047673 Bacteria 14114
720 Ga0495593_0039987 3300047673 Bacteria 2526
721 Ga0495602_0000027 3300048088 Bacteria 145010
722 Ga0495602_0092297 3300048088 Bacteria 2509
723 Ga0495602_0111968 3300048088 Bacteria 2216
724 Ga0495614_0028550 3300048089 Bacteria 2403
725 Ga0495614_0171943 3300048089 Bacteria 972
726 Ga0496100_0029850 3300048903 Unclassified 3376
727 Ga0496100_0112447 3300048903 Bacteria 1894
728 Ga0496100_0272038 3300048903 Bacteria 1260
729 Ga0496101_0036257 3300048904 Bacteria 3492
730 Ga0496101_0364461 3300048904 Bacteria 1136
731 Ga0496101_0493255 3300048904 Bacteria 967
732 Ga0496102_0005220 3300048905 Bacteria 11029
733 Ga0496102_0250040 3300048905 Bacteria 1671
734 Ga0496102_0537203 3300048905 Bacteria 1092
735 Ga0496103_0024207 3300048906 Bacteria 3663
736 Ga0496103_0297315 3300048906 Bacteria 1038
737 Ga0496104_0000116 3300048907 Bacteria 74423
738 Ga0496104_0063343 3300048907 Bacteria 3506
739 Ga0496104_0138651 3300048907 Bacteria 2337
740 Ga0496104_0154803 3300048907 Bacteria 2200
741 Ga0496104_0440187 3300048907 Bacteria 1215
742 Ga0496105_0000550 3300048908 Bacteria 24744
743 Ga0496105_0133733 3300048908 Bacteria 2043
744 Ga0496105_0134925 3300048908 Bacteria 2033
745 Ga0496105_0480073 3300048908 Bacteria 978
746 Ga0496105_0676823 3300048908 Bacteria 794
747 Ga0496106_0014148 3300048909 Bacteria 5894
748 Ga0496106_0135542 3300048909 Bacteria 1934
749 Ga0496106_0184687 3300048909 Bacteria 1656
750 Ga0496107_0018580 3300048910 Bacteria 4896
751 Ga0496107_0205083 3300048910 Bacteria 1465
752 Ga0496107_0258789 3300048910 Bacteria 1295
753 Ga0496108_0004997 3300048911 Bacteria 10716
754 Ga0496108_0064653 3300048911 Bacteria 3082
755 Ga0496108_0084202 3300048911 Bacteria 2698
756 Ga0496108_0187737 3300048911 Bacteria 1791
757 Ga0496108_0488539 3300048911 Bacteria 1075
758 Ga0496109_0014904 3300048912 Bacteria 6765
759 Ga0496109_0143348 3300048912 Bacteria 2234
760 Ga0496109_0144684 3300048912 Unclassified 2223
761 Ga0496109_0168587 3300048912 Bacteria 2054
762 Ga0496110_0062381 3300048913 Bacteria 3292
763 Ga0496110_0098569 3300048913 Bacteria 2619
764 Ga0496110_0305854 3300048913 Bacteria 1448
765 Ga0496111_0101271 3300048914 Bacteria 2116
766 Ga0496111_0564802 3300048914 Bacteria 834
767 Ga0496112_0006007 3300048915 Bacteria 10597
768 Ga0496112_0044146 3300048915 Bacteria 4367
769 Ga0496112_0077584 3300048915 Bacteria 3285
770 Ga0496112_0204620 3300048915 Bacteria 1932
771 Ga0496112_0329436 3300048915 Bacteria 1471
772 Ga0496113_0000721 3300048916 Bacteria 16927
773 Ga0496113_0121831 3300048916 Bacteria 2039
774 Ga0496113_0143331 3300048916 Bacteria 1881
775 Ga0496113_0171033 3300048916 Bacteria 1720
776 Ga0496114_0072297 3300048917 Bacteria 2900
777 Ga0496114_0098697 3300048917 Bacteria 2490
778 Ga0496114_0162064 3300048917 Bacteria 1945
779 Ga0496115_0009214 3300048918 Bacteria 7328
780 Ga0496115_0054870 3300048918 Bacteria 3200
781 Ga0496115_0080495 3300048918 Bacteria 2652
782 Ga0496115_0164148 3300048918 Bacteria 1836
783 Ga0496115_0177654 3300048918 Bacteria 1760
784 Ga0496116_0033108 3300048919 Bacteria 3672
785 Ga0496118_0011606 3300048921 Bacteria 8578
786 Ga0496121_0011689 3300048924 Bacteria 9696
787 Ga0501031_0048621 3300049568 Bacteria 2763
788 Ga0501031_0078386 3300049568 Bacteria 2153
789 Ga0501032_0027977 3300049569 Bacteria 3874
790 Ga0501033_0005800 3300049570 Bacteria 9718
791 Ga0501033_0016275 3300049570 Bacteria 5632
792 Ga0501033_0487378 3300049570 Bacteria 854
793 Ga0501034_0027708 3300049571 Bacteria 5761
794 Ga0501034_0060022 3300049571 Bacteria 3820
795 Ga0501034_0078119 3300049571 Bacteria 3315
796 Ga0501036_0001338 3300049572 Bacteria 18941
797 Ga0501036_0061331 3300049572 Bacteria 3185
798 Ga0501036_0156419 3300049572 Bacteria 1922
799 Ga0501037_0020100 3300049573 Bacteria 4930
800 Ga0501037_0093858 3300049573 Bacteria 2170
801 Ga0501038_0012207 3300049574 Bacteria 7844
802 Ga0501038_0019214 3300049574 Bacteria 6162
803 Ga0501038_0153783 3300049574 Bacteria 1874
804 Ga0501039_0014409 3300049575 Bacteria 6054
805 Ga0501039_0308725 3300049575 Bacteria 1243
806 Ga0501041_0000199 3300049577 Bacteria 27732
807 Ga0501042_0001962 3300049578 Bacteria 12397
808 Ga0501043_0072302 3300049579 Bacteria 2709
809 Ga0501046_0009502 3300049580 Bacteria 8403
810 Ga0501047_0057389 3300049581 Bacteria 3765
811 Ga0501047_0064895 3300049581 Bacteria 3521
812 Ga0501047_0114563 3300049581 Bacteria 2578
813 Ga0501047_0201312 3300049581 Bacteria 1852
814 Ga0501048_0023681 3300049582 Bacteria 4485
815 Ga0501067_0113131 3300049583 Bacteria 1509
816 Ga0501067_0206532 3300049583 Bacteria 1094
817 Ga0501068_0015810 3300049584 Bacteria 4343
818 Ga0501069_0039000 3300049585 Bacteria 2623
819 Ga0501070_0008050 3300049586 Bacteria 8921
820 Ga0501070_0029949 3300049586 Bacteria 4560
821 Ga0501071_0017834 3300049587 Bacteria 4905
822 Ga0501071_0067829 3300049587 Bacteria 2595
823 Ga0501072_0072111 3300049588 Bacteria 2729
824 Ga0501072_0521330 3300049588 Bacteria 940
825 Ga0501073_0115989 3300049589 Bacteria 1856
826 Ga0501073_0190218 3300049589 Bacteria 1420
827 Ga0501073_0315088 3300049589 Bacteria 1079
828 Ga0501074_0053507 3300049590 Bacteria 2911
829 Ga0501075_0000297 3300049591 Bacteria 27597
830 Ga0501076_0001204 3300049592 Bacteria 17188
831 Ga0501077_0040212 3300049593 Bacteria 2979
832 Ga0501077_0342441 3300049593 Bacteria 954
833 Ga0501079_0375507 3300049741 Bacteria 1115
834 Ga0501080_0035829 3300049742 Bacteria 4631
835 Ga0501080_0467639 3300049742 Bacteria 1129
836 Ga0501081_0001439 3300049743 Bacteria 14553
837 Ga0501081_0373961 3300049743 Bacteria 1052
838 Ga0501035_0002939 3300049822 Bacteria 16395
839 Ga0501035_0035392 3300049822 Bacteria 4532
840 Ga0501035_0085525 3300049822 Bacteria 2780
841 Ga0501035_0101959 3300049822 Bacteria 2518
842 Ga0501044_0178984 3300049823 Bacteria 2088
843 Ga0501044_0192820 3300049823 Bacteria 1999
844 Ga0501044_0237119 3300049823 Bacteria 1769
845 Ga0501044_0299869 3300049823 Bacteria 1536
846 Ga0501044_0453378 3300049823 Bacteria 1189
847 Ga0501045_0000711 3300049824 Bacteria 21168
848 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
849 nmdc:mga05p37_46780_c1 3300050507 Bacteria 5320
850 nmdc:mga05p37_5632_c1 3300050507 Bacteria 14723
851 nmdc:mga09592_1148_c1 3300050508 Bacteria 21118
852 nmdc:mga09592_594788_c1 3300050508 Bacteria 948
853 nmdc:mga09592_6478_c1 3300050508 Bacteria 9536
854 nmdc:mga0qj67_16395_c1 3300050509 Bacteria 5619
855 nmdc:mga0qj67_2133_c1 3300050509 Bacteria 14087
856 nmdc:mga06r32_13847_c1 3300050510 Bacteria 7318
857 nmdc:mga06r32_4222_c1 3300050510 Bacteria 12874
858 nmdc:mga08y16_241874_c1 3300050511 Bacteria 1865
859 nmdc:mga08y16_4316_c1 3300050511 Bacteria 14850
860 nmdc:mga08y16_693078_c1 3300050511 Bacteria 1019
861 nmdc:mga08y16_93450_c1 3300050511 Bacteria 3134
862 nmdc:mga0n895_15640_c1 3300050512 Bacteria 6928
863 nmdc:mga0n895_268497_c1 3300050512 Bacteria 1731
864 nmdc:mga0n895_353051_c1 3300050512 Bacteria 1489
865 nmdc:mga0n895_489028_c1 3300050512 Bacteria 1240
866 nmdc:mga0n895_562_c1 3300050512 Bacteria 25458
867 nmdc:mga0n895_803338_c1 3300050512 Bacteria 931
868 nmdc:mga0rr50_24709_c1 3300050513 Bacteria 4167
869 nmdc:mga0rr50_35896_c1 3300050513 Bacteria 3565
870 nmdc:mga0rr50_470435_c1 3300050513 Bacteria 1067
871 nmdc:mga0rr50_515631_c1 3300050513 Bacteria 1017
872 nmdc:mga0rr50_9218_c1 3300050513 Bacteria 6191
873 nmdc:mga08x19_215736_c1 3300050514 Bacteria 1318
874 nmdc:mga08x19_23718_c1 3300050514 Bacteria 3807
875 nmdc:mga0a205_1040_c1 3300050515 Bacteria 23115
876 nmdc:mga0a205_10488_c1 3300050515 Bacteria 8513
877 nmdc:mga0a205_214998_c1 3300050515 Bacteria 1809
878 nmdc:mga0a205_32568_c1 3300050515 Bacteria 4997
879 Ga0495601_0000010 3300053077 Bacteria 266222
880 Ga0495601_0001381 3300053077 Bacteria 13364
881 Ga0495601_0002599 3300053077 Bacteria 10240
882 Ga0495601_0005715 3300053077 Bacteria 7248
883 Ga0495601_0024116 3300053077 Bacteria 3744
884 Ga0495601_0394515 3300053077 Bacteria 897
885 Ga0495612_0000002 3300053078 Bacteria 310466
886 Ga0495612_0001058 3300053078 Bacteria 11257
887 Ga0495612_0003240 3300053078 Bacteria 6749
888 Ga0495612_0050948 3300053078 Bacteria 1700
889 Ga0495595_0000184 3300053084 Bacteria 25097
890 Ga0495595_0000762 3300053084 Bacteria 12239
891 Ga0495595_0010966 3300053084 Bacteria 3781
892 Ga0495595_0044213 3300053084 Bacteria 2046
893 Ga0495595_0061228 3300053084 Bacteria 1762
894 Ga0495595_0071133 3300053084 Bacteria 1644
895 Ga0495595_0182374 3300053084 Bacteria 1041
896 Ga0495619_0000002 3300053085 Bacteria 530226
897 Ga0495619_0000271 3300053085 Bacteria 37662
898 Ga0495619_0002564 3300053085 Bacteria 11890
899 Ga0495619_0007587 3300053085 Bacteria 6868
900 Ga0495619_0009292 3300053085 Bacteria 6207
901 Ga0495619_0019964 3300053085 Bacteria 4263
902 Ga0495619_0033088 3300053085 Bacteria 3357
903 Ga0495619_0037127 3300053085 Bacteria 3173
904 Ga0495619_0069065 3300053085 Bacteria 2361
905 Ga0495619_0144114 3300053085 Bacteria 1642
906 Ga0495619_0226106 3300053085 Bacteria 1296
907 Ga0500643_019657 3300053087 Bacteria 2220
908 Ga0500644_0004254 3300053088 Bacteria 3576
909 Ga0500651_0001961 3300053093 Bacteria 10665
910 Ga0500650_0120534 3300053098 Bacteria 1223
911 Ga0500595_000062 3300053119 Bacteria 77506
912 Ga0500652_005922 3300053131 Bacteria 3892
913 Ga0500616_0000006 3300053153 Bacteria 944738
914 Ga0500616_0010041 3300053153 Bacteria 5689
915 Ga0500645_000282 3300053730 Bacteria 36379
916 Ga0501084_0044968 3300054114 Bacteria 3697
917 Ga0501084_0121442 3300054114 Bacteria 2197
918 Ga0501082_0002630 3300060353 Bacteria 15693
919 Ga0501082_0015525 3300060353 Bacteria 6557
920 Ga0501082_0247390 3300060353 Bacteria 1552
921 Ga0501082_0630752 3300060353 Bacteria 938
922 Ga0501082_0814466 3300060353 Bacteria 817
923 Ga0530510_0060982 3300061734 Bacteria 2730
924 2523103031 2522572158 Bacteria 6514390
925 2841766628 2841760612 Bacteria 6454112
926 2844105366 2844104063 Bacteria 6440972
927 2851252357 2851246043 Bacteria 6439203
928 2935616983 2935616580 Bacteria 9032984
929 2935711735 2935703347 Bacteria 10242284
930 2935810205 2935801545 Bacteria 9301974
931 2935846850 2935837841 Bacteria 9454360
932 2935855608 2935855204 Bacteria 9035059
933 2935870246 2935864058 Bacteria 9784707
934 2935876033 2935873716 Bacteria 9632195
935 2936010668 2936002035 Bacteria 9362176
936 2941547301 2941538514 Bacteria 9402094
937 8019583374 8019576017 Bacteria 10049540
938 8019591186 8019586578 Bacteria 10212056
939 8019600152 8019597564 Bacteria 10041141
940 8019618389 8019608314 Bacteria 10042931
941 Ga0500593_029496
942 ARcpr5oldR_c000028
943 ARSoilOldRDRAFT_c000023
944 JGI24737J22298_10000458
945 JGI24737J22298_10003428
946 Ga0065704_10104383
947 Ga0065712_10072517
948 Ga0065712_10087111
949 Ga0065715_10001564
950 Ga0070658_10011642
951 Ga0070658_10033788
952 Ga0070690_100147733
953 Ga0070690_100291039
954 Ga0070690_100293859
955 Ga0070670_100000437
956 Ga0070670_100107537
957 Ga0070666_10006881
958 Ga0070666_10075867
959 Ga0070680_100010932
960 Ga0070680_100023460
961 Ga0070680_100032247
962 Ga0070680_100126715
963 Ga0070680_100347009
964 Ga0070682_100013961
965 Ga0070682_100079462
966 Ga0068868_100120853
967 Ga0068868_100423853
968 Ga0070660_100008614
969 Ga0070660_100277606
970 Ga0070689_100051873
971 Ga0070689_100122333
972 Ga0070691_10152228
973 Ga0070687_100180124
974 Ga0070692_10000008
975 Ga0070692_10027989
976 Ga0070669_100058695
977 Ga0070675_100016085
978 Ga0070675_100096738
979 Ga0070671_100033139
980 Ga0070671_100100134
981 Ga0070671_100496951
982 Ga0070671_100616961
983 Ga0070674_100000456
984 Ga0070674_100179631
985 Ga0070673_100037972
986 Ga0070673_100328753
987 Ga0070688_100008112
988 Ga0070688_100035477
989 Ga0070688_100407982
990 Ga0070659_100009561
991 Ga0070659_100120197
992 Ga0070659_100205586
993 Ga0070667_100041051
994 Ga0070667_100067811
995 Ga0070667_100565571
996 Ga0070703_10003001
997 Ga0070703_10050284
998 Ga0070709_10008980
999 Ga0070709_10036382
1000 Ga0070709_10037312
1001 Ga0070709_10045792
1002 Ga0070709_10121863
1003 Ga0070709_10463575
1004 Ga0070714_100035035
1005 Ga0070714_100057751
1006 Ga0070714_100137227
1007 Ga0070713_100020676
1008 Ga0070713_100258275
1009 Ga0070710_10053671
1010 Ga0070701_10217497
1011 Ga0070711_100043656
1012 Ga0070711_100102762
1013 Ga0070711_100163490
1014 Ga0070711_100214283
1015 Ga0070705_100048399
1016 Ga0070705_100158202
1017 Ga0070705_100165663
1018 Ga0070705_100174827
1019 Ga0070700_100005017
1020 Ga0070694_100011811
1021 Ga0070694_100060362
1022 Ga0070694_100069947
1023 Ga0070708_100025847
1024 Ga0070663_100036543
1025 Ga0070678_100061496
1026 Ga0070662_100009709
1027 Ga0070662_100121499
1028 Ga0070681_10087410
1029 Ga0070681_10214217
1030 Ga0070681_10440376
1031 Ga0070681_10639002
1032 Ga0068867_100059792
1033 Ga0070685_10009054
1034 Ga0070685_10066335
1035 Ga0070707_100069965
1036 Ga0070707_100251491
1037 Ga0070707_100524883
1038 Ga0070698_100929307
1039 Ga0070679_100052860
1040 Ga0070679_100174006
1041 Ga0070679_100254195
1042 Ga0070679_100254589
1043 Ga0070684_100322239
1044 Ga0068853_100023115
1045 Ga0070672_100233162
1046 Ga0070672_100268521
1047 Ga0070686_100022223
1048 Ga0070686_100203350
1049 Ga0070695_100011865
1050 Ga0070695_100014581
1051 Ga0070695_100026690
1052 Ga0070695_100375927
1053 Ga0070695_100451580
1054 Ga0070696_100024640
1055 Ga0070696_100091787
1056 Ga0070696_100115984
1057 Ga0070693_100011715
1058 Ga0070693_100047229
1059 Ga0070704_100003857
1060 Ga0070704_100030432
1061 Ga0070704_100140760
1062 Ga0070704_100744635
1063 Ga0068855_100067277
1064 Ga0068855_100093341
1065 Ga0068855_100132246
1066 Ga0068855_100200073
1067 Ga0070664_100058305
1068 Ga0070664_100359893
1069 Ga0068857_100259640
1070 Ga0068857_100277508
1071 Ga0068857_100392680
1072 Ga0068854_100080568
1073 Ga0068856_100041527
1074 Ga0068856_100137973
1075 Ga0068856_100262757
1076 Ga0068856_100373940
1077 Ga0070702_100071323
1078 Ga0068852_100042613
1079 Ga0068852_100282026
1080 Ga0068852_100398951
1081 Ga0068859_100036332
1082 Ga0068859_100115780
1083 Ga0068859_100150189
1084 Ga0068864_100079171
1085 Ga0068864_100181923
1086 Ga0068866_10070764
1087 Ga0068861_100098948
1088 Ga0068863_100111336
1089 Ga0068863_100295529
1090 Ga0068863_100471954
1091 Ga0068858_100000512
1092 Ga0068858_100065166
1093 Ga0068858_100113862
1094 Ga0068858_100157576
1095 Ga0068858_100276198
1096 Ga0068860_100040149
1097 Ga0068860_100181065
1098 Ga0068862_100000557
1099 Ga0068862_100021018
1100 Ga0068862_100552056
1101 Ga0081455_10000035
1102 Ga0081455_10069074
1103 Ga0070717_10003781
1104 Ga0070717_10348501
1105 Ga0070717_10587645
1106 Ga0070715_10035594
1107 Ga0070716_100046614
1108 Ga0070716_100067257
1109 Ga0070716_100301529
1110 Ga0070712_100003673
1111 Ga0070712_100057204
1112 Ga0070712_100175892
1113 Ga0075427_10001188
1114 Ga0097621_100092009
1115 Ga0068871_100159997
1116 Ga0075428_100015574
1117 Ga0075428_100091010
1118 Ga0075430_100003545
1119 Ga0075430_100007795
1120 Ga0075430_100142740
1121 Ga0075431_100012917
1122 Ga0075431_100029273
1123 Ga0075433_10004405
1124 Ga0075433_10066986
1125 Ga0075433_10252959
1126 Ga0075434_100001135
1127 Ga0075434_100045346
1128 Ga0075434_100102139
1129 Ga0075434_100299100
1130 Ga0075434_100814204
1131 Ga0075429_100000008
1132 Ga0075429_100001354
1133 Ga0068865_100000119
1134 Ga0068865_100117671
1135 Ga0075436_100010766
1136 Ga0075436_100019478
1137 Ga0075436_100052595
1138 Ga0097620_100036331
1139 Ga0097620_100115777
1140 Ga0097620_100150183
1141 Ga0075435_100042204
1142 Ga0075435_100045146
1143 Ga0075435_100047158
1144 Ga0075435_100213941
1145 Ga0075435_100219849
1146 Ga0075435_100267505
1147 Ga0099795_10007316
1148 Ga0105251_10024945
1149 Ga0105240_10035786
1150 Ga0111539_10001512
1151 Ga0111539_10019347
1152 Ga0111539_11143595
1153 Ga0105245_10128369
1154 Ga0105245_10218347
1155 Ga0105247_10191744
1156 Ga0105247_10255653
1157 Ga0114129_10056907
1158 Ga0114129_10066967
1159 Ga0114129_10175903
1160 Ga0105243_10020499
1161 Ga0105243_10146344
1162 Ga0105242_10002839
1163 Ga0105248_10190862
1164 Ga0105248_10240117
1165 Ga0105248_10372572
1166 Ga0105248_10633902
1167 Ga0105237_10265205
1168 Ga0105238_10085262
1169 Ga0105249_10000215
1170 Ga0105249_10009891
1171 Ga0105249_10115843
1172 Ga0105249_10133900
1173 Ga0105249_10688926
1174 Ga0099796_10005784
1175 Ga0105239_10028262
1176 Ga0105239_10319600
1177 Ga0105239_10414397
1178 Ga0105239_10525955
1179 Ga0105246_10000019
1180 Ga0105246_10145180
1181 Ga0105246_10225498
1182 Ga0157370_10051700
1183 Ga0157370_10263703
1184 Ga0157370_10319230
1185 Ga0157369_10004736
1186 Ga0157374_10326771
1187 Ga0157374_10539711
1188 Ga0157378_10002701
1189 Ga0157378_10240375
1190 Ga0157378_10246363
1191 Ga0163162_10001187
1192 Ga0163162_10087104
1193 Ga0163162_10306353
1194 Ga0163162_10570722
1195 Ga0157372_10701660
1196 Ga0157372_10992013
1197 Ga0157375_10010957
1198 Ga0157375_10228605
1199 Ga0157375_10493174
1200 Ga0157375_10499742
1201 Ga0163163_10019264
1202 Ga0163163_10263527
1203 Ga0163163_10393967
1204 Ga0157380_10000284
1205 Ga0157380_10578608
1206 Ga0182008_10017977
1207 Ga0182008_10131793
1208 Ga0157379_10208769
1209 Ga0157379_10320881
1210 Ga0157376_10363081
1211 Ga0163161_10100882
1212 Ga0163161_10274660
1213 Ga0206354_10285912
1214 Ga0206353_10528377
1215 Ga0206353_11144301
1216 Ga0213876_10033890
1217 Ga0213875_10000165
1218 Ga0207666_1000744
1219 Ga0207697_10003696
1220 Ga0207653_10001699
1221 Ga0207692_10040821
1222 Ga0207692_10052375
1223 Ga0207692_10092149
1224 Ga0207710_10004914
1225 Ga0207688_10034764
1226 Ga0207688_10155127
1227 Ga0207680_10101178
1228 Ga0207647_10043164
1229 Ga0207685_10013800
1230 Ga0207685_10016988
1231 Ga0207699_10061149
1232 Ga0207699_10068983
1233 Ga0207699_10106676
1234 Ga0207699_10160123
1235 Ga0207699_10318315
1236 Ga0207645_10053476
1237 Ga0207705_10203974
1238 Ga0207707_10009645
1239 Ga0207707_10211145
1240 Ga0207707_10256086
1241 Ga0207693_10009873
1242 Ga0207693_10017770
1243 Ga0207693_10209191
1244 Ga0207663_10043923
1245 Ga0207663_10194238
1246 Ga0207660_10174634
1247 Ga0207660_10314724
1248 Ga0207657_10010318
1249 Ga0207657_10074179
1250 Ga0207657_10120100
1251 Ga0207649_10293675
1252 Ga0207652_10026006
1253 Ga0207652_10153018
1254 Ga0207652_10209758
1255 Ga0207646_10085210
1256 Ga0207646_10446086
1257 Ga0207681_10277169
1258 Ga0207694_10244276
1259 Ga0207650_10603563
1260 Ga0207659_10028682
1261 Ga0207687_10006850
1262 Ga0207687_10179633
1263 Ga0207700_10004694
1264 Ga0207700_10018933
1265 Ga0207700_10426199
1266 Ga0207664_10041800
1267 Ga0207664_10098805
1268 Ga0207664_10410093
1269 Ga0207644_10120276
1270 Ga0207644_10312897
1271 Ga0207644_10432814
1272 Ga0207690_10040362
1273 Ga0207690_10231023
1274 Ga0207706_10017526
1275 Ga0207706_10088991
1276 Ga0207686_10035002
1277 Ga0207686_10038994
1278 Ga0207709_10070620
1279 Ga0207670_10112784
1280 Ga0207669_10026526
1281 Ga0207669_10119421
1282 Ga0207704_10024045
1283 Ga0207665_10000631
1284 Ga0207665_10265993
1285 Ga0207665_10267406
1286 Ga0207665_10480970
1287 Ga0207691_10055482
1288 Ga0207691_10285128
1289 Ga0207711_10016598
1290 Ga0207711_10054868
1291 Ga0207711_10455513
1292 Ga0207689_10036982
1293 Ga0207679_10066279
1294 Ga0207679_10126399
1295 Ga0207667_10099491
1296 Ga0207667_10220282
1297 Ga0207651_10037972
1298 Ga0207651_10691524
1299 Ga0207712_10037284
1300 Ga0207712_10073558
1301 Ga0207712_10126500
1302 Ga0207712_10535035
1303 Ga0207668_10090761
1304 Ga0207640_10061221
1305 Ga0207658_10015437
1306 Ga0207658_10399165
1307 Ga0207677_10578127
1308 Ga0207639_10092709
1309 Ga0207678_10014489
1310 Ga0207678_10027526
1311 Ga0207678_10036968
1312 Ga0207708_10002641
1313 Ga0207708_10281192
1314 Ga0207702_10101298
1315 Ga0207702_10204902
1316 Ga0207702_10281850
1317 Ga0207641_10118183
1318 Ga0207641_10161900
1319 Ga0207641_10190827
1320 Ga0207648_10038868
1321 Ga0207648_10289894
1322 Ga0207676_10072633
1323 Ga0207674_10235913
1324 Ga0207674_10266694
1325 Ga0207674_10301720
1326 Ga0207675_100028481
1327 Ga0207683_10045639
1328 Ga0207683_10054532
1329 Ga0207683_10141858
1330 Ga0207698_10126915
1331 Ga0207698_10158228
1332 Ga0209966_1001251
1333 Ga0209966_1001450
1334 Ga0209966_1008347
1335 Ga0209998_10000949
1336 Ga0209998_10009395
1337 Ga0209974_10001910
1338 Ga0209974_10087552
1339 Ga0207428_10000308
1340 Ga0207428_10000474
1341 Ga0268266_10051110
1342 Ga0268266_10294300
1343 Ga0268265_10026332
1344 Ga0268265_10612441
1345 Ga0268264_10159321
1346 Ga0268264_10359016
1347 Ga0268264_10476480
1348 Ga0265338_10002492
1349 Ga0265338_10064148
1350 Ga0265762_1006598
1351 Ga0265330_10003043
1352 Ga0265332_10001070
1353 Ga0265325_10000352
1354 Ga0265325_10052644
1355 Ga0265325_10165057
1356 Ga0265340_10006050
1357 Ga0265340_10034466
1358 Ga0265340_10100770
1359 Ga0265339_10000979
1360 Ga0265339_10005391
1361 Ga0265339_10012730
1362 Ga0265339_10015364
1363 Ga0265316_10044436
1364 Ga0265316_10084271
1365 Ga0265313_10000686
1366 Ga0316579_10024922
1367 Ga0265314_10003780
1368 Ga0265314_10005573
1369 Ga0265342_10000031
1370 Ga0265342_10000882
1371 Ga0265342_10004819
1372 Ga0316583_10000161
1373 Ga0373930_0000020
1374 Ga0373930_0012248
1375 Ga0373948_0000371
1376 Ga0373948_0012850
1377 Ga0373950_0000266
1378 Ga0373958_0000533
1379 Ga0373959_0000539
1380 Ga0373938_0000748
1381 Ga0373926_0004368
1382 Ga0373926_0016309
1383 Ga0373926_0106149
1384 Ga0373928_0004305
1385 Ga0373929_0000042
1386 Ga0373934_0013885
1387 Ga0373934_0042312
1388 Ga0373934_0054287
1389 Ga0373940_0000325
1390 Ga0373944_0019405
1391 Ga0373949_0001117
1392 Ga0373951_0000547
1393 Ga0373952_0000713
1394 Ga0373952_0008868
1395 Ga0373952_0021568
1396 Ga0373923_0002274
1397 Ga0373923_0041700
1398 Ga0373932_0001186
1399 Ga0373932_0002300
1400 Ga0373936_0001104
1401 Ga0373936_0019802
1402 Ga0373936_0084800
1403 Ga0373939_0000360
1404 Ga0373939_0011935
1405 Ga0373941_0001805
1406 Ga0373941_0005933
1407 Ga0373945_0000503
1408 Ga0373953_0000488
1409 Ga0373953_0048465
1410 Ga0373954_0004286
1411 Ga0373954_0057832
1412 Ga0373956_0014464
1413 Ga0373956_0024246
1414 Ga0373957_0005912
1415 Ga0373957_0016648
1416 Ga0373957_0052263
1417 Ga0373957_0133632
1418 Ga0373960_0003891
1419 Ga0373960_0019041
1420 Ga0373960_0036289
1421 Ga0373943_0003705
1422 Ga0373943_0010637
1423 Ga0373943_0027110
1424 Ga0373946_0001059
1425 Ga0373946_0002277
1426 Ga0373955_0000425
1427 Ga0373955_0129552
1428 Ga0373955_0139733
1429 Ga0373942_0001477
1430 Ga0373942_0003320
1431 Ga0373942_0018232
1432 Ga0373961_0003189
1433 Ga0373962_0000354
1434 Ga0373962_0013857
1435 Ga0373924_0049494
1436 Ga0373931_0030133
1437 Ga0373931_0053231
1438 Ga0373931_0252020
1439 Ga0373935_0000337
1440 Ga0373935_0003255
1441 Ga0373935_0036252
1442 Ga0373935_0040667
1443 Ga0373935_0076945
1444 Ga0373927_0011982
1445 Ga0373927_0039586
1446 Ga0373927_0039898
1447 Ga0373927_0043067
1448 Ga0373927_0071590
1449 Ga0373933_0002475
1450 Ga0373933_0010438
1451 Ga0373933_0019109
1452 Ga0373933_0024531
1453 Ga0373933_0071924
1454 Ga0373933_0344860
1455 Ga0373947_0001536
1456 Ga0373947_0012712
1457 Ga0373947_0030383
1458 Ga0373947_0053434
1459 Ga0373947_0494248
1460 Ga0373937_0000223
1461 Ga0373937_0005292
1462 Ga0373937_0011036
1463 Ga0373937_0027077
1464 Ga0373937_0043671
1465 Ga0373937_0073445
1466 Ga0373925_0000741
1467 Ga0373925_0008940
1468 Ga0373925_0150446
1469 Ga0373925_0179833
1470 Ga0373925_0351784
1471 Ga0395899_0036755
1472 Ga0395900_0005074
1473 Ga0395900_0008149
1474 Ga0395900_0424802
1475 Ga0395898_0032574
1476 Ga0395898_0110478
1477 Ga0395898_0121248
1478 Ga0436364_1070861
1479 Ga0436364_1177974
1480 Ga0395901_0009281
1481 Ga0395901_0014372
1482 Ga0436365_0380370
1483 Ga0436365_0442321
1484 Ga0436365_0592364
1485 Ga0436361_0189320
1486 Ga0436361_0944607
1487 Ga0436363_0323907
1488 Ga0436362_0454806
1489 Ga0436362_1243395
1490 Ga0439441_006313
1491 Ga0439441_020180
1492 Ga0439460_0014322
1493 Ga0466966_0125083
1494 Ga0466963_0121732
1495 Ga0466971_0180933
1496 Ga0466957_0066173
1497 Ga0466957_0187463
1498 Ga0451576_0023021
1499 Ga0451576_0056338
1500 Ga0466958_0067366
1501 Ga0466958_0320245
1502 Ga0466967_0022504
1503 Ga0466967_0450012
1504 Ga0495592_0000188
1505 Ga0495592_0007677
1506 Ga0495592_0060198
1507 Ga0495592_0067404
1508 Ga0495592_0180560
1509 Ga0495603_0015554
1510 Ga0495603_0091022
1511 Ga0495591_033479
1512 Ga0495629_0000222
1513 Ga0495629_0002114
1514 Ga0495629_0092397
1515 Ga0495629_0101992
1516 Ga0495629_0139671
1517 Ga0495629_0158420
1518 Ga0495641_0013226
1519 Ga0495651_0001439
1520 Ga0495651_0014733
1521 Ga0495651_0101853
1522 Ga0495651_0142149
1523 Ga0495651_0149293
1524 Ga0495651_0164873
1525 Ga0495651_0248429
1526 Ga0495653_0000198
1527 Ga0495653_0027955
1528 Ga0495653_0037313
1529 Ga0495653_0140058
1530 Ga0495580_0022328
1531 Ga0495580_0120836
1532 Ga0495582_0040673
1533 Ga0495605_0151191
1534 Ga0495639_0008708
1535 Ga0495639_0137851
1536 Ga0495662_0000720
1537 Ga0495662_0009876
1538 Ga0495662_0096654
1539 Ga0495664_0000002
1540 Ga0495664_0003233
1541 Ga0495584_0077382
1542 Ga0495585_0001425
1543 Ga0495594_0091858
1544 Ga0495608_0000009
1545 Ga0495608_0002323
1546 Ga0495608_0014885
1547 Ga0495608_0423360
1548 Ga0495618_0000005
1549 Ga0495618_0060945
1550 Ga0495628_0000002
1551 Ga0495628_0011343
1552 Ga0495628_0014516
1553 Ga0495628_0372241
1554 Ga0495630_0000614
1555 Ga0495630_0057444
1556 Ga0495630_0065524
1557 Ga0495630_0117096
1558 Ga0495630_0213547
1559 Ga0495644_0000656
1560 Ga0495663_0011247
1561 Ga0495666_0008769
1562 Ga0495666_0033500
1563 Ga0495652_0000004
1564 Ga0495652_0020572
1565 Ga0495652_0098442
1566 Ga0495665_0003071
1567 Ga0495665_0052758
1568 Ga0495640_0000005
1569 Ga0495640_0022097
1570 Ga0495640_0082608
1571 Ga0495640_0090755
1572 Ga0495640_0317171
1573 Ga0495640_0438369
1574 Ga0495586_0016023
1575 Ga0495586_0039975
1576 Ga0495586_0090372
1577 Ga0495587_0000007
1578 Ga0495587_0006576
1579 Ga0495609_0107194
1580 Ga0495645_0000003
1581 Ga0495645_0049212
1582 Ga0495645_0070637
1583 Ga0495622_0006136
1584 Ga0495633_0009720
1585 Ga0495667_0000002
1586 Ga0495667_0002675
1587 Ga0495667_0022163
1588 Ga0495667_0034249
1589 Ga0495667_0132571
1590 Ga0495656_0000262
1591 Ga0495634_0000129
1592 Ga0495634_0131359
1593 Ga0495634_0135142
1594 Ga0495634_0190723
1595 Ga0495634_0216474
1596 Ga0495611_0010698
1597 Ga0495635_0000289
1598 Ga0495635_0002537
1599 Ga0495635_0225378
1600 Ga0495659_0006163
1601 Ga0495661_0053372
1602 Ga0495588_0009638
1603 Ga0495588_0093201
1604 Ga0495657_0000781
1605 Ga0495657_0004771
1606 Ga0495599_0000001
1607 Ga0495599_0025159
1608 Ga0495599_0063998
1609 Ga0495623_0000001
1610 Ga0495623_0001394
1611 Ga0495623_0119546
1612 Ga0495646_0000013
1613 Ga0495646_0001135
1614 Ga0495646_0005931
1615 Ga0495647_0003047
1616 Ga0495647_0003641
1617 Ga0495658_0000656
1618 Ga0495658_0013420
1619 Ga0495658_0085832
1620 Ga0495613_0004890
1621 Ga0495613_0031920
1622 Ga0495613_0044829
1623 Ga0495613_0074197
1624 Ga0495613_0132259
1625 Ga0495613_0157754
1626 Ga0495624_0015796
1627 Ga0495624_0024272
1628 Ga0495624_0073691
1629 Ga0495670_0001048
1630 Ga0495671_0045891
1631 Ga0495600_0000233
1632 Ga0495600_0000708
1633 Ga0495600_0003719
1634 Ga0495581_0006809
1635 Ga0495581_0025414
1636 Ga0495581_0052490
1637 Ga0495604_0000005
1638 Ga0495604_0017043
1639 Ga0495604_0127058
1640 Ga0495674_0000003
1641 Ga0495674_0002023
1642 Ga0495674_0007365
1643 Ga0495674_0061512
1644 Ga0495674_0249218
1645 Ga0495676_0042309
1646 Ga0495676_0224287
1647 Ga0495680_0000002
1648 Ga0495680_0005048
1649 Ga0495680_0008971
1650 Ga0495680_0009889
1651 Ga0495680_0042831
1652 Ga0495680_0095117
1653 Ga0495675_0000437
1654 Ga0495675_0003495
1655 Ga0495675_0017856
1656 Ga0495684_0000020
1657 Ga0495684_0181447
1658 Ga0495684_0295581
1659 Ga0495593_0001400
1660 Ga0495593_0039987
1661 Ga0495602_0000027
1662 Ga0495602_0092297
1663 Ga0495602_0111968
1664 Ga0495614_0028550
1665 Ga0495614_0171943
1666 Ga0496100_0029850
1667 Ga0496100_0112447
1668 Ga0496100_0272038
1669 Ga0496101_0036257
1670 Ga0496101_0364461
1671 Ga0496101_0493255
1672 Ga0496102_0005220
1673 Ga0496102_0250040
1674 Ga0496102_0537203
1675 Ga0496103_0024207
1676 Ga0496103_0297315
1677 Ga0496104_0000116
1678 Ga0496104_0063343
1679 Ga0496104_0138651
1680 Ga0496104_0154803
1681 Ga0496104_0440187
1682 Ga0496105_0000550
1683 Ga0496105_0133733
1684 Ga0496105_0134925
1685 Ga0496105_0480073
1686 Ga0496105_0676823
1687 Ga0496106_0014148
1688 Ga0496106_0135542
1689 Ga0496106_0184687
1690 Ga0496107_0018580
1691 Ga0496107_0205083
1692 Ga0496107_0258789
1693 Ga0496108_0004997
1694 Ga0496108_0064653
1695 Ga0496108_0084202
1696 Ga0496108_0187737
1697 Ga0496108_0488539
1698 Ga0496109_0014904
1699 Ga0496109_0143348
1700 Ga0496109_0144684
1701 Ga0496109_0168587
1702 Ga0496110_0062381
1703 Ga0496110_0098569
1704 Ga0496110_0305854
1705 Ga0496111_0101271
1706 Ga0496111_0564802
1707 Ga0496112_0006007
1708 Ga0496112_0044146
1709 Ga0496112_0077584
1710 Ga0496112_0204620
1711 Ga0496112_0329436
1712 Ga0496113_0000721
1713 Ga0496113_0121831
1714 Ga0496113_0143331
1715 Ga0496113_0171033
1716 Ga0496114_0072297
1717 Ga0496114_0098697
1718 Ga0496114_0162064
1719 Ga0496115_0009214
1720 Ga0496115_0054870
1721 Ga0496115_0080495
1722 Ga0496115_0164148
1723 Ga0496115_0177654
1724 Ga0496116_0033108
1725 Ga0496118_0011606
1726 Ga0496121_0011689
1727 Ga0501031_0048621
1728 Ga0501031_0078386
1729 Ga0501032_0027977
1730 Ga0501033_0005800
1731 Ga0501033_0016275
1732 Ga0501033_0487378
1733 Ga0501034_0027708
1734 Ga0501034_0060022
1735 Ga0501034_0078119
1736 Ga0501036_0001338
1737 Ga0501036_0061331
1738 Ga0501036_0156419
1739 Ga0501037_0020100
1740 Ga0501037_0093858
1741 Ga0501038_0012207
1742 Ga0501038_0019214
1743 Ga0501038_0153783
1744 Ga0501039_0014409
1745 Ga0501039_0308725
1746 Ga0501041_0000199
1747 Ga0501042_0001962
1748 Ga0501043_0072302
1749 Ga0501046_0009502
1750 Ga0501047_0057389
1751 Ga0501047_0064895
1752 Ga0501047_0114563
1753 Ga0501047_0201312
1754 Ga0501048_0023681
1755 Ga0501067_0113131
1756 Ga0501067_0206532
1757 Ga0501068_0015810
1758 Ga0501069_0039000
1759 Ga0501070_0008050
1760 Ga0501070_0029949
1761 Ga0501071_0017834
1762 Ga0501071_0067829
1763 Ga0501072_0072111
1764 Ga0501072_0521330
1765 Ga0501073_0115989
1766 Ga0501073_0190218
1767 Ga0501073_0315088
1768 Ga0501074_0053507
1769 Ga0501075_0000297
1770 Ga0501076_0001204
1771 Ga0501077_0040212
1772 Ga0501077_0342441
1773 Ga0501079_0375507
1774 Ga0501080_0035829
1775 Ga0501080_0467639
1776 Ga0501081_0001439
1777 Ga0501081_0373961
1778 Ga0501035_0002939
1779 Ga0501035_0035392
1780 Ga0501035_0085525
1781 Ga0501035_0101959
1782 Ga0501044_0178984
1783 Ga0501044_0192820
1784 Ga0501044_0237119
1785 Ga0501044_0299869
1786 Ga0501044_0453378
1787 Ga0501045_0000711
1788 nmdc:mga05p37_109_c1
1789 nmdc:mga05p37_46780_c1
1790 nmdc:mga05p37_5632_c1
1791 nmdc:mga09592_1148_c1
1792 nmdc:mga09592_594788_c1
1793 nmdc:mga09592_6478_c1
1794 nmdc:mga0qj67_16395_c1
1795 nmdc:mga0qj67_2133_c1
1796 nmdc:mga06r32_13847_c1
1797 nmdc:mga06r32_4222_c1
1798 nmdc:mga08y16_241874_c1
1799 nmdc:mga08y16_4316_c1
1800 nmdc:mga08y16_693078_c1
1801 nmdc:mga08y16_93450_c1
1802 nmdc:mga0n895_15640_c1
1803 nmdc:mga0n895_268497_c1
1804 nmdc:mga0n895_353051_c1
1805 nmdc:mga0n895_489028_c1
1806 nmdc:mga0n895_562_c1
1807 nmdc:mga0n895_803338_c1
1808 nmdc:mga0rr50_24709_c1
1809 nmdc:mga0rr50_35896_c1
1810 nmdc:mga0rr50_470435_c1
1811 nmdc:mga0rr50_515631_c1
1812 nmdc:mga0rr50_9218_c1
1813 nmdc:mga08x19_215736_c1
1814 nmdc:mga08x19_23718_c1
1815 nmdc:mga0a205_1040_c1
1816 nmdc:mga0a205_10488_c1
1817 nmdc:mga0a205_214998_c1
1818 nmdc:mga0a205_32568_c1
1819 Ga0495601_0000010
1820 Ga0495601_0001381
1821 Ga0495601_0002599
1822 Ga0495601_0005715
1823 Ga0495601_0024116
1824 Ga0495601_0394515
1825 Ga0495612_0000002
1826 Ga0495612_0001058
1827 Ga0495612_0003240
1828 Ga0495612_0050948
1829 Ga0495595_0000184
1830 Ga0495595_0000762
1831 Ga0495595_0010966
1832 Ga0495595_0044213
1833 Ga0495595_0061228
1834 Ga0495595_0071133
1835 Ga0495595_0182374
1836 Ga0495619_0000002
1837 Ga0495619_0000271
1838 Ga0495619_0002564
1839 Ga0495619_0007587
1840 Ga0495619_0009292
1841 Ga0495619_0019964
1842 Ga0495619_0033088
1843 Ga0495619_0037127
1844 Ga0495619_0069065
1845 Ga0495619_0144114
1846 Ga0495619_0226106
1847 Ga0500643_019657
1848 Ga0500644_0004254
1849 Ga0500651_0001961
1850 Ga0500650_0120534
1851 Ga0500595_000062
1852 Ga0500652_005922
1853 Ga0500616_0000006
1854 Ga0500616_0010041
1855 Ga0500645_000282
1856 Ga0501084_0044968
1857 Ga0501084_0121442
1858 Ga0501082_0002630
1859 Ga0501082_0015525
1860 Ga0501082_0247390
1861 Ga0501082_0630752
1862 Ga0501082_0814466
1863 Ga0530510_0060982
1864 2523103031
1865 2841766628
1866 2844105366
1867 2851252357
1868 2935616983
1869 2935711735
1870 2935810205
1871 2935846850
1872 2935855608
1873 2935870246
1874 2935876033
1875 2936010668
1876 2941547301
1877 8019583374
1878 8019591186
1879 8019600152
1880 8019618389

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

193

0.95

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

266

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9296 5 232
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9156 5 232
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9141 5 232
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9124 5 243
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9068 1 232
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.931 1 228 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 5 227 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.927 1 228 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9196 4 245 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9109 16 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1RA33-F1-model_v4 ABC transporter ATP-binding protein 0.9784 5 244 GO:0005524
GO:0005886
GO:0016887
AF-U4Q7P7-F1-model_v4 Branched-chain amino acid ABC transporter, ATP-binding component 0.9782 2 244 GO:0005524
GO:0005886
GO:0016887
AF-F6FZX2-F1-model_v4 Amino-acid ATP-binding ABC transporter protein 0.972 3 248 GO:0005524
GO:0005886
GO:0016887
AF-N6TX83-F1-model_v4 Putative ATP-binding protein component of ABC transporter 0.9712 1 244 GO:0005524
GO:0005886
GO:0016887
AF-A0A6H2H6E5-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) 0.9669 3 244 GO:0005524
GO:0005886
GO:0016887

Map