F486334

General Info

Members Datasets Scaffolds Average Seq Length
941 612 1882 287

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0018767|Ga0373947_0018767_706_1647
Length 313
Sequence VSHLWLSALVTSSGYTGARRTALHEAAMNILSIQSWVAYGHVGNASAVFPLQRLGAEVWSINTVQFSNHTGYGHWTGQVYTGDAVRDLVDGIAARDVLRHCDAVLSGYMGDAGIGEAILHAVTRVREENPRAIYCCDPVIGDTEEGVYVREGIEEFLRDHALPQADIATPNRFELERLTGLDCGTLTGAKDAVERLAATMRPDGLRCVLLTSLETELTPGDHMDLLVGEGGSFHLLRTPRLPVSVNGAGDAVAALFLFHRLDTGSAVKAMEAAGSAVHGLLRRTAEAGSREILTVAAQDEFVAPATRFVAHPC

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
333 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
341 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
342 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
343 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
344 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
345 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
346 2512875024
347 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
348 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
349 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
350 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
351 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
352 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
353 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
354 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
355 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
356 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
357 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
358 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
359 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
360 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
361 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
362 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
363 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
364 2738543024 Aminobacter sp. AP02 Isolate Unclassified
365 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
366 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
367 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
368 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
369 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
370 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
371 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
372 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
373 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
374 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
375 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
376 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
377 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
378 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
379 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
380 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
381 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
382 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
383 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
384 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
385 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
386 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
387 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
388 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
389 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
390 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
391 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
392 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
393 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
394 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
395 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
396 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
397 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
398 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
399 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
400 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
401 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
402 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
403 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
404 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
405 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
406 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
407 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
408 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
409 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
410 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
411 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
412 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
413 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
414 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
415 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
416 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
417 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
418 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
419 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
420 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
421 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
422 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
423 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
424 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
425 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
426 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
427 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
428 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
429 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
430 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
431 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
432 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
433 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
434 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
435 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
436 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
437 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
438 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
439 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
440 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
441 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
442 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
443 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
444 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
445 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
446 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
447 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
448 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
449 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
450 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
451 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
452 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
453 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
454 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
455 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
456 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
457 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
458 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
459 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
460 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
461 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
462 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
463 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
464 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
465 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
466 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
467 2909042592 Labrys sp. LIt4 Isolate Nodule
468 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
469 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
470 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
471 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
472 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
473 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
474 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
475 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
476 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
477 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
478 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
479 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
480 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
481 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
482 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
483 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
484 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
485 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
486 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
487 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
488 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
489 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
490 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
491 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
492 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
493 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
494 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
495 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
496 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
497 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
498 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
499 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
500 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
501 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
502 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
503 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
504 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
505 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
506 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
507 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
508 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
509 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
510 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
511 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
512 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
513 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
514 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
515 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
516 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
517 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
518 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
519 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
520 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
521 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
522 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
523 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
524 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
525 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
526 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
527 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
528 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
529 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
530 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
531 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
532 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
533 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
534 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
535 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
536 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
537 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
538 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
539 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
540 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
541 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
542 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
543 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
544 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
545 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
546 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
547 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
548 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
549 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
550 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
551 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
552 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
553 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
554 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
555 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
556 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
557 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
558 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
559 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
560 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
561 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
562 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
563 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
564 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
565 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
566 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
567 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
568 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
569 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
570 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
571 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
572 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
573 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
574 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
575 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
576 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
577 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
578 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
579 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
580 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
581 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
582 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
583 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
584 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
585 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
586 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
587 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
588 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
589 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
590 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
591 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
592 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
593 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
594 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
595 641522639 Methylobacterium sp. 4-46 Isolate Nodule
596 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
597 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
598 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
599 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
600 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
601 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
602 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
603 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
604 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
605 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
606 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
607 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
608 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
609 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
610 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
611 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
612 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.46
Metatranscriptomes 0.32
Isolates 29.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 24.44
Rhizoplane 5.31
Rhizosphere 59.3
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0018767 3300035725 Bacteria 3983
2 JGI25406J46586_10000109 3300003203 Bacteria 36339
3 JGI25404J52841_10000082 3300003659 Bacteria 8763
4 Ga0070658_10056505 3300005327 Bacteria 3190
5 Ga0070683_100069233 3300005329 Bacteria 3289
6 Ga0070683_100163430 3300005329 Bacteria 2112
7 Ga0070683_100182341 3300005329 Bacteria 1993
8 Ga0070690_100036374 3300005330 Bacteria 3094
9 Ga0070670_100050719 3300005331 Bacteria 3565
10 Ga0070666_10006286 3300005335 Bacteria 7304
11 Ga0070666_10014730 3300005335 Bacteria 4981
12 Ga0070680_100159738 3300005336 Bacteria 1894
13 Ga0070680_100365256 3300005336 Bacteria 1228
14 Ga0070682_100263438 3300005337 Bacteria 1248
15 Ga0068868_100013509 3300005338 Bacteria 5988
16 Ga0070660_100213575 3300005339 Bacteria 1567
17 Ga0070687_100085215 3300005343 Bacteria 1734
18 Ga0070661_100022274 3300005344 Bacteria 4536
19 Ga0070692_10257612 3300005345 Bacteria 1047
20 Ga0070668_100200150 3300005347 Bacteria 1639
21 Ga0070668_100325935 3300005347 Bacteria 1294
22 Ga0070669_100164922 3300005353 Bacteria 1724
23 Ga0070675_100278038 3300005354 Bacteria 1470
24 Ga0070671_100097885 3300005355 Bacteria 2460
25 Ga0070673_100041471 3300005364 Bacteria 3540
26 Ga0070688_100007241 3300005365 Bacteria 5976
27 Ga0070659_100086396 3300005366 Bacteria 2510
28 Ga0070667_100032087 3300005367 Bacteria 4380
29 Ga0070667_100060010 3300005367 Bacteria 3219
30 Ga0070709_10010315 3300005434 Bacteria 5168
31 Ga0070709_10021445 3300005434 Bacteria 3762
32 Ga0070714_100085603 3300005435 Bacteria 2753
33 Ga0070714_100445834 3300005435 Bacteria 1229
34 Ga0070714_100687792 3300005435 Bacteria 986
35 Ga0070713_100016764 3300005436 Bacteria 5516
36 Ga0070713_100022844 3300005436 Bacteria 4841
37 Ga0070713_100119143 3300005436 Bacteria 2312
38 Ga0070710_10002270 3300005437 Bacteria 9092
39 Ga0070710_10009019 3300005437 Bacteria 4875
40 Ga0070710_10067927 3300005437 Bacteria 2047
41 Ga0070701_10113335 3300005438 Bacteria 1518
42 Ga0070701_10127453 3300005438 Bacteria 1442
43 Ga0070711_100016805 3300005439 Bacteria 4651
44 Ga0070711_100047333 3300005439 Bacteria 2935
45 Ga0070663_100624251 3300005455 Bacteria 909
46 Ga0070678_100004557 3300005456 Bacteria 7865
47 Ga0070678_100033282 3300005456 Bacteria 3577
48 Ga0070662_100313836 3300005457 Bacteria 1277
49 Ga0070681_10058748 3300005458 Bacteria 3826
50 Ga0070685_10006589 3300005466 Bacteria 5924
51 Ga0070679_100002598 3300005530 Bacteria 16417
52 Ga0070679_100079164 3300005530 Bacteria 3276
53 Ga0070679_100163069 3300005530 Bacteria 2203
54 Ga0070679_100510759 3300005530 Bacteria 1146
55 Ga0070684_100529592 3300005535 Bacteria 1092
56 Ga0070672_100376566 3300005543 Bacteria 1214
57 Ga0070672_100389092 3300005543 Bacteria 1194
58 Ga0070686_100003427 3300005544 Bacteria 8705
59 Ga0070695_100099238 3300005545 Bacteria 1958
60 Ga0070693_100006523 3300005547 Bacteria 5659
61 Ga0070665_100014656 3300005548 Bacteria 7868
62 Ga0070665_100065860 3300005548 Bacteria 3634
63 Ga0070665_100189359 3300005548 Bacteria 2058
64 Ga0068855_100099540 3300005563 Bacteria 3348
65 Ga0070664_100221706 3300005564 Bacteria 1692
66 Ga0068857_100454614 3300005577 Bacteria 1198
67 Ga0068856_100201818 3300005614 Bacteria 2003
68 Ga0068852_100335647 3300005616 Bacteria 1472
69 Ga0068859_100080273 3300005617 Bacteria 3303
70 Ga0068864_100009012 3300005618 Bacteria 8227
71 Ga0068866_10011785 3300005718 Bacteria 3793
72 Ga0068866_10091414 3300005718 Bacteria 1658
73 Ga0068861_100185416 3300005719 Bacteria 1735
74 Ga0068863_100078487 3300005841 Bacteria 3126
75 Ga0068858_100033296 3300005842 Bacteria 4784
76 Ga0068858_100271812 3300005842 Bacteria 1613
77 Ga0081455_10002387 3300005937 Bacteria 22423
78 Ga0081455_10002827 3300005937 Bacteria 20442
79 Ga0081455_10051220 3300005937 Bacteria 3542
80 Ga0081538_10059592 3300005981 Bacteria 2203
81 Ga0081540_1015854 3300005983 Bacteria 4749
82 Ga0081540_1087122 3300005983 Bacteria 1385
83 Ga0081539_10001010 3300005985 Bacteria 51943
84 Ga0081539_10001777 3300005985 Bacteria 34287
85 Ga0070717_10000870 3300006028 Bacteria 19960
86 Ga0070717_10291515 3300006028 Bacteria 1449
87 Ga0075365_10006435 3300006038 Bacteria 6464
88 Ga0075365_10092287 3300006038 Bacteria 2064
89 Ga0075365_10160544 3300006038 Bacteria 1566
90 Ga0075368_10039114 3300006042 Bacteria 1858
91 Ga0075363_100005578 3300006048 Bacteria 5615
92 Ga0075363_100013754 3300006048 Bacteria 3936
93 Ga0075363_100117986 3300006048 Bacteria 1480
94 Ga0075364_10005368 3300006051 Bacteria 7443
95 Ga0075364_10043125 3300006051 Bacteria 2932
96 Ga0070715_10004329 3300006163 Bacteria 4640
97 Ga0070716_100000405 3300006173 Bacteria 17764
98 Ga0070712_100006107 3300006175 Bacteria 7457
99 Ga0070712_100054743 3300006175 Bacteria 2790
100 Ga0070712_100323869 3300006175 Bacteria 1254
101 Ga0070712_100453504 3300006175 Bacteria 1068
102 Ga0075362_10017365 3300006177 Bacteria 2964
103 Ga0075362_10089358 3300006177 Bacteria 1428
104 Ga0075367_10002138 3300006178 Bacteria 8895
105 Ga0075367_10023750 3300006178 Bacteria 3453
106 Ga0075369_10016092 3300006186 Bacteria 3011
107 Ga0075369_10120529 3300006186 Bacteria 1187
108 Ga0097621_100012752 3300006237 Bacteria 6245
109 Ga0075370_10041958 3300006353 Bacteria 2583
110 Ga0068871_100005825 3300006358 Bacteria 8660
111 Ga0075428_100174181 3300006844 Bacteria 2331
112 Ga0075428_100289642 3300006844 Bacteria 1761
113 Ga0075431_100241413 3300006847 Bacteria 1838
114 Ga0075433_10054160 3300006852 Bacteria 3499
115 Ga0075433_10065447 3300006852 Bacteria 3188
116 Ga0075434_100065236 3300006871 Bacteria 3626
117 Ga0075436_100008760 3300006914 Bacteria 6918
118 Ga0075436_100049534 3300006914 Bacteria 2899
119 Ga0097620_100080265 3300006931 Bacteria 3303
120 Ga0075435_100101881 3300007076 Bacteria 2379
121 Ga0105251_10025457 3300009011 Bacteria 3026
122 Ga0105240_10026513 3300009093 Bacteria 7604
123 Ga0105240_10041350 3300009093 Bacteria 5884
124 Ga0111539_10351140 3300009094 Bacteria 1716
125 Ga0105245_10030429 3300009098 Bacteria 4773
126 Ga0105245_10070476 3300009098 Bacteria 3172
127 Ga0105245_10185072 3300009098 Bacteria 1992
128 Ga0105245_10759657 3300009098 Bacteria 1006
129 Ga0105247_10066254 3300009101 Bacteria 2248
130 Ga0114129_10604466 3300009147 Bacteria 1420
131 Ga0105243_10030161 3300009148 Bacteria 4174
132 Ga0105241_10005705 3300009174 Bacteria 9189
133 Ga0105241_10079582 3300009174 Bacteria 2563
134 Ga0105242_10061684 3300009176 Bacteria 3084
135 Ga0105248_10134950 3300009177 Bacteria 2784
136 Ga0105237_10068044 3300009545 Bacteria 3555
137 Ga0105237_10112538 3300009545 Bacteria 2714
138 Ga0105238_10005562 3300009551 Bacteria 12449
139 Ga0105238_10015166 3300009551 Bacteria 7802
140 Ga0105249_10154668 3300009553 Bacteria 2211
141 Ga0105249_10236978 3300009553 Bacteria 1802
142 Ga0105239_10022803 3300010375 Bacteria 6901
143 Ga0105239_10030197 3300010375 Bacteria 5959
144 Ga0105239_10061573 3300010375 Bacteria 4119
145 Ga0105239_10201567 3300010375 Bacteria 2229
146 Ga0105239_10246944 3300010375 Bacteria 2004
147 Ga0105246_10006169 3300011119 Bacteria 7315
148 Ga0105246_10164679 3300011119 Bacteria 1692
149 Ga0105246_10218187 3300011119 Bacteria 1493
150 Ga0157316_1003708 3300012510 Bacteria 1118
151 Ga0157370_10012471 3300013104 Bacteria 8809
152 Ga0157369_10087271 3300013105 Bacteria 3331
153 Ga0157374_10045210 3300013296 Bacteria 4075
154 Ga0163162_10089104 3300013306 Bacteria 3166
155 Ga0163162_10443199 3300013306 Bacteria 1431
156 Ga0157372_10263811 3300013307 Bacteria 2000
157 Ga0157372_10754354 3300013307 Bacteria 1131
158 Ga0157375_10177508 3300013308 Bacteria 2280
159 Ga0163163_10030377 3300014325 Bacteria 5206
160 Ga0163163_10066561 3300014325 Bacteria 3579
161 Ga0163163_10078997 3300014325 Bacteria 3288
162 Ga0182008_10072215 3300014497 Bacteria 1698
163 Ga0157377_10109951 3300014745 Bacteria 1655
164 Ga0157379_10124798 3300014968 Bacteria 2316
165 Ga0157376_10104693 3300014969 Bacteria 2480
166 Ga0182006_1027380 3300015261 Bacteria 2327
167 Ga0206356_11202692 3300020070 Bacteria 1320
168 Ga0206353_10492257 3300020082 Bacteria 2718
169 Ga0206353_11116635 3300020082 Bacteria 2996
170 Ga0213875_10001607 3300021388 Bacteria 14297
171 Ga0213875_10012138 3300021388 Bacteria 4261
172 Ga0213875_10079050 3300021388 Bacteria 1534
173 Ga0213871_10026807 3300021441 Bacteria 1477
174 Ga0209026_1000032 3300025250 Bacteria 322378
175 Ga0209759_1000142 3300025256 Bacteria 124090
176 Ga0209233_1000030 3300025261 Bacteria 636702
177 Ga0209233_1009633 3300025261 Bacteria 2933
178 Ga0207713_1014372 3300025735 Bacteria 4118
179 Ga0207692_10005119 3300025898 Bacteria 5231
180 Ga0207692_10007113 3300025898 Bacteria 4573
181 Ga0207692_10010180 3300025898 Bacteria 3955
182 Ga0207692_10053560 3300025898 Bacteria 2056
183 Ga0207710_10001149 3300025900 Bacteria 13486
184 Ga0207647_10005873 3300025904 Bacteria 8946
185 Ga0207685_10004995 3300025905 Bacteria 3446
186 Ga0207699_10001920 3300025906 Bacteria 9798
187 Ga0207699_10374379 3300025906 Bacteria 1009
188 Ga0207645_10037731 3300025907 Bacteria 3100
189 Ga0207705_10018366 3300025909 Bacteria 5001
190 Ga0207654_10077909 3300025911 Bacteria 1988
191 Ga0207707_10094608 3300025912 Bacteria 2611
192 Ga0207707_10413448 3300025912 Bacteria 1157
193 Ga0207695_10026753 3300025913 Bacteria 6433
194 Ga0207671_10288687 3300025914 Bacteria 1295
195 Ga0207693_10004498 3300025915 Bacteria 11795
196 Ga0207693_10006034 3300025915 Bacteria 10045
197 Ga0207693_10009769 3300025915 Bacteria 7810
198 Ga0207663_10026882 3300025916 Bacteria 3345
199 Ga0207663_10228336 3300025916 Bacteria 1358
200 Ga0207660_10129825 3300025917 Bacteria 1917
201 Ga0207662_10149627 3300025918 Bacteria 1484
202 Ga0207657_10034662 3300025919 Bacteria 4536
203 Ga0207657_10054719 3300025919 Bacteria 3449
204 Ga0207694_10008304 3300025924 Bacteria 7849
205 Ga0207650_10004278 3300025925 Bacteria 9744
206 Ga0207687_10008663 3300025927 Bacteria 6648
207 Ga0207700_10000884 3300025928 Bacteria 17256
208 Ga0207700_10063123 3300025928 Bacteria 2816
209 Ga0207664_10028839 3300025929 Bacteria 4221
210 Ga0207664_10396407 3300025929 Bacteria 1227
211 Ga0207644_10011873 3300025931 Bacteria 5772
212 Ga0207644_10056747 3300025931 Bacteria 2826
213 Ga0207706_10043327 3300025933 Bacteria 3988
214 Ga0207706_10054929 3300025933 Bacteria 3514
215 Ga0207709_10025546 3300025935 Bacteria 3383
216 Ga0207670_10006927 3300025936 Bacteria 6309
217 Ga0207669_10025973 3300025937 Bacteria 3177
218 Ga0207704_10092321 3300025938 Bacteria 1992
219 Ga0207665_10000996 3300025939 Bacteria 19123
220 Ga0207691_10475398 3300025940 Bacteria 1062
221 Ga0207711_10027773 3300025941 Bacteria 4756
222 Ga0207667_10063594 3300025949 Bacteria 3856
223 Ga0207651_10020536 3300025960 Bacteria 3989
224 Ga0207712_10049036 3300025961 Bacteria 2940
225 Ga0207712_10309000 3300025961 Bacteria 1300
226 Ga0207658_10009968 3300025986 Bacteria 6457
227 Ga0207703_10079032 3300026035 Bacteria 2735
228 Ga0207639_10282780 3300026041 Bacteria 1460
229 Ga0207678_10016681 3300026067 Bacteria 6450
230 Ga0207678_10112700 3300026067 Bacteria 2320
231 Ga0207678_10413604 3300026067 Bacteria 1169
232 Ga0207702_10220404 3300026078 Bacteria 1768
233 Ga0207702_10268115 3300026078 Bacteria 1610
234 Ga0207641_10012369 3300026088 Bacteria 7001
235 Ga0207648_10483688 3300026089 Bacteria 1131
236 Ga0207676_10008443 3300026095 Bacteria 7323
237 Ga0207674_10275389 3300026116 Bacteria 1631
238 Ga0207675_100016232 3300026118 Bacteria 6951
239 Ga0207675_100177464 3300026118 Bacteria 2038
240 Ga0207675_100235960 3300026118 Bacteria 1766
241 Ga0207683_10003153 3300026121 Bacteria 14397
242 Ga0207683_10056939 3300026121 Bacteria 3430
243 Ga0207698_10058439 3300026142 Bacteria 2989
244 Ga0207698_10090301 3300026142 Bacteria 2505
245 Ga0268266_10003978 3300028379 Bacteria 14334
246 Ga0268266_10019048 3300028379 Bacteria 5846
247 Ga0268266_10131554 3300028379 Bacteria 2238
248 Ga0268266_10152584 3300028379 Bacteria 2084
249 Ga0268265_10035234 3300028380 Bacteria 3655
250 Ga0268265_10586000 3300028380 Bacteria 1064
251 Ga0268264_10016368 3300028381 Bacteria 6071
252 Ga0265337_1001512 3300028556 Bacteria 11408
253 Ga0265338_10018836 3300028800 Bacteria 7363
254 Ga0265338_10030205 3300028800 Bacteria 5347
255 Ga0265313_10007874 3300031595 Bacteria 7182
256 Ga0307508_10085557 3300031616 Bacteria 2736
257 Ga0316579_10024534 3300031691 Bacteria 2716
258 Ga0265314_10071571 3300031711 Bacteria 2319
259 Ga0265314_10108940 3300031711 Bacteria 1764
260 Ga0307413_10013520 3300031824 Bacteria 4108
261 Ga0307410_10379299 3300031852 Bacteria 1137
262 Ga0307410_10396523 3300031852 Bacteria 1114
263 Ga0307407_10304197 3300031903 Bacteria 1113
264 Ga0307407_10427340 3300031903 Bacteria 956
265 Ga0307412_10052877 3300031911 Bacteria 2691
266 Ga0307409_100124461 3300031995 Bacteria 2190
267 Ga0307409_100128668 3300031995 Bacteria 2159
268 Ga0307409_100203465 3300031995 Bacteria 1773
269 Ga0307416_100220795 3300032002 Bacteria 1817
270 Ga0307416_101126389 3300032002 Bacteria 890
271 Ga0307415_100094346 3300032126 Bacteria 2175
272 Ga0307415_100096430 3300032126 Bacteria 2155
273 Ga0307510_10113650 3300033180 Bacteria 2440
274 Ga0373930_0009127 3300034816 Bacteria 1749
275 Ga0373930_0021193 3300034816 Bacteria 1274
276 Ga0373948_0022159 3300034817 Bacteria 1223
277 Ga0373959_0025617 3300034820 Bacteria 1160
278 Ga0373938_0029931 3300034957 Bacteria 1159
279 Ga0373926_0071044 3300035083 Bacteria 1279
280 Ga0373926_0133000 3300035083 Bacteria 942
281 Ga0373928_0032971 3300035084 Bacteria 1157
282 Ga0373940_0062743 3300035088 Bacteria 1067
283 Ga0373944_0013917 3300035089 Bacteria 2239
284 Ga0373944_0036829 3300035089 Bacteria 1496
285 Ga0373949_0019193 3300035090 Bacteria 1555
286 Ga0373951_0013595 3300035091 Bacteria 1829
287 Ga0373952_0022384 3300035092 Bacteria 1342
288 Ga0373923_0072157 3300035111 Bacteria 1484
289 Ga0373932_0008124 3300035112 Bacteria 2505
290 Ga0373936_0128024 3300035113 Bacteria 1089
291 Ga0373939_0000595 3300035114 Bacteria 9020
292 Ga0373939_0008360 3300035114 Bacteria 2536
293 Ga0373941_0024519 3300035115 Bacteria 1733
294 Ga0373954_0005645 3300035118 Bacteria 5420
295 Ga0373954_0009134 3300035118 Bacteria 4362
296 Ga0373954_0035220 3300035118 Bacteria 2321
297 Ga0373956_0017690 3300035119 Bacteria 3010
298 Ga0373957_0072477 3300035120 Unclassified 1349
299 Ga0373957_0075762 3300035120 Bacteria 1322
300 Ga0373943_0014695 3300035170 Bacteria 3550
301 Ga0373943_0058322 3300035170 Bacteria 1921
302 Ga0373943_0164217 3300035170 Bacteria 1211
303 Ga0373955_0003027 3300035172 Bacteria 7369
304 Ga0373955_0007627 3300035172 Bacteria 4985
305 Ga0373955_0007756 3300035172 Bacteria 4946
306 Ga0373924_0005315 3300035410 Bacteria 4554
307 Ga0373924_0080189 3300035410 Bacteria 1387
308 Ga0373931_0052368 3300035691 Bacteria 2176
309 Ga0373931_0167389 3300035691 Bacteria 1292
310 Ga0373935_0016511 3300035692 Bacteria 4466
311 Ga0373935_0035975 3300035692 Bacteria 3093
312 Ga0373935_0077427 3300035692 Bacteria 2155
313 Ga0373935_0175544 3300035692 Bacteria 1468
314 Ga0373935_0204050 3300035692 Bacteria 1367
315 Ga0373927_0020566 3300035695 Bacteria 4328
316 Ga0373927_0067623 3300035695 Bacteria 2312
317 Ga0373933_0007683 3300035724 Bacteria 5888
318 Ga0373933_0008207 3300035724 Bacteria 5701
319 Ga0373933_0034906 3300035724 Bacteria 2934
320 Ga0373933_0042484 3300035724 Bacteria 2687
321 Ga0373933_0087061 3300035724 Bacteria 1923
322 Ga0373947_0045098 3300035725 Bacteria 2638
323 Ga0373947_0046308 3300035725 Bacteria 2604
324 Ga0373937_0000824 3300036401 Bacteria 26565
325 Ga0373937_0003327 3300036401 Bacteria 13492
326 Ga0373937_0005428 3300036401 Bacteria 10911
327 Ga0373937_0020693 3300036401 Bacteria 5901
328 Ga0373937_0035947 3300036401 Bacteria 4512
329 Ga0373937_0043962 3300036401 Bacteria 4079
330 Ga0373937_0206769 3300036401 Bacteria 1846
331 Ga0373937_0406378 3300036401 Bacteria 1292
332 Ga0373937_0636318 3300036401 Unclassified 1012
333 Ga0373925_0009860 3300037068 Bacteria 6939
334 Ga0373925_0020221 3300037068 Bacteria 4844
335 Ga0373925_0046337 3300037068 Bacteria 3233
336 Ga0373925_0121310 3300037068 Bacteria 2029
337 Ga0373925_0203128 3300037068 Bacteria 1576
338 Ga0373925_0546680 3300037068 Bacteria 952
339 Ga0395899_0000058 3300037312 Bacteria 213049
340 Ga0395899_0002233 3300037312 Bacteria 15864
341 Ga0395899_0078551 3300037312 Bacteria 2405
342 Ga0395900_0001351 3300037418 Bacteria 29638
343 Ga0395900_0043962 3300037418 Bacteria 4604
344 Ga0395900_0144680 3300037418 Bacteria 2432
345 Ga0395900_0228201 3300037418 Bacteria 1874
346 Ga0395900_0258646 3300037418 Bacteria 1739
347 Ga0395898_0014184 3300037466 Bacteria 8194
348 Ga0395898_0016934 3300037466 Bacteria 7441
349 Ga0395898_0021905 3300037466 Bacteria 6473
350 Ga0395898_0038675 3300037466 Bacteria 4727
351 Ga0395905_0263078 3300037471 Bacteria 1610
352 Ga0395905_0459597 3300037471 Bacteria 1171
353 Ga0436364_0127534 3300037853 Bacteria 4097
354 Ga0436364_0335466 3300037853 Bacteria 1895
355 Ga0436364_0341381 3300037853 Bacteria 15601
356 Ga0436364_0534960 3300037853 Bacteria 1060
357 Ga0436364_0716978 3300037853 Bacteria 4965
358 Ga0436364_1095010 3300037853 Bacteria 1263
359 Ga0436364_1179675 3300037853 Bacteria 7860
360 Ga0436364_1505086 3300037853 Bacteria 23518
361 Ga0436364_1513145 3300037853 Bacteria 16116
362 Ga0395901_0013773 3300038443 Bacteria 8221
363 Ga0395901_0015782 3300038443 Bacteria 7696
364 Ga0395901_0044071 3300038443 Bacteria 4627
365 Ga0395901_0131108 3300038443 Bacteria 2634
366 Ga0436365_0209418 3300039437 Bacteria 1799
367 Ga0436365_0686558 3300039437 Bacteria 2799
368 Ga0436365_0696682 3300039437 Bacteria 2067
369 Ga0436365_1151479 3300039437 Bacteria 9186
370 Ga0436365_1658787 3300039437 Bacteria 3409
371 Ga0436360_0023402 3300039438 Bacteria 3422
372 Ga0436360_0314979 3300039438 Bacteria 1486
373 Ga0436360_0394148 3300039438 Bacteria 6296
374 Ga0436360_1044519 3300039438 Bacteria 2578
375 Ga0436361_0582741 3300039447 Bacteria 1535
376 Ga0436363_0329936 3300039450 Bacteria 1735
377 Ga0436363_0678607 3300039450 Bacteria 1648
378 Ga0436363_1347707 3300039450 Bacteria 1307
379 Ga0436362_0749915 3300039453 Bacteria 1522
380 Ga0436362_1078251 3300039453 Bacteria 3010
381 Ga0466972_0030800 3300044658 Bacteria 2641
382 Ga0466965_0112551 3300044683 Bacteria 1400
383 Ga0466965_0133181 3300044683 Bacteria 1290
384 Ga0466966_0048885 3300044684 Bacteria 2694
385 Ga0466961_0069813 3300044693 Bacteria 2230
386 Ga0466961_0177552 3300044693 Bacteria 1323
387 Ga0466963_0151206 3300044694 Bacteria 1612
388 Ga0466963_0232437 3300044694 Bacteria 1292
389 Ga0466963_0272778 3300044694 Bacteria 1188
390 Ga0466963_0319368 3300044694 Bacteria 1093
391 Ga0466971_0052565 3300044719 Bacteria 1835
392 Ga0466968_0042004 3300044735 Bacteria 1932
393 Ga0466970_0211593 3300044765 Bacteria 1080
394 Ga0466957_0301227 3300044842 Bacteria 1077
395 Ga0466960_0065737 3300044901 Bacteria 1792
396 Ga0466960_0066169 3300044901 Bacteria 1786
397 Ga0466960_0067827 3300044901 Bacteria 1768
398 Ga0466960_0302647 3300044901 Bacteria 901
399 Ga0466959_0093137 3300045049 Bacteria 2162
400 Ga0466959_0103152 3300045049 Bacteria 2041
401 Ga0466959_0106141 3300045049 Bacteria 2008
402 Ga0466967_0038125 3300045976 Bacteria 4119
403 Ga0466967_0091230 3300045976 Bacteria 2768
404 Ga0466967_0211600 3300045976 Bacteria 1839
405 Ga0466967_0673365 3300045976 Bacteria 1024
406 Ga0495592_0016974 3300046454 Bacteria 5526
407 Ga0495592_0019964 3300046454 Bacteria 5094
408 Ga0495592_0176742 3300046454 Unclassified 1457
409 Ga0495592_0234065 3300046454 Bacteria 1222
410 Ga0495603_0046352 3300046455 Bacteria 2591
411 Ga0495629_0006816 3300046459 Bacteria 8445
412 Ga0495638_0021151 3300046460 Bacteria 4291
413 Ga0495641_0118462 3300046461 Bacteria 1181
414 Ga0495651_0010286 3300046462 Bacteria 7188
415 Ga0495651_0051025 3300046462 Bacteria 3191
416 Ga0495651_0088366 3300046462 Bacteria 2329
417 Ga0495653_0064776 3300046463 Bacteria 2753
418 Ga0495653_0128709 3300046463 Bacteria 1795
419 Ga0495580_0083844 3300046472 Bacteria 2220
420 Ga0495639_0109221 3300046475 Bacteria 1311
421 Ga0495664_0005387 3300046477 Bacteria 7023
422 Ga0495664_0151921 3300046477 Bacteria 1404
423 Ga0495664_0194775 3300046477 Bacteria 1228
424 Ga0495594_0065426 3300046499 Bacteria 2016
425 Ga0495606_0213347 3300046507 Bacteria 1092
426 Ga0495608_0133658 3300046511 Bacteria 1586
427 Ga0495608_0143047 3300046511 Bacteria 1526
428 Ga0495608_0230235 3300046511 Bacteria 1160
429 Ga0495628_0002495 3300046516 Bacteria 16570
430 Ga0495628_0189170 3300046516 Bacteria 1555
431 Ga0495643_0020016 3300046522 Bacteria 3865
432 Ga0495640_0054279 3300046533 Bacteria 2745
433 Ga0495640_0126671 3300046533 Bacteria 1656
434 Ga0495587_0015685 3300046536 Bacteria 4726
435 Ga0495587_0025425 3300046536 Bacteria 3618
436 Ga0495587_0050288 3300046536 Bacteria 2466
437 Ga0495645_0039395 3300046543 Bacteria 3446
438 Ga0495667_0005423 3300046559 Bacteria 8621
439 Ga0495667_0007799 3300046559 Bacteria 7249
440 Ga0495667_0029059 3300046559 Bacteria 3721
441 Ga0495667_0063057 3300046559 Bacteria 2427
442 Ga0495667_0123470 3300046559 Bacteria 1671
443 Ga0495667_0329835 3300046559 Bacteria 965
444 Ga0495634_0055785 3300046642 Bacteria 2641
445 Ga0495635_0013367 3300046663 Bacteria 5745
446 Ga0495635_0014990 3300046663 Bacteria 5422
447 Ga0495635_0117174 3300046663 Bacteria 1817
448 Ga0495588_0301765 3300046674 Bacteria 843
449 Ga0495657_0007004 3300046675 Bacteria 8746
450 Ga0495657_0117051 3300046675 Bacteria 1682
451 Ga0495657_0121432 3300046675 Bacteria 1645
452 Ga0495599_0015899 3300046678 Bacteria 4670
453 Ga0495599_0071204 3300046678 Bacteria 2170
454 Ga0495623_0339024 3300046679 Bacteria 821
455 Ga0495646_0007579 3300046680 Bacteria 6898
456 Ga0495646_0205501 3300046680 Bacteria 1071
457 Ga0495658_0000857 3300046683 Bacteria 16367
458 Ga0495658_0182417 3300046683 Bacteria 1303
459 Ga0495613_0005530 3300046689 Bacteria 9485
460 Ga0495613_0199293 3300046689 Bacteria 1412
461 Ga0495604_0007736 3300047317 Bacteria 8512
462 Ga0495604_0029158 3300047317 Bacteria 4390
463 Ga0495604_0052727 3300047317 Bacteria 3148
464 Ga0495604_0064971 3300047317 Bacteria 2779
465 Ga0495604_0196319 3300047317 Bacteria 1403
466 Ga0495674_0042794 3300047319 Bacteria 4037
467 Ga0495674_0116521 3300047319 Bacteria 2260
468 Ga0495676_0062701 3300047321 Bacteria 2901
469 Ga0495676_0082339 3300047321 Bacteria 2436
470 Ga0495680_0007406 3300047322 Bacteria 10066
471 Ga0495680_0019787 3300047322 Bacteria 5676
472 Ga0495680_0155661 3300047322 Bacteria 1663
473 Ga0495680_0164646 3300047322 Bacteria 1608
474 Ga0495687_033246 3300047443 Bacteria 2342
475 Ga0495675_0008439 3300047444 Bacteria 6383
476 Ga0495679_094254 3300047446 Bacteria 837
477 Ga0495684_0072882 3300047471 Bacteria 2609
478 Ga0495684_0147958 3300047471 Bacteria 1758
479 Ga0495684_0249205 3300047471 Bacteria 1293
480 Ga0495684_0266262 3300047471 Bacteria 1241
481 Ga0495593_0073081 3300047673 Bacteria 1779
482 Ga0495602_0007703 3300048088 Bacteria 11258
483 Ga0495602_0008247 3300048088 Bacteria 10879
484 Ga0495602_0040749 3300048088 Bacteria 4253
485 Ga0495602_0056229 3300048088 Bacteria 3461
486 Ga0495614_0227468 3300048089 Bacteria 849
487 Ga0495626_0146227 3300048091 Bacteria 999
488 Ga0496100_0010727 3300048903 Bacteria 5195
489 Ga0496100_0016956 3300048903 Bacteria 4287
490 Ga0496101_0030950 3300048904 Bacteria 3757
491 Ga0496102_0004469 3300048905 Bacteria 11799
492 Ga0496102_0054690 3300048905 Bacteria 3640
493 Ga0496102_0093976 3300048905 Bacteria 2778
494 Ga0496102_0144634 3300048905 Bacteria 2231
495 Ga0496102_0183389 3300048905 Bacteria 1972
496 Ga0496102_0229204 3300048905 Bacteria 1751
497 Ga0496102_0283571 3300048905 Bacteria 1561
498 Ga0496102_0300223 3300048905 Bacteria 1513
499 Ga0496103_0007284 3300048906 Bacteria 6593
500 Ga0496103_0116220 3300048906 Bacteria 1702
501 Ga0496104_0000055 3300048907 Bacteria 124267
502 Ga0496104_0003540 3300048907 Bacteria 13466
503 Ga0496104_0008257 3300048907 Bacteria 9245
504 Ga0496104_0435682 3300048907 Bacteria 1223
505 Ga0496105_0000797 3300048908 Bacteria 21298
506 Ga0496105_0012262 3300048908 Bacteria 6786
507 Ga0496105_0020421 3300048908 Bacteria 5352
508 Ga0496105_0115646 3300048908 Bacteria 2212
509 Ga0496107_0015062 3300048910 Bacteria 5417
510 Ga0496107_0024577 3300048910 Bacteria 4262
511 Ga0496108_0002024 3300048911 Bacteria 16234
512 Ga0496108_0004408 3300048911 Bacteria 11325
513 Ga0496108_0121897 3300048911 Bacteria 2237
514 Ga0496109_0001887 3300048912 Bacteria 17391
515 Ga0496109_0017110 3300048912 Bacteria 6346
516 Ga0496109_0050361 3300048912 Bacteria 3793
517 Ga0496109_0075889 3300048912 Bacteria 3090
518 Ga0496110_0004828 3300048913 Bacteria 10504
519 Ga0496110_0303778 3300048913 Bacteria 1453
520 Ga0496110_0311797 3300048913 Bacteria 1433
521 Ga0496111_0001458 3300048914 Bacteria 13525
522 Ga0496111_0082817 3300048914 Bacteria 2343
523 Ga0496111_0138127 3300048914 Bacteria 1806
524 Ga0496112_0008278 3300048915 Bacteria 9305
525 Ga0496112_0026418 3300048915 Bacteria 5586
526 Ga0496112_0152710 3300048915 Bacteria 2276
527 Ga0496113_0008064 3300048916 Bacteria 6834
528 Ga0496113_0011316 3300048916 Bacteria 5946
529 Ga0496113_0020314 3300048916 Bacteria 4667
530 Ga0496113_0080341 3300048916 Bacteria 2498
531 Ga0496114_0078664 3300048917 Bacteria 2782
532 Ga0496114_0211875 3300048917 Bacteria 1699
533 Ga0496115_0039056 3300048918 Bacteria 3769
534 Ga0496115_0071180 3300048918 Bacteria 2820
535 Ga0496115_0077469 3300048918 Bacteria 2703
536 Ga0496115_0293493 3300048918 Bacteria 1333
537 Ga0496117_0053718 3300048920 Bacteria 2829
538 Ga0496119_0000344 3300048922 Bacteria 65097
539 Ga0496119_0002572 3300048922 Bacteria 19717
540 Ga0496121_0166975 3300048924 Bacteria 1603
541 Ga0496122_0011879 3300048925 Bacteria 8749
542 Ga0496123_0005458 3300048926 Bacteria 12799
543 Ga0496124_0158266 3300048927 Bacteria 1769
544 Ga0501031_0000166 3300049568 Bacteria 37199
545 Ga0501031_0025653 3300049568 Bacteria 3844
546 Ga0501031_0130464 3300049568 Bacteria 1642
547 Ga0501031_0156460 3300049568 Bacteria 1490
548 Ga0501032_0000384 3300049569 Bacteria 36492
549 Ga0501032_0005222 3300049569 Bacteria 9665
550 Ga0501033_0000511 3300049570 Bacteria 36490
551 Ga0501033_0034340 3300049570 Bacteria 3806
552 Ga0501033_0036461 3300049570 Bacteria 3685
553 Ga0501033_0072778 3300049570 Bacteria 2523
554 Ga0501033_0073043 3300049570 Bacteria 2518
555 Ga0501034_0001159 3300049571 Bacteria 36532
556 Ga0501034_0001769 3300049571 Bacteria 27612
557 Ga0501034_0041858 3300049571 Bacteria 4635
558 Ga0501034_0278589 3300049571 Bacteria 1612
559 Ga0501034_0471844 3300049571 Bacteria 1171
560 Ga0501036_0000248 3300049572 Bacteria 36490
561 Ga0501037_0000389 3300049573 Bacteria 36523
562 Ga0501037_0020819 3300049573 Bacteria 4842
563 Ga0501037_0045208 3300049573 Bacteria 3232
564 Ga0501037_0045725 3300049573 Bacteria 3213
565 Ga0501038_0000433 3300049574 Bacteria 36490
566 Ga0501038_0060799 3300049574 Bacteria 3232
567 Ga0501038_0099584 3300049574 Bacteria 2423
568 Ga0501039_0000279 3300049575 Bacteria 36490
569 Ga0501039_0175451 3300049575 Bacteria 1685
570 Ga0501040_0015093 3300049576 Bacteria 5104
571 Ga0501042_0108850 3300049578 Bacteria 1995
572 Ga0501043_0000452 3300049579 Bacteria 36530
573 Ga0501043_0057397 3300049579 Bacteria 3057
574 Ga0501043_0174320 3300049579 Bacteria 1677
575 Ga0501047_0000677 3300049581 Bacteria 35497
576 Ga0501047_0074907 3300049581 Bacteria 3258
577 Ga0501047_0128563 3300049581 Bacteria 2413
578 Ga0501047_0182779 3300049581 Bacteria 1963
579 Ga0501047_0827165 3300049581 Bacteria 740
580 Ga0501048_0004698 3300049582 Bacteria 10399
581 Ga0501067_0009463 3300049583 Bacteria 5399
582 Ga0501067_0018832 3300049583 Bacteria 3821
583 Ga0501068_0003218 3300049584 Bacteria 8747
584 Ga0501069_0135635 3300049585 Bacteria 1411
585 Ga0501069_0241699 3300049585 Bacteria 1052
586 Ga0501070_0032726 3300049586 Bacteria 4350
587 Ga0501070_0043124 3300049586 Bacteria 3755
588 Ga0501070_0154614 3300049586 Bacteria 1892
589 Ga0501071_0069902 3300049587 Bacteria 2557
590 Ga0501071_0170165 3300049587 Bacteria 1631
591 Ga0501072_0004195 3300049588 Bacteria 10925
592 Ga0501073_0025687 3300049589 Bacteria 4221
593 Ga0501073_0038639 3300049589 Bacteria 3384
594 Ga0501073_0066587 3300049589 Bacteria 2511
595 Ga0501074_0044730 3300049590 Bacteria 3204
596 Ga0501074_0093956 3300049590 Bacteria 2148
597 Ga0501074_0130257 3300049590 Bacteria 1800
598 Ga0501080_0044678 3300049742 Bacteria 4124
599 Ga0501080_0485492 3300049742 Bacteria 1105
600 Ga0501080_0698425 3300049742 Bacteria 895
601 Ga0501083_0046096 3300049744 Bacteria 2948
602 Ga0501083_0067811 3300049744 Bacteria 2374
603 Ga0501083_0086999 3300049744 Bacteria 2067
604 Ga0501083_0309078 3300049744 Bacteria 1028
605 Ga0501035_0000651 3300049822 Bacteria 38225
606 Ga0501035_0064636 3300049822 Bacteria 3251
607 Ga0501044_0000862 3300049823 Bacteria 36490
608 Ga0501044_0019854 3300049823 Bacteria 7177
609 Ga0501044_0025214 3300049823 Bacteria 6305
610 Ga0501044_0056088 3300049823 Bacteria 4045
611 Ga0501044_0211761 3300049823 Bacteria 1892
612 Ga0501044_0278927 3300049823 Bacteria 1605
613 Ga0501045_0018395 3300049824 Bacteria 4970
614 nmdc:mga03683_47570_c1 3300050489 Bacteria 1780
615 nmdc:mga03n38_16303_c1 3300050490 Bacteria 2888
616 nmdc:mga00v17_114749_c1 3300050491 Bacteria 1711
617 nmdc:mga00v17_16996_c1 3300050491 Bacteria 4109
618 nmdc:mga00v17_37745_c1 3300050491 Bacteria 2886
619 nmdc:mga0yw44_153322_c1 3300050492 Bacteria 1504
620 nmdc:mga0yw44_20790_c1 3300050492 Bacteria 3649
621 nmdc:mga0yw44_8593_c1 3300050492 Bacteria 5099
622 nmdc:mga0yw44_99598_c1 3300050492 Bacteria 1849
623 nmdc:mga0k408_28578_c1 3300050493 Bacteria 3171
624 nmdc:mga06z11_38624_c1 3300050494 Bacteria 2372
625 nmdc:mga06z11_659_c1 3300050494 Bacteria 11138
626 nmdc:mga07m45_267935_c1 3300050496 Bacteria 994
627 nmdc:mga05p37_4816_c1 3300050507 Bacteria 15790
628 nmdc:mga06r32_209654_c1 3300050510 Bacteria 1936
629 nmdc:mga06r32_99192_c1 3300050510 Bacteria 2856
630 nmdc:mga0n895_103856_c1 3300050512 Bacteria 2854
631 nmdc:mga0n895_42236_c1 3300050512 Bacteria 4436
632 nmdc:mga0rr50_205118_c1 3300050513 Bacteria 1622
633 nmdc:mga0rr50_24524_c1 3300050513 Bacteria 4178
634 nmdc:mga08x19_9716_c1 3300050514 Bacteria 5760
635 nmdc:mga0a205_86288_c1 3300050515 Bacteria 3031
636 nmdc:mga0sz30_16451_c1 3300050516 Bacteria 2938
637 nmdc:mga0sz30_76197_c1 3300050516 Bacteria 1448
638 Ga0495601_0004059 3300053077 Bacteria 8442
639 Ga0495601_0005636 3300053077 Bacteria 7300
640 Ga0495601_0016725 3300053077 Bacteria 4447
641 Ga0495612_0001521 3300053078 Bacteria 9544
642 Ga0495612_0002491 3300053078 Bacteria 7590
643 Ga0495612_0015912 3300053078 Bacteria 3014
644 Ga0495612_0030188 3300053078 Bacteria 2184
645 Ga0495612_0046200 3300053078 Bacteria 1783
646 Ga0495595_0000380 3300053084 Bacteria 16825
647 Ga0495595_0007849 3300053084 Bacteria 4371
648 Ga0495619_0000085 3300053085 Bacteria 70073
649 Ga0495619_0000442 3300053085 Bacteria 27859
650 Ga0495619_0000536 3300053085 Bacteria 25079
651 Ga0495619_0011298 3300053085 Bacteria 5618
652 Ga0495619_0020082 3300053085 Bacteria 4251
653 Ga0495619_0061326 3300053085 Bacteria 2502
654 Ga0500556_0000122 3300053104 Bacteria 67150
655 Ga0500593_000036 3300053117 Bacteria 47889
656 Ga0500568_0000002 3300053139 Bacteria 880601
657 Ga0500568_0000104 3300053139 Bacteria 78075
658 Ga0500604_0079305 3300053151 Bacteria 1058
659 Ga0500620_021403 3300053155 Bacteria 1932
660 Ga0501084_0037737 3300054114 Bacteria 4038
661 Ga0501084_0054562 3300054114 Bacteria 3343
662 Ga0501084_0282195 3300054114 Bacteria 1402
663 Ga0501082_0000032 3300060353 Bacteria 99261
664 Ga0466962_0032763 3300061719 Bacteria 2487
665 Ga0466962_0050053 3300061719 Bacteria 1997
666 Ga0466962_0050886 3300061719 Bacteria 1981
667 2503199165 2503198000 Bacteria 6884444
668 2509116541 2508501123 Bacteria 6283661
669 2509144290 2508501127 Bacteria 7037543
670 2509372515 2509276018 Bacteria 6910194
671 2509394105 2509276022 Bacteria 6200534
672 2512933440 2512875016 Bacteria 6529530
673 2512961556 2512875024 Bacteria 7195110
674 2513613342 2513237090 Bacteria 7096802
675 2514036841 2513237164 Bacteria 7563725
676 2514418131 2513237305 Bacteria 7293571
677 2514586908 2513237351 Bacteria 6968952
678 2523467409 2523231067 Bacteria 5230452
679 2526063588 2524614857 Bacteria 4146328
680 2545675643 2545555834 Bacteria 8130841
681 2588519511 2588253730 Bacteria 6881675
682 2596375007 2595698237 Bacteria 6712432
683 2597811787 2597489875 Bacteria 7010078
684 2599937050 2599185301 Bacteria 6161860
685 2623500983 2622736605 Bacteria 4992138
686 2643777471 2643221551 Bacteria 3750538
687 2643795919 2643221555 Bacteria 3749717
688 2688596450 2687453392 Bacteria 6880454
689 2694630130 2693429783 Bacteria 7019804
690 2723573540 2721755686 Bacteria 7343952
691 2739306137 2738543024 Bacteria 5603683
692 2739347852 2738543031 Bacteria 5769731
693 2740061938 2739367875 Bacteria 4157290
694 2828308722 2828305725 Bacteria 4916900
695 2837682524 2837678835 Bacteria 5252418
696 2841736871 2841734538 Bacteria 6784580
697 2842336437 2842333319 Bacteria 8899485
698 2842702458 2842698319 Bacteria 5190321
699 2842777744 2842775625 Bacteria 5587290
700 2844011276 2844009547 Bacteria 6728125
701 2847673855 2847670302 Bacteria 6165597
702 2847690350 2847686936 Bacteria 6278406
703 2856320494 2856314179 Bacteria 6477897
704 2856327308 2856320880 Bacteria 7263508
705 2856328405 2856328259 Bacteria 6528202
706 2856338593 2856334872 Bacteria 7037011
707 2856344591 2856342000 Bacteria 7176905
708 2856350841 2856349417 Bacteria 6230045
709 2856356739 2856356410 Bacteria 6297484
710 2856364963 2856364286 Bacteria 6939991
711 2857353347 2857349434 Bacteria 7926032
712 2857373407 2857367948 Bacteria 6965560
713 2869174427 2869169390 Bacteria 6659796
714 2869235963 2869234852 Bacteria 6654993
715 2869244428 2869242130 Bacteria 6609239
716 2869254069 2869249662 Bacteria 6868783
717 2869257182 2869256925 Bacteria 6981691
718 2869266410 2869264136 Bacteria 6880765
719 2869273102 2869271264 Bacteria 6908218
720 2869279465 2869278585 Bacteria 7077053
721 2869286412 2869285874 Bacteria 6901219
722 2871430381 2871429161 Bacteria 6547891
723 2871440122 2871435913 Bacteria 6880295
724 2871450556 2871444079 Bacteria 6423508
725 2871452074 2871451962 Bacteria 7336357
726 2871477133 2871474448 Bacteria 6806570
727 2871483774 2871481445 Bacteria 6700002
728 2871494809 2871488783 Bacteria 6929816
729 2874102889 2874102143 Bacteria 6342645
730 2874116329 2874109183 Bacteria 6517025
731 2874119661 2874116593 Bacteria 6674494
732 2874130188 2874123672 Bacteria 7238285
733 2874135960 2874131515 Bacteria 6820270
734 2874139544 2874139085 Bacteria 7021506
735 2874146799 2874146452 Bacteria 7533118
736 2874155872 2874155637 Bacteria 6724144
737 2874165497 2874162495 Bacteria 6174670
738 2874176710 2874168670 Bacteria 8062617
739 2876364306 2876363079 Bacteria 6544991
740 2876377607 2876369609 Bacteria 6807521
741 2876385159 2876377896 Bacteria 6565995
742 2876386370 2876386047 Bacteria 6698674
743 2876402245 2876399893 Bacteria 6927900
744 2876414201 2876413966 Bacteria 6831344
745 2876421331 2876420981 Bacteria 6687741
746 2878038909 2878035449 Bacteria 6555736
747 2878737036 2878730984 Bacteria 6380721
748 2878741991 2878738818 Bacteria 7136951
749 2878746577 2878745973 Bacteria 6867388
750 2878759942 2878753008 Bacteria 6922523
751 2878765079 2878760144 Bacteria 6823465
752 2878772251 2878767105 Bacteria 6898628
753 2878776494 2878774303 Bacteria 6108671
754 2878785775 2878781027 Bacteria 6834456
755 2881148651 2881147464 Bacteria 7779814
756 2881159730 2881155292 Bacteria 6461656
757 2881165432 2881161766 Bacteria 7127907
758 2881851216 2881845957 Bacteria 6611900
759 2881866955 2881861095 Bacteria 7128710
760 2882640253 2882632389 Bacteria 8154593
761 2882914155 2882912400 Bacteria 6801539
762 2883578302 2883577096 Bacteria 4709178
763 2884299575 2884298095 Bacteria 3823049
764 2885307287 2885305155 Bacteria 7348390
765 2885313673 2885312484 Bacteria 6415165
766 2885322822 2885318864 Bacteria 6729568
767 2885329056 2885326080 Bacteria 7134805
768 2885339364 2885334103 Bacteria 7216818
769 2885343615 2885342637 Bacteria 7011821
770 2885352456 2885350715 Bacteria 6787678
771 2888337126 2888337043 Bacteria 6629336
772 2888344838 2888343758 Bacteria 6611049
773 2888353607 2888350351 Bacteria 7372807
774 2889015327 2889010040 Bacteria 6749192
775 2889019599 2889016732 Bacteria 6700763
776 2891048767 2891048133 Bacteria 4447501
777 2894775621 2894772417 Bacteria 5305674
778 2902411364 2902405164 Bacteria 6784948
779 2903455170 2903448605 Bacteria 7357801
780 2903494167 2903492973 Bacteria 13473544
781 2903499767 2903492973 Bacteria 13473544
782 2903523927 2903521522 Bacteria 6525694
783 2903530426 2903528002 Bacteria 6586099
784 2903545881 2903540706 Bacteria 7062119
785 2906308979 2906308376 Bacteria 6841989
786 2906322259 2906321335 Bacteria 6579571
787 2906333788 2906328253 Bacteria 6585166
788 2906367577 2906363423 Bacteria 6856682
789 2906373810 2906370794 Bacteria 6881062
790 2906390269 2906386501 Bacteria 5977019
791 2906398157 2906393657 Bacteria 6790866
792 2906402686 2906401398 Bacteria 6693206
793 2906409972 2906408224 Bacteria 6162342
794 2906421273 2906414383 Bacteria 6580790
795 2909044198 2909042592 Bacteria 6499737
796 2917554934 2917554339 Bacteria 4987857
797 2919454906 2919450847 Bacteria 5631160
798 2922136709 2922130491 Bacteria 7173936
799 2922157601 2922151315 Bacteria 6902399
800 2922161308 2922158528 Bacteria 6573167
801 2922173562 2922172374 Bacteria 6167644
802 2922183708 2922178524 Bacteria 6025201
803 2922193556 2922185730 Bacteria 7113964
804 2924714556 2924710171 Bacteria 6752351
805 2924725504 2924718760 Bacteria 6331356
806 2924730450 2924726620 Bacteria 6271473
807 2924734412 2924733363 Bacteria 7574837
808 2924744531 2924741084 Bacteria 6661321
809 2924751012 2924748358 Bacteria 6154725
810 2924759883 2924754689 Bacteria 6774424
811 2924765404 2924762789 Bacteria 6561353
812 2924779675 2924776078 Bacteria 7492003
813 2924790747 2924784321 Bacteria 7416538
814 2928129930 2928125067 Bacteria 5937560
815 2929204148 2929199973 Bacteria 7260745
816 2937822319 2937813078 Bacteria 7783518
817 2937826890 2937822353 Bacteria 7290551
818 2937841280 2937836603 Bacteria 6811263
819 2937866204 2937861824 Bacteria 6660327
820 2937873903 2937868953 Bacteria 6639878
821 2937878169 2937877337 Bacteria 7246526
822 2937896331 2937891427 Bacteria 6357007
823 2937972924 2937972304 Bacteria 7532020
824 2937982799 2937980651 Bacteria 6517427
825 2937999735 2937994558 Bacteria 7036190
826 2938022276 2938014810 Bacteria 6700592
827 2958035043 2958034702 Bacteria 6989922
828 2958044074 2958041894 Bacteria 13082850
829 2958057330 2958041894 Bacteria 13082850
830 2958068544 2958064165 Bacteria 7158582
831 2958073147 2958071322 Bacteria 6815895
832 2958085283 2958084443 Bacteria 7312792
833 2958098747 2958092219 Bacteria 6861151
834 2958107667 2958100919 Bacteria 6800575
835 2958110765 2958108152 Bacteria 6681128
836 2958120523 2958115193 Bacteria 6923548
837 2958122947 2958122699 Bacteria 7280457
838 2958130813 2958130278 Bacteria 6897202
839 2958143015 2958137437 Bacteria 6050276
840 2958164045 2958158011 Bacteria 6058449
841 2958170203 2958165035 Bacteria 6906348
842 2958173573 2958172287 Bacteria 6716688
843 2958180151 2958179912 Bacteria 6874908
844 2961077978 2961077736 Bacteria 7079850
845 2961130543 2961127735 Bacteria 7196641
846 2961136925 2961136820 Bacteria 6775228
847 2961168654 2961163497 Bacteria 6901077
848 2961177214 2961170736 Bacteria 7072258
849 2961185207 2961183825 Bacteria 6688536
850 2963645764 2963644680 Bacteria 6530403
851 2965023466 2965018300 Bacteria 6883036
852 2965030939 2965025482 Bacteria 6532201
853 2965032098 2965032056 Bacteria 6887443
854 2965041782 2965040258 Bacteria 6855979
855 2965052175 2965047637 Bacteria 6623551
856 2965062261 2965062239 Bacteria 7412989
857 2965094418 2965089291 Bacteria 6866420
858 2965106301 2965102966 Bacteria 6800987
859 2965125894 2965119406 Bacteria 6956431
860 2968002305 2967996073 Bacteria 6787468
861 2968009539 2968003550 Bacteria 6929263
862 2968023463 2968016561 Bacteria 7022047
863 2968089272 2968083720 Bacteria 7351627
864 2968101939 2968097103 Bacteria 6107094
865 2968122255 2968117919 Bacteria 6536078
866 2968133209 2968128360 Bacteria 6270294
867 2968143041 2968138860 Bacteria 6605449
868 2968177066 2968171901 Bacteria 6894245
869 2970476045 2970469710 Bacteria 6969209
870 2970493732 2970489779 Bacteria 6517260
871 2970509888 2970503327 Bacteria 7099517
872 2970512591 2970510686 Bacteria 7006402
873 2970526563 2970524798 Bacteria 6840927
874 2970537167 2970532167 Bacteria 6553173
875 2970540042 2970540015 Bacteria 6977556
876 2970552343 2970547951 Bacteria 6931819
877 2970559926 2970554993 Bacteria 6814252
878 2970594065 2970593180 Bacteria 7073582
879 2970627209 2970627176 Bacteria 6680862
880 2977828464 2977821940 Bacteria 6906439
881 2977836485 2977828996 Bacteria 7007971
882 2977844185 2977843712 Bacteria 6753583
883 2977857658 2977851361 Bacteria 6694324
884 2977864907 2977858184 Bacteria 6215359
885 2977869779 2977864932 Bacteria 7534097
886 2977878376 2977872689 Bacteria 7270173
887 2977906273 2977898635 Bacteria 6675551
888 2977914183 2977907340 Bacteria 6577984
889 2977922566 2977915119 Bacteria 6829656
890 2977941791 2977935797 Bacteria 6252826
891 2977942319 2977942078 Bacteria 7570577
892 2977954456 2977950692 Bacteria 6893264
893 2977962686 2977957713 Bacteria 6877875
894 2977975117 2977971508 Bacteria 7472917
895 2977991227 2977986579 Bacteria 6581278
896 2979710835 2979710463 Bacteria 6785254
897 2979745545 2979742915 Bacteria 7301278
898 2979770811 2979764755 Bacteria 6610066
899 2979776811 2979772303 Bacteria 6618277
900 2979782398 2979779861 Bacteria 6219781
901 2979794832 2979793036 Bacteria 6808957
902 2979814764 2979808191 Bacteria 7179355
903 2987641940 2987636660 Bacteria 8088555
904 2987646318 2987645492 Bacteria 6117018
905 2987655314 2987652177 Bacteria 6969023
906 2987664683 2987659509 Bacteria 6966464
907 2987669748 2987666974 Bacteria 6509233
908 2987680773 2987673487 Bacteria 6884027
909 2996315310 2996310559 Bacteria 6357320
910 2996346716 2996341866 Bacteria 6643098
911 2996354626 2996348954 Bacteria 7239054
912 2996389558 2996386984 Bacteria 6978667
913 3000137841 3000135777 Bacteria 6891109
914 3004193738 3004188549 Bacteria 6952365
915 3004202666 3004195979 Bacteria 6776956
916 3004209249 3004203850 Bacteria 7307914
917 3004237783 3004232784 Bacteria 6662140
918 3004243251 3004239961 Bacteria 6892290
919 3004251952 3004248173 Bacteria 6563236
920 3004269094 3004268573 Bacteria 7043476
921 3004281274 3004275668 Bacteria 7114440
922 3004336704 3004334049 Bacteria 8449246
923 637076541 637000159 Bacteria 7596297
924 641641709 641522639 Bacteria 7737025
925 649871001 649633066 Bacteria 6690028
926 8001849347 8001845381 Bacteria 5804942
927 8002290697 8002285264 Bacteria 6717907
928 8004306830 8004300914 Bacteria 6132239
929 8004363709 8004361976 Bacteria 6858373
930 8004381441 8004374579 Bacteria 6898112
931 8004388614 8004387939 Bacteria 7049250
932 8004452218 8004445564 Bacteria 6322258
933 8004635437 8004633249 Bacteria 6723080
934 8004646414 8004640170 Bacteria 6723001
935 8004700419 8004695233 Bacteria 6731676
936 8004706319 8004703790 Bacteria 8006957
937 8004715235 8004714634 Bacteria 6776161
938 8004728998 8004727605 Bacteria 6643904
939 8055618392 8055617313 Bacteria 7548464
940 8055911324 8055909800 Bacteria 7278581
941 8057163766 8057160832 Bacteria 3268302
942 Ga0373947_0018767
943 JGI25406J46586_10000109
944 JGI25404J52841_10000082
945 Ga0070658_10056505
946 Ga0070683_100069233
947 Ga0070683_100163430
948 Ga0070683_100182341
949 Ga0070690_100036374
950 Ga0070670_100050719
951 Ga0070666_10006286
952 Ga0070666_10014730
953 Ga0070680_100159738
954 Ga0070680_100365256
955 Ga0070682_100263438
956 Ga0068868_100013509
957 Ga0070660_100213575
958 Ga0070687_100085215
959 Ga0070661_100022274
960 Ga0070692_10257612
961 Ga0070668_100200150
962 Ga0070668_100325935
963 Ga0070669_100164922
964 Ga0070675_100278038
965 Ga0070671_100097885
966 Ga0070673_100041471
967 Ga0070688_100007241
968 Ga0070659_100086396
969 Ga0070667_100032087
970 Ga0070667_100060010
971 Ga0070709_10010315
972 Ga0070709_10021445
973 Ga0070714_100085603
974 Ga0070714_100445834
975 Ga0070714_100687792
976 Ga0070713_100016764
977 Ga0070713_100022844
978 Ga0070713_100119143
979 Ga0070710_10002270
980 Ga0070710_10009019
981 Ga0070710_10067927
982 Ga0070701_10113335
983 Ga0070701_10127453
984 Ga0070711_100016805
985 Ga0070711_100047333
986 Ga0070663_100624251
987 Ga0070678_100004557
988 Ga0070678_100033282
989 Ga0070662_100313836
990 Ga0070681_10058748
991 Ga0070685_10006589
992 Ga0070679_100002598
993 Ga0070679_100079164
994 Ga0070679_100163069
995 Ga0070679_100510759
996 Ga0070684_100529592
997 Ga0070672_100376566
998 Ga0070672_100389092
999 Ga0070686_100003427
1000 Ga0070695_100099238
1001 Ga0070693_100006523
1002 Ga0070665_100014656
1003 Ga0070665_100065860
1004 Ga0070665_100189359
1005 Ga0068855_100099540
1006 Ga0070664_100221706
1007 Ga0068857_100454614
1008 Ga0068856_100201818
1009 Ga0068852_100335647
1010 Ga0068859_100080273
1011 Ga0068864_100009012
1012 Ga0068866_10011785
1013 Ga0068866_10091414
1014 Ga0068861_100185416
1015 Ga0068863_100078487
1016 Ga0068858_100033296
1017 Ga0068858_100271812
1018 Ga0081455_10002387
1019 Ga0081455_10002827
1020 Ga0081455_10051220
1021 Ga0081538_10059592
1022 Ga0081540_1015854
1023 Ga0081540_1087122
1024 Ga0081539_10001010
1025 Ga0081539_10001777
1026 Ga0070717_10000870
1027 Ga0070717_10291515
1028 Ga0075365_10006435
1029 Ga0075365_10092287
1030 Ga0075365_10160544
1031 Ga0075368_10039114
1032 Ga0075363_100005578
1033 Ga0075363_100013754
1034 Ga0075363_100117986
1035 Ga0075364_10005368
1036 Ga0075364_10043125
1037 Ga0070715_10004329
1038 Ga0070716_100000405
1039 Ga0070712_100006107
1040 Ga0070712_100054743
1041 Ga0070712_100323869
1042 Ga0070712_100453504
1043 Ga0075362_10017365
1044 Ga0075362_10089358
1045 Ga0075367_10002138
1046 Ga0075367_10023750
1047 Ga0075369_10016092
1048 Ga0075369_10120529
1049 Ga0097621_100012752
1050 Ga0075370_10041958
1051 Ga0068871_100005825
1052 Ga0075428_100174181
1053 Ga0075428_100289642
1054 Ga0075431_100241413
1055 Ga0075433_10054160
1056 Ga0075433_10065447
1057 Ga0075434_100065236
1058 Ga0075436_100008760
1059 Ga0075436_100049534
1060 Ga0097620_100080265
1061 Ga0075435_100101881
1062 Ga0105251_10025457
1063 Ga0105240_10026513
1064 Ga0105240_10041350
1065 Ga0111539_10351140
1066 Ga0105245_10030429
1067 Ga0105245_10070476
1068 Ga0105245_10185072
1069 Ga0105245_10759657
1070 Ga0105247_10066254
1071 Ga0114129_10604466
1072 Ga0105243_10030161
1073 Ga0105241_10005705
1074 Ga0105241_10079582
1075 Ga0105242_10061684
1076 Ga0105248_10134950
1077 Ga0105237_10068044
1078 Ga0105237_10112538
1079 Ga0105238_10005562
1080 Ga0105238_10015166
1081 Ga0105249_10154668
1082 Ga0105249_10236978
1083 Ga0105239_10022803
1084 Ga0105239_10030197
1085 Ga0105239_10061573
1086 Ga0105239_10201567
1087 Ga0105239_10246944
1088 Ga0105246_10006169
1089 Ga0105246_10164679
1090 Ga0105246_10218187
1091 Ga0157316_1003708
1092 Ga0157370_10012471
1093 Ga0157369_10087271
1094 Ga0157374_10045210
1095 Ga0163162_10089104
1096 Ga0163162_10443199
1097 Ga0157372_10263811
1098 Ga0157372_10754354
1099 Ga0157375_10177508
1100 Ga0163163_10030377
1101 Ga0163163_10066561
1102 Ga0163163_10078997
1103 Ga0182008_10072215
1104 Ga0157377_10109951
1105 Ga0157379_10124798
1106 Ga0157376_10104693
1107 Ga0182006_1027380
1108 Ga0206356_11202692
1109 Ga0206353_10492257
1110 Ga0206353_11116635
1111 Ga0213875_10001607
1112 Ga0213875_10012138
1113 Ga0213875_10079050
1114 Ga0213871_10026807
1115 Ga0209026_1000032
1116 Ga0209759_1000142
1117 Ga0209233_1000030
1118 Ga0209233_1009633
1119 Ga0207713_1014372
1120 Ga0207692_10005119
1121 Ga0207692_10007113
1122 Ga0207692_10010180
1123 Ga0207692_10053560
1124 Ga0207710_10001149
1125 Ga0207647_10005873
1126 Ga0207685_10004995
1127 Ga0207699_10001920
1128 Ga0207699_10374379
1129 Ga0207645_10037731
1130 Ga0207705_10018366
1131 Ga0207654_10077909
1132 Ga0207707_10094608
1133 Ga0207707_10413448
1134 Ga0207695_10026753
1135 Ga0207671_10288687
1136 Ga0207693_10004498
1137 Ga0207693_10006034
1138 Ga0207693_10009769
1139 Ga0207663_10026882
1140 Ga0207663_10228336
1141 Ga0207660_10129825
1142 Ga0207662_10149627
1143 Ga0207657_10034662
1144 Ga0207657_10054719
1145 Ga0207694_10008304
1146 Ga0207650_10004278
1147 Ga0207687_10008663
1148 Ga0207700_10000884
1149 Ga0207700_10063123
1150 Ga0207664_10028839
1151 Ga0207664_10396407
1152 Ga0207644_10011873
1153 Ga0207644_10056747
1154 Ga0207706_10043327
1155 Ga0207706_10054929
1156 Ga0207709_10025546
1157 Ga0207670_10006927
1158 Ga0207669_10025973
1159 Ga0207704_10092321
1160 Ga0207665_10000996
1161 Ga0207691_10475398
1162 Ga0207711_10027773
1163 Ga0207667_10063594
1164 Ga0207651_10020536
1165 Ga0207712_10049036
1166 Ga0207712_10309000
1167 Ga0207658_10009968
1168 Ga0207703_10079032
1169 Ga0207639_10282780
1170 Ga0207678_10016681
1171 Ga0207678_10112700
1172 Ga0207678_10413604
1173 Ga0207702_10220404
1174 Ga0207702_10268115
1175 Ga0207641_10012369
1176 Ga0207648_10483688
1177 Ga0207676_10008443
1178 Ga0207674_10275389
1179 Ga0207675_100016232
1180 Ga0207675_100177464
1181 Ga0207675_100235960
1182 Ga0207683_10003153
1183 Ga0207683_10056939
1184 Ga0207698_10058439
1185 Ga0207698_10090301
1186 Ga0268266_10003978
1187 Ga0268266_10019048
1188 Ga0268266_10131554
1189 Ga0268266_10152584
1190 Ga0268265_10035234
1191 Ga0268265_10586000
1192 Ga0268264_10016368
1193 Ga0265337_1001512
1194 Ga0265338_10018836
1195 Ga0265338_10030205
1196 Ga0265313_10007874
1197 Ga0307508_10085557
1198 Ga0316579_10024534
1199 Ga0265314_10071571
1200 Ga0265314_10108940
1201 Ga0307413_10013520
1202 Ga0307410_10379299
1203 Ga0307410_10396523
1204 Ga0307407_10304197
1205 Ga0307407_10427340
1206 Ga0307412_10052877
1207 Ga0307409_100124461
1208 Ga0307409_100128668
1209 Ga0307409_100203465
1210 Ga0307416_100220795
1211 Ga0307416_101126389
1212 Ga0307415_100094346
1213 Ga0307415_100096430
1214 Ga0307510_10113650
1215 Ga0373930_0009127
1216 Ga0373930_0021193
1217 Ga0373948_0022159
1218 Ga0373959_0025617
1219 Ga0373938_0029931
1220 Ga0373926_0071044
1221 Ga0373926_0133000
1222 Ga0373928_0032971
1223 Ga0373940_0062743
1224 Ga0373944_0013917
1225 Ga0373944_0036829
1226 Ga0373949_0019193
1227 Ga0373951_0013595
1228 Ga0373952_0022384
1229 Ga0373923_0072157
1230 Ga0373932_0008124
1231 Ga0373936_0128024
1232 Ga0373939_0000595
1233 Ga0373939_0008360
1234 Ga0373941_0024519
1235 Ga0373954_0005645
1236 Ga0373954_0009134
1237 Ga0373954_0035220
1238 Ga0373956_0017690
1239 Ga0373957_0072477
1240 Ga0373957_0075762
1241 Ga0373943_0014695
1242 Ga0373943_0058322
1243 Ga0373943_0164217
1244 Ga0373955_0003027
1245 Ga0373955_0007627
1246 Ga0373955_0007756
1247 Ga0373924_0005315
1248 Ga0373924_0080189
1249 Ga0373931_0052368
1250 Ga0373931_0167389
1251 Ga0373935_0016511
1252 Ga0373935_0035975
1253 Ga0373935_0077427
1254 Ga0373935_0175544
1255 Ga0373935_0204050
1256 Ga0373927_0020566
1257 Ga0373927_0067623
1258 Ga0373933_0007683
1259 Ga0373933_0008207
1260 Ga0373933_0034906
1261 Ga0373933_0042484
1262 Ga0373933_0087061
1263 Ga0373947_0045098
1264 Ga0373947_0046308
1265 Ga0373937_0000824
1266 Ga0373937_0003327
1267 Ga0373937_0005428
1268 Ga0373937_0020693
1269 Ga0373937_0035947
1270 Ga0373937_0043962
1271 Ga0373937_0206769
1272 Ga0373937_0406378
1273 Ga0373937_0636318
1274 Ga0373925_0009860
1275 Ga0373925_0020221
1276 Ga0373925_0046337
1277 Ga0373925_0121310
1278 Ga0373925_0203128
1279 Ga0373925_0546680
1280 Ga0395899_0000058
1281 Ga0395899_0002233
1282 Ga0395899_0078551
1283 Ga0395900_0001351
1284 Ga0395900_0043962
1285 Ga0395900_0144680
1286 Ga0395900_0228201
1287 Ga0395900_0258646
1288 Ga0395898_0014184
1289 Ga0395898_0016934
1290 Ga0395898_0021905
1291 Ga0395898_0038675
1292 Ga0395905_0263078
1293 Ga0395905_0459597
1294 Ga0436364_0127534
1295 Ga0436364_0335466
1296 Ga0436364_0341381
1297 Ga0436364_0534960
1298 Ga0436364_0716978
1299 Ga0436364_1095010
1300 Ga0436364_1179675
1301 Ga0436364_1505086
1302 Ga0436364_1513145
1303 Ga0395901_0013773
1304 Ga0395901_0015782
1305 Ga0395901_0044071
1306 Ga0395901_0131108
1307 Ga0436365_0209418
1308 Ga0436365_0686558
1309 Ga0436365_0696682
1310 Ga0436365_1151479
1311 Ga0436365_1658787
1312 Ga0436360_0023402
1313 Ga0436360_0314979
1314 Ga0436360_0394148
1315 Ga0436360_1044519
1316 Ga0436361_0582741
1317 Ga0436363_0329936
1318 Ga0436363_0678607
1319 Ga0436363_1347707
1320 Ga0436362_0749915
1321 Ga0436362_1078251
1322 Ga0466972_0030800
1323 Ga0466965_0112551
1324 Ga0466965_0133181
1325 Ga0466966_0048885
1326 Ga0466961_0069813
1327 Ga0466961_0177552
1328 Ga0466963_0151206
1329 Ga0466963_0232437
1330 Ga0466963_0272778
1331 Ga0466963_0319368
1332 Ga0466971_0052565
1333 Ga0466968_0042004
1334 Ga0466970_0211593
1335 Ga0466957_0301227
1336 Ga0466960_0065737
1337 Ga0466960_0066169
1338 Ga0466960_0067827
1339 Ga0466960_0302647
1340 Ga0466959_0093137
1341 Ga0466959_0103152
1342 Ga0466959_0106141
1343 Ga0466967_0038125
1344 Ga0466967_0091230
1345 Ga0466967_0211600
1346 Ga0466967_0673365
1347 Ga0495592_0016974
1348 Ga0495592_0019964
1349 Ga0495592_0176742
1350 Ga0495592_0234065
1351 Ga0495603_0046352
1352 Ga0495629_0006816
1353 Ga0495638_0021151
1354 Ga0495641_0118462
1355 Ga0495651_0010286
1356 Ga0495651_0051025
1357 Ga0495651_0088366
1358 Ga0495653_0064776
1359 Ga0495653_0128709
1360 Ga0495580_0083844
1361 Ga0495639_0109221
1362 Ga0495664_0005387
1363 Ga0495664_0151921
1364 Ga0495664_0194775
1365 Ga0495594_0065426
1366 Ga0495606_0213347
1367 Ga0495608_0133658
1368 Ga0495608_0143047
1369 Ga0495608_0230235
1370 Ga0495628_0002495
1371 Ga0495628_0189170
1372 Ga0495643_0020016
1373 Ga0495640_0054279
1374 Ga0495640_0126671
1375 Ga0495587_0015685
1376 Ga0495587_0025425
1377 Ga0495587_0050288
1378 Ga0495645_0039395
1379 Ga0495667_0005423
1380 Ga0495667_0007799
1381 Ga0495667_0029059
1382 Ga0495667_0063057
1383 Ga0495667_0123470
1384 Ga0495667_0329835
1385 Ga0495634_0055785
1386 Ga0495635_0013367
1387 Ga0495635_0014990
1388 Ga0495635_0117174
1389 Ga0495588_0301765
1390 Ga0495657_0007004
1391 Ga0495657_0117051
1392 Ga0495657_0121432
1393 Ga0495599_0015899
1394 Ga0495599_0071204
1395 Ga0495623_0339024
1396 Ga0495646_0007579
1397 Ga0495646_0205501
1398 Ga0495658_0000857
1399 Ga0495658_0182417
1400 Ga0495613_0005530
1401 Ga0495613_0199293
1402 Ga0495604_0007736
1403 Ga0495604_0029158
1404 Ga0495604_0052727
1405 Ga0495604_0064971
1406 Ga0495604_0196319
1407 Ga0495674_0042794
1408 Ga0495674_0116521
1409 Ga0495676_0062701
1410 Ga0495676_0082339
1411 Ga0495680_0007406
1412 Ga0495680_0019787
1413 Ga0495680_0155661
1414 Ga0495680_0164646
1415 Ga0495687_033246
1416 Ga0495675_0008439
1417 Ga0495679_094254
1418 Ga0495684_0072882
1419 Ga0495684_0147958
1420 Ga0495684_0249205
1421 Ga0495684_0266262
1422 Ga0495593_0073081
1423 Ga0495602_0007703
1424 Ga0495602_0008247
1425 Ga0495602_0040749
1426 Ga0495602_0056229
1427 Ga0495614_0227468
1428 Ga0495626_0146227
1429 Ga0496100_0010727
1430 Ga0496100_0016956
1431 Ga0496101_0030950
1432 Ga0496102_0004469
1433 Ga0496102_0054690
1434 Ga0496102_0093976
1435 Ga0496102_0144634
1436 Ga0496102_0183389
1437 Ga0496102_0229204
1438 Ga0496102_0283571
1439 Ga0496102_0300223
1440 Ga0496103_0007284
1441 Ga0496103_0116220
1442 Ga0496104_0000055
1443 Ga0496104_0003540
1444 Ga0496104_0008257
1445 Ga0496104_0435682
1446 Ga0496105_0000797
1447 Ga0496105_0012262
1448 Ga0496105_0020421
1449 Ga0496105_0115646
1450 Ga0496107_0015062
1451 Ga0496107_0024577
1452 Ga0496108_0002024
1453 Ga0496108_0004408
1454 Ga0496108_0121897
1455 Ga0496109_0001887
1456 Ga0496109_0017110
1457 Ga0496109_0050361
1458 Ga0496109_0075889
1459 Ga0496110_0004828
1460 Ga0496110_0303778
1461 Ga0496110_0311797
1462 Ga0496111_0001458
1463 Ga0496111_0082817
1464 Ga0496111_0138127
1465 Ga0496112_0008278
1466 Ga0496112_0026418
1467 Ga0496112_0152710
1468 Ga0496113_0008064
1469 Ga0496113_0011316
1470 Ga0496113_0020314
1471 Ga0496113_0080341
1472 Ga0496114_0078664
1473 Ga0496114_0211875
1474 Ga0496115_0039056
1475 Ga0496115_0071180
1476 Ga0496115_0077469
1477 Ga0496115_0293493
1478 Ga0496117_0053718
1479 Ga0496119_0000344
1480 Ga0496119_0002572
1481 Ga0496121_0166975
1482 Ga0496122_0011879
1483 Ga0496123_0005458
1484 Ga0496124_0158266
1485 Ga0501031_0000166
1486 Ga0501031_0025653
1487 Ga0501031_0130464
1488 Ga0501031_0156460
1489 Ga0501032_0000384
1490 Ga0501032_0005222
1491 Ga0501033_0000511
1492 Ga0501033_0034340
1493 Ga0501033_0036461
1494 Ga0501033_0072778
1495 Ga0501033_0073043
1496 Ga0501034_0001159
1497 Ga0501034_0001769
1498 Ga0501034_0041858
1499 Ga0501034_0278589
1500 Ga0501034_0471844
1501 Ga0501036_0000248
1502 Ga0501037_0000389
1503 Ga0501037_0020819
1504 Ga0501037_0045208
1505 Ga0501037_0045725
1506 Ga0501038_0000433
1507 Ga0501038_0060799
1508 Ga0501038_0099584
1509 Ga0501039_0000279
1510 Ga0501039_0175451
1511 Ga0501040_0015093
1512 Ga0501042_0108850
1513 Ga0501043_0000452
1514 Ga0501043_0057397
1515 Ga0501043_0174320
1516 Ga0501047_0000677
1517 Ga0501047_0074907
1518 Ga0501047_0128563
1519 Ga0501047_0182779
1520 Ga0501047_0827165
1521 Ga0501048_0004698
1522 Ga0501067_0009463
1523 Ga0501067_0018832
1524 Ga0501068_0003218
1525 Ga0501069_0135635
1526 Ga0501069_0241699
1527 Ga0501070_0032726
1528 Ga0501070_0043124
1529 Ga0501070_0154614
1530 Ga0501071_0069902
1531 Ga0501071_0170165
1532 Ga0501072_0004195
1533 Ga0501073_0025687
1534 Ga0501073_0038639
1535 Ga0501073_0066587
1536 Ga0501074_0044730
1537 Ga0501074_0093956
1538 Ga0501074_0130257
1539 Ga0501080_0044678
1540 Ga0501080_0485492
1541 Ga0501080_0698425
1542 Ga0501083_0046096
1543 Ga0501083_0067811
1544 Ga0501083_0086999
1545 Ga0501083_0309078
1546 Ga0501035_0000651
1547 Ga0501035_0064636
1548 Ga0501044_0000862
1549 Ga0501044_0019854
1550 Ga0501044_0025214
1551 Ga0501044_0056088
1552 Ga0501044_0211761
1553 Ga0501044_0278927
1554 Ga0501045_0018395
1555 nmdc:mga03683_47570_c1
1556 nmdc:mga03n38_16303_c1
1557 nmdc:mga00v17_114749_c1
1558 nmdc:mga00v17_16996_c1
1559 nmdc:mga00v17_37745_c1
1560 nmdc:mga0yw44_153322_c1
1561 nmdc:mga0yw44_20790_c1
1562 nmdc:mga0yw44_8593_c1
1563 nmdc:mga0yw44_99598_c1
1564 nmdc:mga0k408_28578_c1
1565 nmdc:mga06z11_38624_c1
1566 nmdc:mga06z11_659_c1
1567 nmdc:mga07m45_267935_c1
1568 nmdc:mga05p37_4816_c1
1569 nmdc:mga06r32_209654_c1
1570 nmdc:mga06r32_99192_c1
1571 nmdc:mga0n895_103856_c1
1572 nmdc:mga0n895_42236_c1
1573 nmdc:mga0rr50_205118_c1
1574 nmdc:mga0rr50_24524_c1
1575 nmdc:mga08x19_9716_c1
1576 nmdc:mga0a205_86288_c1
1577 nmdc:mga0sz30_16451_c1
1578 nmdc:mga0sz30_76197_c1
1579 Ga0495601_0004059
1580 Ga0495601_0005636
1581 Ga0495601_0016725
1582 Ga0495612_0001521
1583 Ga0495612_0002491
1584 Ga0495612_0015912
1585 Ga0495612_0030188
1586 Ga0495612_0046200
1587 Ga0495595_0000380
1588 Ga0495595_0007849
1589 Ga0495619_0000085
1590 Ga0495619_0000442
1591 Ga0495619_0000536
1592 Ga0495619_0011298
1593 Ga0495619_0020082
1594 Ga0495619_0061326
1595 Ga0500556_0000122
1596 Ga0500593_000036
1597 Ga0500568_0000002
1598 Ga0500568_0000104
1599 Ga0500604_0079305
1600 Ga0500620_021403
1601 Ga0501084_0037737
1602 Ga0501084_0054562
1603 Ga0501084_0282195
1604 Ga0501082_0000032
1605 Ga0466962_0032763
1606 Ga0466962_0050053
1607 Ga0466962_0050886
1608 2503199165
1609 2509116541
1610 2509144290
1611 2509372515
1612 2509394105
1613 2512933440
1614 2512961556
1615 2513613342
1616 2514036841
1617 2514418131
1618 2514586908
1619 2523467409
1620 2526063588
1621 2545675643
1622 2588519511
1623 2596375007
1624 2597811787
1625 2599937050
1626 2623500983
1627 2643777471
1628 2643795919
1629 2688596450
1630 2694630130
1631 2723573540
1632 2739306137
1633 2739347852
1634 2740061938
1635 2828308722
1636 2837682524
1637 2841736871
1638 2842336437
1639 2842702458
1640 2842777744
1641 2844011276
1642 2847673855
1643 2847690350
1644 2856320494
1645 2856327308
1646 2856328405
1647 2856338593
1648 2856344591
1649 2856350841
1650 2856356739
1651 2856364963
1652 2857353347
1653 2857373407
1654 2869174427
1655 2869235963
1656 2869244428
1657 2869254069
1658 2869257182
1659 2869266410
1660 2869273102
1661 2869279465
1662 2869286412
1663 2871430381
1664 2871440122
1665 2871450556
1666 2871452074
1667 2871477133
1668 2871483774
1669 2871494809
1670 2874102889
1671 2874116329
1672 2874119661
1673 2874130188
1674 2874135960
1675 2874139544
1676 2874146799
1677 2874155872
1678 2874165497
1679 2874176710
1680 2876364306
1681 2876377607
1682 2876385159
1683 2876386370
1684 2876402245
1685 2876414201
1686 2876421331
1687 2878038909
1688 2878737036
1689 2878741991
1690 2878746577
1691 2878759942
1692 2878765079
1693 2878772251
1694 2878776494
1695 2878785775
1696 2881148651
1697 2881159730
1698 2881165432
1699 2881851216
1700 2881866955
1701 2882640253
1702 2882914155
1703 2883578302
1704 2884299575
1705 2885307287
1706 2885313673
1707 2885322822
1708 2885329056
1709 2885339364
1710 2885343615
1711 2885352456
1712 2888337126
1713 2888344838
1714 2888353607
1715 2889015327
1716 2889019599
1717 2891048767
1718 2894775621
1719 2902411364
1720 2903455170
1721 2903494167
1722 2903499767
1723 2903523927
1724 2903530426
1725 2903545881
1726 2906308979
1727 2906322259
1728 2906333788
1729 2906367577
1730 2906373810
1731 2906390269
1732 2906398157
1733 2906402686
1734 2906409972
1735 2906421273
1736 2909044198
1737 2917554934
1738 2919454906
1739 2922136709
1740 2922157601
1741 2922161308
1742 2922173562
1743 2922183708
1744 2922193556
1745 2924714556
1746 2924725504
1747 2924730450
1748 2924734412
1749 2924744531
1750 2924751012
1751 2924759883
1752 2924765404
1753 2924779675
1754 2924790747
1755 2928129930
1756 2929204148
1757 2937822319
1758 2937826890
1759 2937841280
1760 2937866204
1761 2937873903
1762 2937878169
1763 2937896331
1764 2937972924
1765 2937982799
1766 2937999735
1767 2938022276
1768 2958035043
1769 2958044074
1770 2958057330
1771 2958068544
1772 2958073147
1773 2958085283
1774 2958098747
1775 2958107667
1776 2958110765
1777 2958120523
1778 2958122947
1779 2958130813
1780 2958143015
1781 2958164045
1782 2958170203
1783 2958173573
1784 2958180151
1785 2961077978
1786 2961130543
1787 2961136925
1788 2961168654
1789 2961177214
1790 2961185207
1791 2963645764
1792 2965023466
1793 2965030939
1794 2965032098
1795 2965041782
1796 2965052175
1797 2965062261
1798 2965094418
1799 2965106301
1800 2965125894
1801 2968002305
1802 2968009539
1803 2968023463
1804 2968089272
1805 2968101939
1806 2968122255
1807 2968133209
1808 2968143041
1809 2968177066
1810 2970476045
1811 2970493732
1812 2970509888
1813 2970512591
1814 2970526563
1815 2970537167
1816 2970540042
1817 2970552343
1818 2970559926
1819 2970594065
1820 2970627209
1821 2977828464
1822 2977836485
1823 2977844185
1824 2977857658
1825 2977864907
1826 2977869779
1827 2977878376
1828 2977906273
1829 2977914183
1830 2977922566
1831 2977941791
1832 2977942319
1833 2977954456
1834 2977962686
1835 2977975117
1836 2977991227
1837 2979710835
1838 2979745545
1839 2979770811
1840 2979776811
1841 2979782398
1842 2979794832
1843 2979814764
1844 2987641940
1845 2987646318
1846 2987655314
1847 2987664683
1848 2987669748
1849 2987680773
1850 2996315310
1851 2996346716
1852 2996354626
1853 2996389558
1854 3000137841
1855 3004193738
1856 3004202666
1857 3004209249
1858 3004237783
1859 3004243251
1860 3004251952
1861 3004269094
1862 3004281274
1863 3004336704
1864 637076541
1865 641641709
1866 649871001
1867 8001849347
1868 8002290697
1869 8004306830
1870 8004363709
1871 8004381441
1872 8004388614
1873 8004452218
1874 8004635437
1875 8004646414
1876 8004700419
1877 8004706319
1878 8004715235
1879 8004728998
1880 8055618392
1881 8055911324
1882 8057163766

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

82

295

0.85

PF00294

PfkB

pfkB family carbohydrate kinase

103

287

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.9594 2 269
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.9524 2 269
3pzs-assembly1.cif.gz_A crystal structure of a pyridoxamine kinase from yersinia pestis co92 0.9514 1 269
1vi9-assembly2.cif.gz_D crystal structure of pyridoxamine kinase 0.9509 2 269
1td2-assembly1.cif.gz_B crystal structure of the pdxy protein from escherichia coli 0.9495 2 269
ID Description Score Start End Superfamily
af_Q7KUC2_7_303_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9255 2 269 3.40.1190.20
af_P53727_6_307_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9234 2 222 3.40.1190.20
af_P40191_1_283_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9217 3 249 3.40.1190.20
af_Q59MC6_1_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9203 2 230 3.40.1190.20
1vi9C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9197 2 269 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A537MWP1-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9973 1 100 GO:0005829
GO:0008478
GO:0009443
AF-A0A7Z1UXG6-F1-model_v4 deleted 0.9972 1 137
AF-A0A258SQ85-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9951 1 109 GO:0005829
GO:0008478
GO:0009443
AF-A0A537QCB7-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9931 2 182 GO:0005829
GO:0008478
GO:0009443
AF-A0A258SQ85-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9861 1 109 GO:0005829
GO:0008478
GO:0009443

Map