F486335

General Info

Members Datasets Scaffolds Average Seq Length
941 399 1882 126

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_266032|Ga0400483_266032_683_1060
Length 125
Sequence MPTIQQLVRKGRSKQVYKSKAPALDACPQKRGVCVRVYTTTPKKPNSAMRKVARVRITKSGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHLIRGALDTAGVEGRTQRRSKYGAKRPKK

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
152 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
192 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
193 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
194 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
235 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
308 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
336 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
367 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
368 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
369 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
370 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
371 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
372 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
373 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
374 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
375 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
376 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
377 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
378 2860837431 Bacillus sp. WR11 Isolate Unclassified
379 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
380 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
381 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
382 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
383 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
384 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
385 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
386 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
387 2969141011 Bacillus velezensis MH25 Isolate Unclassified
388 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
389 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
390 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
391 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
392 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
393 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
394 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
395 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
396 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
397 8022653035 Bacillus sp. Rc4 Isolate Unclassified
398 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
399 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.53
Metatranscriptomes 12.86
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.7
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_266032 3300039062 Bacteria 1622
2 Ga0006759J45824_1150259 3300003163 Bacteria 616
3 rootH1_10069712 3300003323 Bacteria 4000
4 rootH1_10403485 3300003323 Bacteria 1254
5 Ga0065707_10167338 3300005295 Bacteria 1512
6 Ga0070676_11259696 3300005328 Bacteria 564
7 Ga0070683_100648598 3300005329 Bacteria 1011
8 Ga0070690_100530485 3300005330 Bacteria 885
9 Ga0070670_100590010 3300005331 Bacteria 994
10 Ga0068869_100099622 3300005334 Bacteria 2196
11 Ga0070680_100355547 3300005336 Bacteria 1246
12 Ga0070682_100791466 3300005337 Bacteria 769
13 Ga0070689_101065984 3300005340 Bacteria 721
14 Ga0070689_101343123 3300005340 Bacteria 645
15 Ga0070689_101454326 3300005340 Bacteria 620
16 Ga0070692_10380746 3300005345 Bacteria 885
17 Ga0070674_100068400 3300005356 Bacteria 2502
18 Ga0070673_100506945 3300005364 Bacteria 1092
19 Ga0070667_101407232 3300005367 Bacteria 654
20 Ga0070703_10037289 3300005406 Bacteria 1497
21 Ga0070709_10006493 3300005434 Bacteria 6375
22 Ga0070709_10068471 3300005434 Bacteria 2283
23 Ga0070714_100506323 3300005435 Bacteria 1152
24 Ga0070714_100758792 3300005435 Bacteria 938
25 Ga0070713_100002365 3300005436 Bacteria 12304
26 Ga0070713_100016190 3300005436 Bacteria 5604
27 Ga0070713_100242785 3300005436 Bacteria 1641
28 Ga0070713_100428436 3300005436 Bacteria 1239
29 Ga0070713_100854865 3300005436 Bacteria 874
30 Ga0070710_10043474 3300005437 Bacteria 2488
31 Ga0070710_10166147 3300005437 Bacteria 1372
32 Ga0070710_10273875 3300005437 Bacteria 1093
33 Ga0070710_11159375 3300005437 Bacteria 570
34 Ga0070701_10184773 3300005438 Bacteria 1223
35 Ga0070711_100001449 3300005439 Bacteria 13051
36 Ga0070711_100045540 3300005439 Bacteria 2985
37 Ga0070711_100090240 3300005439 Bacteria 2207
38 Ga0070711_100130525 3300005439 Bacteria 1871
39 Ga0070711_101221300 3300005439 Bacteria 651
40 Ga0070705_100086727 3300005440 Bacteria 1939
41 Ga0070705_100925381 3300005440 Bacteria 703
42 Ga0070705_101040583 3300005440 Bacteria 667
43 Ga0070705_101487901 3300005440 Bacteria 567
44 Ga0070694_100008757 3300005444 Bacteria 6199
45 Ga0070708_100004769 3300005445 Bacteria 10687
46 Ga0070708_100016611 3300005445 Bacteria 6112
47 Ga0070708_100807413 3300005445 Bacteria 882
48 Ga0070708_100974040 3300005445 Bacteria 795
49 Ga0070678_100070409 3300005456 Bacteria 2614
50 Ga0070681_10198635 3300005458 Bacteria 1924
51 Ga0070681_10700340 3300005458 Bacteria 929
52 Ga0068867_100257994 3300005459 Bacteria 1420
53 Ga0068867_100259979 3300005459 Bacteria 1415
54 Ga0070706_100027065 3300005467 Bacteria 5277
55 Ga0070706_100038479 3300005467 Bacteria 4414
56 Ga0070706_100045252 3300005467 Bacteria 4066
57 Ga0070706_100090069 3300005467 Bacteria 2845
58 Ga0070706_100233626 3300005467 Bacteria 1716
59 Ga0070707_100010443 3300005468 Bacteria 8648
60 Ga0070707_100012413 3300005468 Bacteria 7956
61 Ga0070707_100014471 3300005468 Bacteria 7393
62 Ga0070707_101011500 3300005468 Bacteria 797
63 Ga0070698_100003219 3300005471 Bacteria 17992
64 Ga0070698_100065898 3300005471 Bacteria 3647
65 Ga0070698_100068156 3300005471 Bacteria 3577
66 Ga0070698_100480315 3300005471 Bacteria 1180
67 Ga0070698_100911535 3300005471 Bacteria 825
68 Ga0070698_101394679 3300005471 Bacteria 651
69 Ga0070699_100037932 3300005518 Bacteria 4171
70 Ga0070699_100063431 3300005518 Bacteria 3204
71 Ga0070699_100186526 3300005518 Bacteria 1842
72 Ga0070699_100334911 3300005518 Bacteria 1361
73 Ga0070679_100024467 3300005530 Bacteria 5917
74 Ga0070679_100685245 3300005530 Bacteria 968
75 Ga0070684_101702750 3300005535 Bacteria 595
76 Ga0070697_100130858 3300005536 Bacteria 2104
77 Ga0070697_100414395 3300005536 Bacteria 1170
78 Ga0070697_100593093 3300005536 Bacteria 973
79 Ga0070697_101102441 3300005536 Bacteria 707
80 Ga0070697_101315149 3300005536 Bacteria 645
81 Ga0070697_101446656 3300005536 Bacteria 614
82 Ga0070697_101554003 3300005536 Bacteria 592
83 Ga0070672_100013159 3300005543 Bacteria 5834
84 Ga0070686_100356003 3300005544 Bacteria 1101
85 Ga0070695_100027795 3300005545 Bacteria 3506
86 Ga0070695_100124337 3300005545 Bacteria 1769
87 Ga0070696_100003003 3300005546 Bacteria 11197
88 Ga0070696_100044176 3300005546 Bacteria 3085
89 Ga0070696_100648192 3300005546 Bacteria 856
90 Ga0070696_102020260 3300005546 Bacteria 501
91 Ga0070693_100000994 3300005547 Bacteria 12639
92 Ga0070665_100000700 3300005548 Bacteria 44692
93 Ga0070665_100004237 3300005548 Bacteria 15097
94 Ga0070665_102085204 3300005548 Bacteria 572
95 Ga0070704_100003283 3300005549 Bacteria 9244
96 Ga0070704_100377124 3300005549 Bacteria 1204
97 Ga0070704_100615286 3300005549 Bacteria 956
98 Ga0070704_101517299 3300005549 Bacteria 617
99 Ga0068854_100489662 3300005578 Bacteria 1034
100 Ga0068854_100906868 3300005578 Bacteria 775
101 Ga0068856_100465458 3300005614 Bacteria 1285
102 Ga0068864_101268011 3300005618 Bacteria 737
103 Ga0068861_101020095 3300005719 Bacteria 791
104 Ga0068870_10529830 3300005840 Bacteria 790
105 Ga0068863_100014791 3300005841 Bacteria 7503
106 Ga0068858_100088230 3300005842 Bacteria 2885
107 Ga0068860_100010580 3300005843 Bacteria 9113
108 Ga0068860_100509204 3300005843 Bacteria 1202
109 Ga0068862_100333204 3300005844 Bacteria 1404
110 Ga0081455_10002585 3300005937 Bacteria 21454
111 Ga0081455_10157276 3300005937 Bacteria 1746
112 Ga0081538_10000250 3300005981 Bacteria 60946
113 Ga0081538_10002047 3300005981 Bacteria 20127
114 Ga0081538_10019032 3300005981 Bacteria 5126
115 Ga0081538_10138015 3300005981 Bacteria 1131
116 Ga0070715_10082874 3300006163 Bacteria 1459
117 Ga0070715_10208809 3300006163 Bacteria 997
118 Ga0070715_10212958 3300006163 Bacteria 989
119 Ga0070716_100041393 3300006173 Bacteria 2566
120 Ga0070716_100604165 3300006173 Bacteria 825
121 Ga0070716_101367341 3300006173 Bacteria 575
122 Ga0070712_100072105 3300006175 Bacteria 2473
123 Ga0070712_100255026 3300006175 Bacteria 1403
124 Ga0070712_100351408 3300006175 Bacteria 1207
125 Ga0070712_100452968 3300006175 Bacteria 1069
126 Ga0070712_101024728 3300006175 Bacteria 715
127 Ga0097621_100171453 3300006237 Bacteria 1870
128 Ga0097621_100332534 3300006237 Bacteria 1348
129 Ga0097621_100689135 3300006237 Bacteria 940
130 Ga0097621_100726987 3300006237 Bacteria 916
131 Ga0068871_100022756 3300006358 Bacteria 4836
132 Ga0068871_100716246 3300006358 Bacteria 918
133 Ga0068871_101560463 3300006358 Bacteria 625
134 Ga0075428_100263152 3300006844 Bacteria 1857
135 Ga0075428_100269384 3300006844 Bacteria 1832
136 Ga0075428_101151503 3300006844 Bacteria 818
137 Ga0075428_102356328 3300006844 Bacteria 547
138 Ga0075430_100039669 3300006846 Bacteria 3986
139 Ga0075430_100225464 3300006846 Bacteria 1554
140 Ga0075430_100829049 3300006846 Bacteria 762
141 Ga0075431_100063276 3300006847 Bacteria 3818
142 Ga0075431_100452149 3300006847 Bacteria 1280
143 Ga0075431_101034084 3300006847 Bacteria 787
144 Ga0075431_101113721 3300006847 Bacteria 754
145 Ga0075433_10024717 3300006852 Bacteria 5073
146 Ga0075433_10060259 3300006852 Bacteria 3322
147 Ga0075433_10688173 3300006852 Bacteria 896
148 Ga0075433_11130862 3300006852 Bacteria 681
149 Ga0075434_100063706 3300006871 Bacteria 3670
150 Ga0075434_100084572 3300006871 Bacteria 3171
151 Ga0075434_101387012 3300006871 Bacteria 713
152 Ga0075429_100048515 3300006880 Bacteria 3693
153 Ga0075429_100267299 3300006880 Bacteria 1498
154 Ga0075429_100284342 3300006880 Bacteria 1448
155 Ga0075429_100602085 3300006880 Bacteria 963
156 Ga0075429_100672111 3300006880 Bacteria 907
157 Ga0068865_100072446 3300006881 Bacteria 2447
158 Ga0068865_100204745 3300006881 Bacteria 1534
159 Ga0068865_100712783 3300006881 Bacteria 858
160 Ga0068865_101932220 3300006881 Bacteria 535
161 Ga0075436_100005799 3300006914 Bacteria 8480
162 Ga0075436_100009783 3300006914 Bacteria 6556
163 Ga0075436_100800916 3300006914 Bacteria 701
164 Ga0075435_100140998 3300007076 Bacteria 2022
165 Ga0075435_100805145 3300007076 Bacteria 818
166 Ga0075435_101405799 3300007076 Bacteria 611
167 Ga0099794_10014076 3300007265 Bacteria 3497
168 Ga0099794_10023888 3300007265 Bacteria 2801
169 Ga0099794_10035542 3300007265 Bacteria 2352
170 Ga0099794_10113447 3300007265 Bacteria 1359
171 Ga0099795_10004417 3300007788 Bacteria 3627
172 Ga0099795_10030072 3300007788 Bacteria 1862
173 Ga0099795_10086438 3300007788 Bacteria 1209
174 Ga0105250_10425161 3300009092 Bacteria 593
175 Ga0105240_10004245 3300009093 Bacteria 21913
176 Ga0105240_10121109 3300009093 Bacteria 3150
177 Ga0105240_10274511 3300009093 Bacteria 1940
178 Ga0105240_10922690 3300009093 Bacteria 938
179 Ga0111539_10023538 3300009094 Bacteria 7567
180 Ga0111539_10140216 3300009094 Bacteria 2830
181 Ga0111539_10456351 3300009094 Bacteria 1488
182 Ga0105245_10033891 3300009098 Bacteria 4526
183 Ga0105247_10279487 3300009101 Bacteria 1151
184 Ga0114129_10814565 3300009147 Bacteria 1190
185 Ga0105242_10247762 3300009176 Bacteria 1604
186 Ga0105242_10654675 3300009176 Bacteria 1022
187 Ga0105242_10912622 3300009176 Bacteria 879
188 Ga0105242_11090234 3300009176 Bacteria 812
189 Ga0105242_12148188 3300009176 Bacteria 603
190 Ga0105248_10373894 3300009177 Bacteria 1604
191 Ga0105248_11056173 3300009177 Bacteria 918
192 Ga0105248_11706920 3300009177 Bacteria 714
193 Ga0105237_10072778 3300009545 Bacteria 3431
194 Ga0105237_10150945 3300009545 Bacteria 2320
195 Ga0105237_10222663 3300009545 Bacteria 1887
196 Ga0099796_10063694 3300010159 Bacteria 1314
197 Ga0105239_10022622 3300010375 Bacteria 6930
198 Ga0105239_10030499 3300010375 Bacteria 5928
199 Ga0105239_10544717 3300010375 Bacteria 1321
200 Ga0157340_1008626 3300012473 Bacteria 685
201 Ga0157371_10272231 3300013102 Bacteria 1222
202 Ga0157371_10410538 3300013102 Bacteria 992
203 Ga0157369_11202069 3300013105 Bacteria 774
204 Ga0157374_10000801 3300013296 Bacteria 27561
205 Ga0157374_10119097 3300013296 Bacteria 2547
206 Ga0157378_10000272 3300013297 Bacteria 50377
207 Ga0157378_10000886 3300013297 Bacteria 27619
208 Ga0157378_10010996 3300013297 Bacteria 7921
209 Ga0157378_10438127 3300013297 Bacteria 1295
210 Ga0157378_10888802 3300013297 Bacteria 921
211 Ga0157378_11598577 3300013297 Bacteria 698
212 Ga0163162_10374288 3300013306 Bacteria 1557
213 Ga0163162_11107878 3300013306 Bacteria 897
214 Ga0157372_10098714 3300013307 Bacteria 3332
215 Ga0157372_12959194 3300013307 Bacteria 543
216 Ga0157375_10313280 3300013308 Bacteria 1733
217 Ga0157375_11315401 3300013308 Bacteria 850
218 Ga0157375_12507451 3300013308 Bacteria 616
219 Ga0157375_12673585 3300013308 Bacteria 597
220 Ga0157380_11062915 3300014326 Bacteria 846
221 Ga0157380_13475935 3300014326 Bacteria 504
222 Ga0157377_10540728 3300014745 Bacteria 821
223 Ga0157379_10056214 3300014968 Bacteria 3516
224 Ga0157379_11034308 3300014968 Bacteria 784
225 Ga0157376_10000075 3300014969 Bacteria 75560
226 Ga0157376_10002707 3300014969 Bacteria 12069
227 Ga0157376_10226962 3300014969 Bacteria 1733
228 Ga0157376_10438194 3300014969 Bacteria 1272
229 Ga0157376_12354466 3300014969 Bacteria 572
230 Ga0182007_10392064 3300015262 Bacteria 528
231 Ga0184603_100407 3300019192 Bacteria 633
232 Ga0213873_10179721 3300021358 Bacteria 649
233 Ga0213876_10024420 3300021384 Bacteria 3191
234 Ga0213876_10135418 3300021384 Bacteria 1310
235 Ga0256720_139491 3300023438 Bacteria 598
236 Ga0228598_1004458 3300024227 Bacteria 2965
237 Ga0228598_1004932 3300024227 Bacteria 2808
238 Ga0207653_10022350 3300025885 Bacteria 2008
239 Ga0207642_10082809 3300025899 Bacteria 1563
240 Ga0207688_10661977 3300025901 Bacteria 659
241 Ga0207685_10053011 3300025905 Bacteria 1573
242 Ga0207685_10274449 3300025905 Bacteria 825
243 Ga0207699_10022332 3300025906 Bacteria 3427
244 Ga0207699_10059947 3300025906 Bacteria 2283
245 Ga0207699_10175452 3300025906 Bacteria 1437
246 Ga0207699_10186348 3300025906 Bacteria 1398
247 Ga0207699_10317275 3300025906 Bacteria 1092
248 Ga0207699_10339564 3300025906 Bacteria 1058
249 Ga0207699_10674165 3300025906 Bacteria 756
250 Ga0207643_10554156 3300025908 Bacteria 738
251 Ga0207705_10162926 3300025909 Bacteria 1676
252 Ga0207684_10010612 3300025910 Bacteria 8097
253 Ga0207684_10021082 3300025910 Bacteria 5564
254 Ga0207684_10027856 3300025910 Bacteria 4813
255 Ga0207684_10126378 3300025910 Bacteria 2194
256 Ga0207684_10424447 3300025910 Bacteria 1142
257 Ga0207707_11559912 3300025912 Bacteria 521
258 Ga0207695_10104798 3300025913 Bacteria 2816
259 Ga0207695_10184944 3300025913 Bacteria 2003
260 Ga0207695_10861390 3300025913 Bacteria 786
261 Ga0207671_10094363 3300025914 Bacteria 2258
262 Ga0207671_10767804 3300025914 Bacteria 765
263 Ga0207671_11231216 3300025914 Bacteria 585
264 Ga0207693_10043266 3300025915 Bacteria 3543
265 Ga0207693_10118572 3300025915 Bacteria 2078
266 Ga0207693_10159441 3300025915 Bacteria 1775
267 Ga0207693_10413993 3300025915 Bacteria 1054
268 Ga0207663_10026105 3300025916 Bacteria 3387
269 Ga0207663_10076628 3300025916 Bacteria 2174
270 Ga0207663_10125904 3300025916 Bacteria 1762
271 Ga0207663_10465398 3300025916 Bacteria 977
272 Ga0207663_10496103 3300025916 Bacteria 948
273 Ga0207663_10546106 3300025916 Bacteria 905
274 Ga0207660_10288355 3300025917 Bacteria 1305
275 Ga0207662_10723882 3300025918 Bacteria 698
276 Ga0207662_10876025 3300025918 Bacteria 635
277 Ga0207652_10032823 3300025921 Bacteria 4368
278 Ga0207646_10001996 3300025922 Bacteria 24533
279 Ga0207646_10016678 3300025922 Bacteria 6889
280 Ga0207646_10093840 3300025922 Bacteria 2687
281 Ga0207646_10242931 3300025922 Bacteria 1627
282 Ga0207646_10317494 3300025922 Bacteria 1408
283 Ga0207646_10669651 3300025922 Bacteria 929
284 Ga0207681_10887101 3300025923 Bacteria 747
285 Ga0207694_10482770 3300025924 Bacteria 1037
286 Ga0207687_10777486 3300025927 Bacteria 816
287 Ga0207700_10002600 3300025928 Bacteria 10384
288 Ga0207700_10067895 3300025928 Bacteria 2731
289 Ga0207700_10167004 3300025928 Bacteria 1832
290 Ga0207700_10220042 3300025928 Bacteria 1609
291 Ga0207664_10482958 3300025929 Bacteria 1108
292 Ga0207686_10250328 3300025934 Bacteria 1294
293 Ga0207686_10698442 3300025934 Bacteria 806
294 Ga0207670_10288920 3300025936 Bacteria 1280
295 Ga0207670_10384233 3300025936 Bacteria 1119
296 Ga0207670_10954623 3300025936 Bacteria 720
297 Ga0207670_11160662 3300025936 Bacteria 653
298 Ga0207665_10005811 3300025939 Bacteria 8207
299 Ga0207665_10031807 3300025939 Bacteria 3492
300 Ga0207665_10090757 3300025939 Bacteria 2117
301 Ga0207665_10135097 3300025939 Bacteria 1754
302 Ga0207665_10138823 3300025939 Bacteria 1731
303 Ga0207665_10559080 3300025939 Bacteria 890
304 Ga0207665_10695306 3300025939 Bacteria 799
305 Ga0207691_10479356 3300025940 Bacteria 1057
306 Ga0207711_10306284 3300025941 Bacteria 1466
307 Ga0207689_10183463 3300025942 Bacteria 1726
308 Ga0207689_10612955 3300025942 Bacteria 916
309 Ga0207661_10938254 3300025944 Bacteria 797
310 Ga0207661_11042659 3300025944 Bacteria 753
311 Ga0207651_10788706 3300025960 Bacteria 842
312 Ga0207651_11330940 3300025960 Bacteria 646
313 Ga0207651_11465341 3300025960 Bacteria 615
314 Ga0207677_10206493 3300026023 Bacteria 1565
315 Ga0207703_10017399 3300026035 Bacteria 5611
316 Ga0207702_11581631 3300026078 Bacteria 649
317 Ga0207641_10006158 3300026088 Bacteria 10152
318 Ga0207641_10924854 3300026088 Bacteria 867
319 Ga0207641_12459694 3300026088 Bacteria 519
320 Ga0207648_10286078 3300026089 Bacteria 1475
321 Ga0207648_10339454 3300026089 Bacteria 1352
322 Ga0207676_11250965 3300026095 Bacteria 736
323 Ga0207675_100097252 3300026118 Bacteria 2772
324 Ga0207683_10030943 3300026121 Bacteria 4642
325 Ga0209179_1017684 3300027512 Bacteria 1354
326 Ga0209179_1030480 3300027512 Bacteria 1103
327 Ga0209588_1009968 3300027671 Bacteria 2850
328 Ga0209588_1013299 3300027671 Bacteria 2509
329 Ga0209588_1023729 3300027671 Bacteria 1935
330 Ga0207428_10687091 3300027907 Bacteria 733
331 Ga0265354_1000344 3300028016 Bacteria 8226
332 Ga0268266_10000259 3300028379 Bacteria 88660
333 Ga0268266_10016375 3300028379 Bacteria 6339
334 Ga0268264_10016281 3300028381 Bacteria 6088
335 Ga0268264_10019364 3300028381 Bacteria 5563
336 Ga0265326_10057163 3300028558 Bacteria 1104
337 Ga0265319_1000006 3300028563 Bacteria 228868
338 Ga0265319_1004383 3300028563 Bacteria 6996
339 Ga0265319_1005558 3300028563 Bacteria 6010
340 Ga0265319_1025804 3300028563 Bacteria 2099
341 Ga0265334_10062672 3300028573 Bacteria 1399
342 Ga0265318_10000466 3300028577 Bacteria 30068
343 Ga0265318_10002149 3300028577 Bacteria 10711
344 Ga0265322_10079760 3300028654 Bacteria 929
345 Ga0265336_10026034 3300028666 Bacteria 1839
346 Ga0265338_10051864 3300028800 Bacteria 3688
347 Ga0265338_10065699 3300028800 Bacteria 3144
348 Ga0265338_10070235 3300028800 Bacteria 3004
349 Ga0265338_10219663 3300028800 Bacteria 1420
350 Ga0265338_10426682 3300028800 Bacteria 942
351 Ga0265338_10650042 3300028800 Bacteria 731
352 Ga0265338_10912176 3300028800 Bacteria 598
353 Ga0311001_1083056 3300029277 Bacteria 1199
354 Ga0310981_1060993 3300029285 Bacteria 1104
355 Ga0265324_10325219 3300029957 Bacteria 524
356 Ga0265770_1003693 3300030878 Bacteria 2080
357 Ga0265765_1006543 3300030879 Bacteria 1242
358 Ga0265764_102136 3300030882 Bacteria 944
359 Ga0265773_1001638 3300031018 Bacteria 1243
360 Ga0265760_10000026 3300031090 Bacteria 63601
361 Ga0265760_10019572 3300031090 Bacteria 1951
362 Ga0265760_10021342 3300031090 Bacteria 1873
363 Ga0265760_10051624 3300031090 Bacteria 1239
364 Ga0265330_10044087 3300031235 Bacteria 1971
365 Ga0265332_10011115 3300031238 Bacteria 4001
366 Ga0265332_10125373 3300031238 Bacteria 1078
367 Ga0265328_10048044 3300031239 Bacteria 1568
368 Ga0265328_10154371 3300031239 Bacteria 864
369 Ga0265328_10189103 3300031239 Bacteria 780
370 Ga0265328_10192958 3300031239 Bacteria 772
371 Ga0265320_10001540 3300031240 Bacteria 16675
372 Ga0265320_10033071 3300031240 Bacteria 2642
373 Ga0265320_10354462 3300031240 Bacteria 648
374 Ga0265325_10012503 3300031241 Bacteria 4853
375 Ga0265325_10111536 3300031241 Bacteria 1328
376 Ga0265329_10004500 3300031242 Bacteria 5784
377 Ga0265329_10006079 3300031242 Bacteria 4821
378 Ga0265329_10008477 3300031242 Bacteria 3895
379 Ga0265329_10100232 3300031242 Bacteria 922
380 Ga0265340_10017605 3300031247 Bacteria 3696
381 Ga0265340_10102258 3300031247 Bacteria 1331
382 Ga0265339_10001807 3300031249 Bacteria 15694
383 Ga0265331_10000025 3300031250 Bacteria 229346
384 Ga0265331_10002674 3300031250 Bacteria 11903
385 Ga0265331_10016846 3300031250 Bacteria 3825
386 Ga0265331_10277030 3300031250 Bacteria 752
387 Ga0265316_10000784 3300031344 Bacteria 35048
388 Ga0265316_10001106 3300031344 Bacteria 29252
389 Ga0265316_10031378 3300031344 Bacteria 4346
390 Ga0265316_10124722 3300031344 Bacteria 1943
391 Ga0265316_10357170 3300031344 Bacteria 1057
392 Ga0265316_10612981 3300031344 Bacteria 771
393 Ga0307509_10043415 3300031507 Bacteria 4865
394 Ga0307408_100071079 3300031548 Bacteria 2572
395 Ga0265313_10001605 3300031595 Bacteria 21001
396 Ga0265313_10018591 3300031595 Bacteria 3896
397 Ga0265313_10102933 3300031595 Bacteria 1265
398 Ga0265313_10156241 3300031595 Bacteria 971
399 Ga0316575_10108542 3300031665 Bacteria 1132
400 Ga0316579_10019575 3300031691 Bacteria 2992
401 Ga0316579_10033104 3300031691 Bacteria 2372
402 Ga0316579_10057060 3300031691 Bacteria 1834
403 Ga0316579_10102736 3300031691 Bacteria 1369
404 Ga0316579_10109614 3300031691 Bacteria 1325
405 Ga0316579_10254432 3300031691 Bacteria 849
406 Ga0265314_10000087 3300031711 Bacteria 138681
407 Ga0265314_10038233 3300031711 Bacteria 3470
408 Ga0265314_10063634 3300031711 Bacteria 2502
409 Ga0265314_10118535 3300031711 Bacteria 1670
410 Ga0265342_10000362 3300031712 Bacteria 50260
411 Ga0265342_10026417 3300031712 Bacteria 3638
412 Ga0265342_10038414 3300031712 Bacteria 2916
413 Ga0316576_10000859 3300031727 Bacteria 15370
414 Ga0316576_10050533 3300031727 Bacteria 3024
415 Ga0316576_10114440 3300031727 Bacteria 2023
416 Ga0316576_10277870 3300031727 Bacteria 1254
417 Ga0316576_10341683 3300031727 Bacteria 1115
418 Ga0316576_10419265 3300031727 Bacteria 991
419 Ga0316576_10447642 3300031727 Bacteria 954
420 Ga0316576_10453360 3300031727 Bacteria 947
421 Ga0316576_10495153 3300031727 Bacteria 899
422 Ga0316576_10631927 3300031727 Bacteria 780
423 Ga0316576_10849366 3300031727 Bacteria 655
424 Ga0316576_11060207 3300031727 Bacteria 576
425 Ga0316578_10000241 3300031728 Bacteria 16205
426 Ga0316578_10004865 3300031728 Bacteria 6418
427 Ga0316578_10022633 3300031728 Bacteria 3507
428 Ga0316578_10105859 3300031728 Bacteria 1688
429 Ga0316578_10395493 3300031728 Bacteria 819
430 Ga0307405_10222748 3300031731 Bacteria 1385
431 Ga0316577_10000447 3300031733 Bacteria 16151
432 Ga0307413_10748047 3300031824 Bacteria 817
433 Ga0307410_10231950 3300031852 Bacteria 1426
434 Ga0307406_10062091 3300031901 Bacteria 2416
435 Ga0307406_11341423 3300031901 Bacteria 625
436 Ga0307407_10357030 3300031903 Bacteria 1037
437 Ga0307412_10845582 3300031911 Bacteria 798
438 Ga0307409_100265902 3300031995 Bacteria 1577
439 Ga0307409_101197534 3300031995 Bacteria 783
440 Ga0307416_100407877 3300032002 Bacteria 1399
441 Ga0307416_100951267 3300032002 Bacteria 961
442 Ga0307414_12323689 3300032004 Bacteria 501
443 Ga0307411_11352474 3300032005 Bacteria 650
444 Ga0307411_11786736 3300032005 Bacteria 570
445 Ga0316053_104592 3300032120 Bacteria 855
446 Ga0307415_100241717 3300032126 Bacteria 1461
447 Ga0316583_10000319 3300032133 Bacteria 13537
448 Ga0316583_10305313 3300032133 Bacteria 550
449 Ga0316585_10004899 3300032137 Bacteria 3761
450 Ga0316585_10111936 3300032137 Bacteria 897
451 Ga0316580_10002598 3300032139 Bacteria 5004
452 Ga0316580_10102712 3300032139 Bacteria 875
453 Ga0316593_10000417 3300032168 Bacteria 7701
454 Ga0316593_10000589 3300032168 Bacteria 6877
455 Ga0316593_10000698 3300032168 Bacteria 6551
456 Ga0316593_10000765 3300032168 Bacteria 6363
457 Ga0316593_10001578 3300032168 Bacteria 5079
458 Ga0316593_10001601 3300032168 Bacteria 5053
459 Ga0316593_10001733 3300032168 Bacteria 4942
460 Ga0316593_10003549 3300032168 Bacteria 3891
461 Ga0316593_10004947 3300032168 Bacteria 3470
462 Ga0316593_10008436 3300032168 Bacteria 2873
463 Ga0316593_10018658 3300032168 Bacteria 2135
464 Ga0316593_10019627 3300032168 Bacteria 2091
465 Ga0316593_10032306 3300032168 Bacteria 1709
466 Ga0316593_10058392 3300032168 Bacteria 1315
467 Ga0316593_10062765 3300032168 Bacteria 1273
468 Ga0316593_10064218 3300032168 Bacteria 1260
469 Ga0316593_10067967 3300032168 Bacteria 1229
470 Ga0316593_10094507 3300032168 Bacteria 1055
471 Ga0316593_10095358 3300032168 Bacteria 1051
472 Ga0316593_10108047 3300032168 Bacteria 992
473 Ga0316593_10341679 3300032168 Bacteria 572
474 Ga0316593_10386520 3300032168 Bacteria 539
475 Ga0316592_1000662 3300033524 Bacteria 5022
476 Ga0316592_1000955 3300033524 Bacteria 4438
477 Ga0316592_1001027 3300033524 Bacteria 4334
478 Ga0316592_1001802 3300033524 Bacteria 3568
479 Ga0316592_1002156 3300033524 Bacteria 3355
480 Ga0316592_1002445 3300033524 Bacteria 3211
481 Ga0316592_1007962 3300033524 Bacteria 2080
482 Ga0316592_1039484 3300033524 Bacteria 1043
483 Ga0316592_1054794 3300033524 Bacteria 892
484 Ga0316592_1067077 3300033524 Bacteria 809
485 Ga0316592_1099061 3300033524 Bacteria 670
486 Ga0316592_1126026 3300033524 Bacteria 596
487 Ga0316592_1145451 3300033524 Bacteria 558
488 Ga0316586_1000181 3300033527 Bacteria 5262
489 Ga0316586_1000255 3300033527 Bacteria 4665
490 Ga0316586_1008483 3300033527 Bacteria 1525
491 Ga0316586_1008737 3300033527 Bacteria 1506
492 Ga0316586_1071432 3300033527 Bacteria 640
493 Ga0316588_1000659 3300033528 Bacteria 5008
494 Ga0316588_1000759 3300033528 Bacteria 4790
495 Ga0316588_1000948 3300033528 Bacteria 4477
496 Ga0316588_1001353 3300033528 Bacteria 3982
497 Ga0316588_1001472 3300033528 Bacteria 3874
498 Ga0316588_1002494 3300033528 Bacteria 3210
499 Ga0316588_1005683 3300033528 Bacteria 2447
500 Ga0316588_1013709 3300033528 Bacteria 1763
501 Ga0316588_1029418 3300033528 Bacteria 1284
502 Ga0316588_1149495 3300033528 Bacteria 599
503 Ga0316587_1000871 3300033529 Bacteria 3412
504 Ga0316587_1001166 3300033529 Bacteria 3129
505 Ga0316587_1002730 3300033529 Bacteria 2393
506 Ga0316587_1019796 3300033529 Bacteria 1140
507 Ga0316587_1022964 3300033529 Bacteria 1072
508 Ga0316587_1025453 3300033529 Bacteria 1028
509 Ga0316587_1025912 3300033529 Bacteria 1020
510 Ga0316587_1044150 3300033529 Bacteria 809
511 Ga0316587_1054006 3300033529 Bacteria 739
512 Ga0316587_1095463 3300033529 Bacteria 570
513 Ga0316596_1000015 3300033541 Bacteria 16015
514 Ga0316596_1000019 3300033541 Bacteria 14934
515 Ga0316596_1000051 3300033541 Bacteria 12718
516 Ga0316596_1003186 3300033541 Bacteria 3575
517 Ga0316596_1003324 3300033541 Bacteria 3511
518 Ga0316596_1003362 3300033541 Bacteria 3499
519 Ga0316596_1004711 3300033541 Bacteria 3079
520 Ga0316596_1004760 3300033541 Bacteria 3065
521 Ga0316596_1014132 3300033541 Bacteria 1977
522 Ga0316596_1038286 3300033541 Bacteria 1256
523 Ga0316596_1040097 3300033541 Bacteria 1229
524 Ga0316596_1052486 3300033541 Bacteria 1081
525 Ga0316596_1087267 3300033541 Bacteria 840
526 Ga0316596_1090373 3300033541 Bacteria 825
527 Ga0316596_1106758 3300033541 Bacteria 759
528 Ga0316596_1110717 3300033541 Bacteria 745
529 Ga0316596_1166113 3300033541 Bacteria 608
530 Ga0316212_1002571 3300033547 Bacteria 2593
531 Ga0316212_1006236 3300033547 Bacteria 1729
532 Ga0373926_0174374 3300035083 Bacteria 823
533 Ga0373934_0116127 3300035086 Bacteria 1087
534 Ga0373934_0224577 3300035086 Bacteria 775
535 Ga0373923_0021564 3300035111 Bacteria 2516
536 Ga0373923_0105810 3300035111 Bacteria 1245
537 Ga0373932_0362169 3300035112 Bacteria 554
538 Ga0373953_0012646 3300035117 Bacteria 2995
539 Ga0373953_0249313 3300035117 Bacteria 772
540 Ga0373954_0004146 3300035118 Bacteria 6209
541 Ga0373954_0054945 3300035118 Bacteria 1873
542 Ga0373956_0001921 3300035119 Bacteria 8573
543 Ga0373956_0262775 3300035119 Bacteria 821
544 Ga0373956_0588856 3300035119 Bacteria 531
545 Ga0373957_0000289 3300035120 Bacteria 12644
546 Ga0373946_0041980 3300035171 Bacteria 1878
547 Ga0373946_0104855 3300035171 Bacteria 1272
548 Ga0373955_0005175 3300035172 Bacteria 5836
549 Ga0373955_0158603 3300035172 Bacteria 1334
550 Ga0373955_0353005 3300035172 Bacteria 891
551 Ga0373955_0582717 3300035172 Bacteria 685
552 Ga0316574_0129363 3300035398 Bacteria 1624
553 Ga0316574_0165133 3300035398 Bacteria 1426
554 Ga0373924_0036091 3300035410 Bacteria 2007
555 Ga0373931_0596196 3300035691 Bacteria 722
556 Ga0373935_0036026 3300035692 Bacteria 3091
557 Ga0373935_0482747 3300035692 Bacteria 898
558 Ga0373927_0014376 3300035695 Bacteria 5240
559 Ga0373927_0091563 3300035695 Bacteria 1975
560 Ga0373933_0008697 3300035724 Bacteria 5535
561 Ga0373933_0056998 3300035724 Bacteria 2347
562 Ga0373933_0746621 3300035724 Bacteria 644
563 Ga0373947_0000905 3300035725 Bacteria 17957
564 Ga0373947_0212700 3300035725 Bacteria 1269
565 Ga0373937_0024810 3300036401 Bacteria 5411
566 Ga0373937_0053565 3300036401 Bacteria 3700
567 Ga0373937_0185079 3300036401 Bacteria 1956
568 Ga0373937_0885021 3300036401 Bacteria 842
569 Ga0316582_0002761 3300036647 Bacteria 8355
570 Ga0316582_0010159 3300036647 Bacteria 5144
571 Ga0316582_0401048 3300036647 Bacteria 945
572 Ga0316582_1247372 3300036647 Bacteria 506
573 Ga0316584_0001067 3300036712 Bacteria 15995
574 Ga0316584_0027859 3300036712 Bacteria 4160
575 Ga0316584_0087558 3300036712 Bacteria 2331
576 Ga0316584_0167910 3300036712 Bacteria 1629
577 Ga0316584_0542668 3300036712 Bacteria 813
578 Ga0373925_0248932 3300037068 Bacteria 1425
579 Ga0373925_0571442 3300037068 Bacteria 930
580 Ga0395899_0007266 3300037312 Bacteria 8568
581 Ga0395899_0326214 3300037312 Bacteria 1033
582 Ga0395900_0037779 3300037418 Bacteria 4977
583 Ga0395900_0660692 3300037418 Bacteria 981
584 Ga0395900_0964913 3300037418 Bacteria 773
585 Ga0395898_0240331 3300037466 Bacteria 1727
586 Ga0395898_0684801 3300037466 Bacteria 967
587 Ga0395898_0958273 3300037466 Bacteria 792
588 Ga0395905_0000376 3300037471 Bacteria 63695
589 Ga0395905_0563765 3300037471 Bacteria 1040
590 Ga0395905_1233340 3300037471 Bacteria 651
591 Ga0395901_0116510 3300038443 Bacteria 2806
592 Ga0395901_0329662 3300038443 Bacteria 1578
593 Ga0395901_1495669 3300038443 Bacteria 631
594 Ga0400483_016634 3300039062 Bacteria 3272
595 Ga0400483_024254 3300039062 Bacteria 2169
596 Ga0400483_121213 3300039062 Bacteria 1059
597 Ga0400483_145883 3300039062 Bacteria 4531
598 Ga0436365_0074160 3300039437 Bacteria 506
599 Ga0436365_1256045 3300039437 Bacteria 3452
600 Ga0436361_0557259 3300039447 Bacteria 1151
601 Ga0436362_0113140 3300039453 Bacteria 598
602 Ga0436362_1100490 3300039453 Bacteria 850
603 Ga0451794_33567 3300041446 Bacteria 593
604 Ga0451795_0631926 3300041456 Bacteria 942
605 Ga0451805_008458 3300041461 Bacteria 653
606 Ga0451837_0887641 3300041494 Bacteria 727
607 Ga0451852_16322 3300041508 Bacteria 501
608 Ga0451843_1239513 3300041509 Bacteria 1088
609 Ga0451577_0000092 3300042876 Bacteria 198898
610 Ga0451577_0002251 3300042876 Bacteria 23422
611 Ga0451577_0017091 3300042876 Bacteria 6708
612 Ga0451577_0037725 3300042876 Bacteria 4349
613 Ga0451577_0155638 3300042876 Bacteria 2057
614 Ga0451577_0225538 3300042876 Bacteria 1694
615 Ga0451577_0239036 3300042876 Bacteria 1643
616 Ga0451577_0418106 3300042876 Bacteria 1217
617 Ga0451577_0898726 3300042876 Bacteria 797
618 Ga0451577_1002833 3300042876 Bacteria 750
619 Ga0451577_1273950 3300042876 Bacteria 654
620 Ga0453683_0000522 3300044673 Bacteria 43145
621 Ga0453683_0000935 3300044673 Bacteria 27791
622 Ga0453683_0006598 3300044673 Bacteria 7948
623 Ga0453683_0025793 3300044673 Bacteria 3731
624 Ga0453683_0028929 3300044673 Bacteria 3506
625 Ga0453683_0171760 3300044673 Bacteria 1373
626 Ga0453683_0310911 3300044673 Bacteria 1009
627 Ga0453683_0661052 3300044673 Bacteria 683
628 Ga0453683_1056882 3300044673 Bacteria 540
629 Ga0453684_0000432 3300044712 Bacteria 170746
630 Ga0453684_0001193 3300044712 Bacteria 80343
631 Ga0453684_0002324 3300044712 Bacteria 46610
632 Ga0453684_0048592 3300044712 Bacteria 5606
633 Ga0453684_0055571 3300044712 Bacteria 5146
634 Ga0453684_0058446 3300044712 Bacteria 4981
635 Ga0453684_0070061 3300044712 Bacteria 4443
636 Ga0453684_0073743 3300044712 Bacteria 4301
637 Ga0453684_0087736 3300044712 Bacteria 3854
638 Ga0453684_0141642 3300044712 Bacteria 2870
639 Ga0453684_0219846 3300044712 Bacteria 2201
640 Ga0453684_0267587 3300044712 Bacteria 1955
641 Ga0453684_0479027 3300044712 Bacteria 1381
642 Ga0453684_0589068 3300044712 Bacteria 1220
643 Ga0453684_1075362 3300044712 Bacteria 851
644 Ga0453684_1309569 3300044712 Bacteria 755
645 Ga0453684_2108582 3300044712 Bacteria 565
646 Ga0453684_2291792 3300044712 Bacteria 537
647 Ga0466968_0241135 3300044735 Bacteria 856
648 Ga0466957_0834350 3300044842 Bacteria 656
649 Ga0466957_1447120 3300044842 Bacteria 501
650 Ga0466960_0038323 3300044901 Bacteria 2253
651 Ga0466960_0110797 3300044901 Bacteria 1426
652 Ga0466960_0418190 3300044901 Bacteria 774
653 Ga0466960_0612666 3300044901 Bacteria 647
654 Ga0451576_0000003 3300045051 Bacteria 1550573
655 Ga0451576_0000113 3300045051 Bacteria 208644
656 Ga0451576_0001103 3300045051 Bacteria 49329
657 Ga0451576_0017828 3300045051 Bacteria 7799
658 Ga0451576_0067033 3300045051 Bacteria 3736
659 Ga0451576_0163274 3300045051 Bacteria 2324
660 Ga0451576_0208325 3300045051 Bacteria 2042
661 Ga0451576_0257261 3300045051 Bacteria 1825
662 Ga0451576_0524010 3300045051 Bacteria 1245
663 Ga0451576_0720739 3300045051 Bacteria 1048
664 Ga0451576_1642384 3300045051 Bacteria 666
665 Ga0466967_1001337 3300045976 Bacteria 832
666 Ga0495592_0000015 3300046454 Bacteria 145683
667 Ga0495592_0043671 3300046454 Bacteria 3352
668 Ga0495592_0051472 3300046454 Bacteria 3059
669 Ga0495592_0059446 3300046454 Bacteria 2815
670 Ga0495592_0116904 3300046454 Bacteria 1881
671 Ga0495592_0118228 3300046454 Bacteria 1868
672 Ga0495629_0491777 3300046459 Bacteria 828
673 Ga0495641_0147058 3300046461 Bacteria 1053
674 Ga0495651_0036587 3300046462 Bacteria 3822
675 Ga0495651_0055165 3300046462 Bacteria 3054
676 Ga0495651_0072417 3300046462 Bacteria 2617
677 Ga0495653_0014747 3300046463 Bacteria 6373
678 Ga0495653_0168461 3300046463 Bacteria 1514
679 Ga0495650_0000121 3300046471 Bacteria 183055
680 Ga0495580_0054728 3300046472 Bacteria 2813
681 Ga0495580_0258517 3300046472 Bacteria 1191
682 Ga0495582_0258942 3300046473 Bacteria 998
683 Ga0495639_0404316 3300046475 Bacteria 690
684 Ga0495639_0489934 3300046475 Bacteria 627
685 Ga0495662_0011984 3300046476 Bacteria 4237
686 Ga0495664_0060251 3300046477 Bacteria 2260
687 Ga0495664_0124483 3300046477 Bacteria 1559
688 Ga0495664_0133073 3300046477 Bacteria 1506
689 Ga0495594_0158317 3300046499 Bacteria 1287
690 Ga0495608_0008358 3300046511 Bacteria 7258
691 Ga0495608_0028526 3300046511 Bacteria 3793
692 Ga0495608_0082753 3300046511 Bacteria 2084
693 Ga0495618_0004868 3300046514 Bacteria 8201
694 Ga0495618_0247707 3300046514 Bacteria 1118
695 Ga0495618_0431316 3300046514 Bacteria 802
696 Ga0495628_0000140 3300046516 Bacteria 62202
697 Ga0495628_0001930 3300046516 Bacteria 18824
698 Ga0495628_0108928 3300046516 Bacteria 2132
699 Ga0495628_0131261 3300046516 Bacteria 1916
700 Ga0495628_0398014 3300046516 Bacteria 1006
701 Ga0495628_0894785 3300046516 Bacteria 616
702 Ga0495628_0983104 3300046516 Bacteria 581
703 Ga0495630_0004677 3300046517 Bacteria 9607
704 Ga0495630_0008269 3300046517 Bacteria 7472
705 Ga0495630_0052655 3300046517 Bacteria 3048
706 Ga0495630_0091375 3300046517 Bacteria 2300
707 Ga0495630_1530036 3300046517 Bacteria 500
708 Ga0495666_0051031 3300046526 Bacteria 1988
709 Ga0495666_0064047 3300046526 Bacteria 1755
710 Ga0495652_0014402 3300046529 Bacteria 7100
711 Ga0495652_0104883 3300046529 Bacteria 2285
712 Ga0495652_0186269 3300046529 Bacteria 1588
713 Ga0495652_0659315 3300046529 Bacteria 708
714 Ga0495665_0003304 3300046531 Bacteria 8738
715 Ga0495665_0498767 3300046531 Bacteria 613
716 Ga0495640_0016376 3300046533 Bacteria 5546
717 Ga0495640_0319729 3300046533 Bacteria 961
718 Ga0495640_0847254 3300046533 Bacteria 543
719 Ga0495586_0000942 3300046535 Bacteria 16500
720 Ga0495586_0035973 3300046535 Bacteria 2659
721 Ga0495586_0492190 3300046535 Bacteria 707
722 Ga0495587_0002155 3300046536 Bacteria 13171
723 Ga0495587_0020580 3300046536 Bacteria 4071
724 Ga0495645_0002009 3300046543 Bacteria 13855
725 Ga0495645_0121158 3300046543 Bacteria 1841
726 Ga0495645_0247946 3300046543 Bacteria 1185
727 Ga0495622_0509001 3300046557 Bacteria 514
728 Ga0495667_0017783 3300046559 Bacteria 4802
729 Ga0495667_0125252 3300046559 Bacteria 1658
730 Ga0495667_0359202 3300046559 Bacteria 920
731 Ga0495634_0081968 3300046642 Bacteria 2109
732 Ga0495635_0049231 3300046663 Bacteria 2904
733 Ga0495635_0131153 3300046663 Bacteria 1708
734 Ga0495635_0181088 3300046663 Bacteria 1432
735 Ga0495588_0270336 3300046674 Bacteria 895
736 Ga0495657_0066320 3300046675 Bacteria 2371
737 Ga0495657_0110556 3300046675 Bacteria 1741
738 Ga0495657_0151267 3300046675 Bacteria 1441
739 Ga0495657_0335417 3300046675 Bacteria 897
740 Ga0495599_0021784 3300046678 Bacteria 4000
741 Ga0495599_0098721 3300046678 Bacteria 1820
742 Ga0495599_0177850 3300046678 Bacteria 1312
743 Ga0495623_0015674 3300046679 Bacteria 4898
744 Ga0495623_0137933 3300046679 Bacteria 1454
745 Ga0495623_0269529 3300046679 Bacteria 951
746 Ga0495646_0014717 3300046680 Bacteria 4972
747 Ga0495646_0046689 3300046680 Bacteria 2639
748 Ga0495658_0002307 3300046683 Bacteria 9627
749 Ga0495658_0091811 3300046683 Bacteria 1799
750 Ga0495613_0180121 3300046689 Bacteria 1497
751 Ga0495613_0253462 3300046689 Bacteria 1228
752 Ga0495624_0016372 3300046690 Bacteria 4990
753 Ga0495624_0146504 3300046690 Bacteria 1445
754 Ga0495600_0303358 3300046809 Bacteria 1007
755 Ga0495600_0378201 3300046809 Bacteria 884
756 Ga0495604_0002807 3300047317 Bacteria 13979
757 Ga0495604_0019334 3300047317 Bacteria 5452
758 Ga0495604_0081209 3300047317 Bacteria 2427
759 Ga0495604_0270715 3300047317 Bacteria 1151
760 Ga0495604_0506652 3300047317 Bacteria 782
761 Ga0495674_0000992 3300047319 Bacteria 27284
762 Ga0495674_0015976 3300047319 Bacteria 7007
763 Ga0495674_0049324 3300047319 Bacteria 3721
764 Ga0495674_0072689 3300047319 Bacteria 2966
765 Ga0495674_0213133 3300047319 Bacteria 1599
766 Ga0495676_0026951 3300047321 Bacteria 4936
767 Ga0495680_0010376 3300047322 Bacteria 8313
768 Ga0495680_0037174 3300047322 Bacteria 3902
769 Ga0495680_0134879 3300047322 Bacteria 1811
770 Ga0495680_0161336 3300047322 Bacteria 1628
771 Ga0495675_0002873 3300047444 Bacteria 10333
772 Ga0495675_0004854 3300047444 Bacteria 8180
773 Ga0495684_0005513 3300047471 Bacteria 9853
774 Ga0495684_0036919 3300047471 Bacteria 3746
775 Ga0495684_0077651 3300047471 Bacteria 2520
776 Ga0495684_0111921 3300047471 Bacteria 2059
777 Ga0495593_0010826 3300047673 Bacteria 5259
778 Ga0495602_0090783 3300048088 Bacteria 2536
779 Ga0495602_0126705 3300048088 Bacteria 2044
780 Ga0495602_0262442 3300048088 Bacteria 1280
781 Ga0495614_0058406 3300048089 Bacteria 1656
782 Ga0495614_0174547 3300048089 Bacteria 965
783 Ga0495615_0283139 3300048090 Bacteria 533
784 Ga0496102_0463485 3300048905 Bacteria 1188
785 Ga0496103_0358492 3300048906 Bacteria 937
786 Ga0496104_0639534 3300048907 Bacteria 973
787 Ga0496104_1690417 3300048907 Bacteria 535
788 Ga0496107_0590638 3300048910 Bacteria 821
789 Ga0496107_0630963 3300048910 Bacteria 791
790 Ga0496109_1297456 3300048912 Bacteria 664
791 Ga0496112_0000516 3300048915 Bacteria 26268
792 Ga0496112_0256546 3300048915 Bacteria 1699
793 Ga0496112_0394878 3300048915 Bacteria 1323
794 Ga0496113_0032155 3300048916 Bacteria 3812
795 Ga0496115_0333657 3300048918 Bacteria 1239
796 Ga0496115_0730131 3300048918 Bacteria 776
797 Ga0496119_0381322 3300048922 Bacteria 676
798 Ga0496121_0006505 3300048924 Bacteria 14454
799 Ga0496125_0004021 3300048928 Bacteria 17262
800 Ga0496125_0010850 3300048928 Bacteria 9171
801 Ga0501306_003070 3300049127 Bacteria 1770
802 Ga0501306_104614 3300049127 Bacteria 509
803 Ga0501308_007513 3300049128 Bacteria 1143
804 Ga0501308_034137 3300049128 Bacteria 694
805 Ga0501308_052445 3300049128 Bacteria 600
806 Ga0501309_064488 3300049129 Bacteria 594
807 Ga0501304_001315 3300049160 Bacteria 1570
808 Ga0501305_116230 3300049161 Bacteria 510
809 Ga0501305_116248 3300049161 Bacteria 510
810 Ga0501307_018937 3300049162 Bacteria 879
811 Ga0501292_042392 3300049515 Bacteria 789
812 Ga0501311_026839 3300049527 Bacteria 814
813 Ga0501311_032212 3300049527 Bacteria 764
814 Ga0501312_045365 3300049528 Bacteria 728
815 Ga0501313_031423 3300049529 Bacteria 690
816 Ga0501318_084511 3300049534 Bacteria 518
817 Ga0501319_031007 3300049535 Bacteria 514
818 Ga0501320_030333 3300049536 Bacteria 670
819 Ga0501320_036925 3300049536 Bacteria 628
820 Ga0501320_066742 3300049536 Bacteria 514
821 Ga0501031_0009956 3300049568 Bacteria 6190
822 Ga0501032_0199597 3300049569 Bacteria 1305
823 Ga0501033_0029262 3300049570 Bacteria 4139
824 Ga0501034_0095132 3300049571 Bacteria 2975
825 Ga0501034_0408012 3300049571 Bacteria 1281
826 Ga0501034_0990356 3300049571 Bacteria 725
827 Ga0501036_0014384 3300049572 Bacteria 6589
828 Ga0501037_0108066 3300049573 Bacteria 2004
829 Ga0501038_0005590 3300049574 Bacteria 11667
830 Ga0501038_1259750 3300049574 Bacteria 535
831 Ga0501039_0121352 3300049575 Bacteria 2048
832 Ga0501040_0359091 3300049576 Bacteria 1044
833 Ga0501043_0440364 3300049579 Bacteria 980
834 Ga0501043_0695671 3300049579 Bacteria 743
835 Ga0501046_0034880 3300049580 Bacteria 4057
836 Ga0501046_0778081 3300049580 Bacteria 671
837 Ga0501047_0308480 3300049581 Bacteria 1423
838 Ga0501048_0008581 3300049582 Bacteria 7716
839 Ga0501048_0169189 3300049582 Bacteria 1548
840 Ga0501067_0006705 3300049583 Bacteria 6392
841 Ga0501067_0009843 3300049583 Bacteria 5294
842 Ga0501067_0391562 3300049583 Bacteria 775
843 Ga0501069_0090513 3300049585 Bacteria 1730
844 Ga0501071_0061932 3300049587 Bacteria 2710
845 Ga0501071_0477217 3300049587 Bacteria 956
846 Ga0501071_0988280 3300049587 Bacteria 650
847 Ga0501072_1174545 3300049588 Bacteria 596
848 Ga0501073_0159025 3300049589 Bacteria 1565
849 Ga0501074_0013273 3300049590 Bacteria 5989
850 Ga0501074_0130988 3300049590 Bacteria 1794
851 Ga0501074_0146862 3300049590 Bacteria 1686
852 Ga0501075_0220466 3300049591 Bacteria 1447
853 Ga0501075_0469804 3300049591 Bacteria 959
854 Ga0501077_0230973 3300049593 Bacteria 1176
855 Ga0501242_026540 3300049674 Bacteria 767
856 Ga0501257_097188 3300049686 Bacteria 770
857 Ga0501079_0665848 3300049741 Bacteria 819
858 Ga0501079_1217808 3300049741 Bacteria 593
859 Ga0501080_0191461 3300049742 Bacteria 1879
860 Ga0501080_1091273 3300049742 Bacteria 689
861 Ga0501083_0041703 3300049744 Bacteria 3112
862 Ga0501083_0520694 3300049744 Bacteria 774
863 Ga0501035_0040785 3300049822 Bacteria 4193
864 Ga0501035_1115667 3300049822 Bacteria 615
865 Ga0501044_0013375 3300049823 Bacteria 8874
866 Ga0501044_0078916 3300049823 Bacteria 3336
867 Ga0501045_1230145 3300049824 Bacteria 546
868 nmdc:mga06z11_301313_c1 3300050494 Bacteria 953
869 nmdc:mga05p37_1927286_c1 3300050507 Bacteria 563
870 nmdc:mga09592_172694_c1 3300050508 Bacteria 1869
871 nmdc:mga09592_185333_c1 3300050508 Bacteria 1801
872 nmdc:mga09592_458615_c1 3300050508 Bacteria 1099
873 nmdc:mga09592_926227_c1 3300050508 Unclassified 731
874 nmdc:mga0qj67_281355_c1 3300050509 Bacteria 1348
875 nmdc:mga0qj67_3985_c2 3300050509 Bacteria 4055
876 nmdc:mga06r32_268624_c1 3300050510 Bacteria 1693
877 nmdc:mga06r32_319969_c1 3300050510 Bacteria 1537
878 nmdc:mga06r32_54362_c1 3300050510 Bacteria 3839
879 nmdc:mga08y16_18794_c1 3300050511 Bacteria 7281
880 nmdc:mga08y16_468499_c1 3300050511 Bacteria 1283
881 nmdc:mga08y16_932106_c1 3300050511 Bacteria 853
882 nmdc:mga0n895_2004878_c1 3300050512 Bacteria 536
883 nmdc:mga0rr50_382368_c1 3300050513 Bacteria 1187
884 nmdc:mga08x19_22048_c1 3300050514 Bacteria 3940
885 nmdc:mga0a205_116758_c1 3300050515 Bacteria 2567
886 nmdc:mga0a205_232987_c1 3300050515 Bacteria 1724
887 nmdc:mga0a205_602712_c1 3300050515 Bacteria 951
888 nmdc:mga0a205_69251_c1 3300050515 Bacteria 3408
889 nmdc:mga0a205_968698_c1 3300050515 Bacteria 697
890 Ga0495601_0230599 3300053077 Bacteria 1209
891 Ga0495601_0394008 3300053077 Bacteria 898
892 Ga0495612_0328643 3300053078 Bacteria 688
893 Ga0495595_0156992 3300053084 Bacteria 1121
894 Ga0495595_0197946 3300053084 Bacteria 1000
895 Ga0495619_0010291 3300053085 Bacteria 5888
896 Ga0501084_0045171 3300054114 Bacteria 3689
897 Ga0501084_0824520 3300054114 Bacteria 781
898 Ga0501084_1281179 3300054114 Bacteria 614
899 Ga0587080_081379 3300059503 Bacteria 665
900 Ga0587086_030397 3300059507 Bacteria 791
901 Ga0587090_127125 3300059510 Bacteria 558
902 Ga0587109_133264 3300059624 Bacteria 601
903 Ga0587062_081960 3300059639 Bacteria 601
904 Ga0587072_134023 3300059643 Bacteria 585
905 Ga0587072_201303 3300059643 Bacteria 506
906 Ga0587078_078141 3300059646 Bacteria 527
907 Ga0501082_0142204 3300060353 Bacteria 2082
908 2511697993 2511231119 Bacteria 4019861
909 2545559768 2545555800 Bacteria 4222588
910 2578930725 2576861599 Bacteria 4217202
911 2631982472 2630968484 Bacteria 3876276
912 2651530336 2648501850 Bacteria 3975476
913 2674421109 2671180844 Bacteria 4164150
914 2695629913 2695420354 Bacteria 3922431
915 2717918188 2716884898 Bacteria 3928789
916 2788433934 2786546940 Bacteria 6396474
917 2809057194 2808606399 Bacteria 4021018
918 2817478182 2816332295 Bacteria 4352468
919 2857608878 2857604169 Bacteria 5111450
920 2860837572 2860837431 Bacteria 4202080
921 2877768791 2877768649 Bacteria 3957164
922 2880169733 2880169592 Bacteria 3900066
923 2897109760 2897109615 Bacteria 4009619
924 2904564582 2904560550 Bacteria 4029838
925 2916972069 2916971899 Bacteria 4250608
926 2962290783 2962290636 Bacteria 4072939
927 2964375278 2964375228 Bacteria 4909004
928 2969136990 2969136845 Bacteria 3923176
929 2969141159 2969141011 Bacteria 4118468
930 2969766261 2969765954 Bacteria 4216713
931 2969774929 2969770375 Bacteria 4271280
932 2971893520 2971893375 Bacteria 3929648
933 2980492734 2980492589 Bacteria 4072961
934 3006828577 3006826541 Bacteria 4678913
935 3006858510 3006858327 Bacteria 4317835
936 3006883621 3006879489 Bacteria 4064221
937 3006973804 3006969106 Bacteria 4739423
938 8022631648 8022630665 Bacteria 3886130
939 8022655870 8022653035 Bacteria 4035078
940 8051956503 8051952484 Bacteria 3926774
941 8052174979 8052174270 Bacteria 3881265
942 Ga0400483_266032
943 Ga0006759J45824_1150259
944 rootH1_10069712
945 rootH1_10403485
946 Ga0065707_10167338
947 Ga0070676_11259696
948 Ga0070683_100648598
949 Ga0070690_100530485
950 Ga0070670_100590010
951 Ga0068869_100099622
952 Ga0070680_100355547
953 Ga0070682_100791466
954 Ga0070689_101065984
955 Ga0070689_101343123
956 Ga0070689_101454326
957 Ga0070692_10380746
958 Ga0070674_100068400
959 Ga0070673_100506945
960 Ga0070667_101407232
961 Ga0070703_10037289
962 Ga0070709_10006493
963 Ga0070709_10068471
964 Ga0070714_100506323
965 Ga0070714_100758792
966 Ga0070713_100002365
967 Ga0070713_100016190
968 Ga0070713_100242785
969 Ga0070713_100428436
970 Ga0070713_100854865
971 Ga0070710_10043474
972 Ga0070710_10166147
973 Ga0070710_10273875
974 Ga0070710_11159375
975 Ga0070701_10184773
976 Ga0070711_100001449
977 Ga0070711_100045540
978 Ga0070711_100090240
979 Ga0070711_100130525
980 Ga0070711_101221300
981 Ga0070705_100086727
982 Ga0070705_100925381
983 Ga0070705_101040583
984 Ga0070705_101487901
985 Ga0070694_100008757
986 Ga0070708_100004769
987 Ga0070708_100016611
988 Ga0070708_100807413
989 Ga0070708_100974040
990 Ga0070678_100070409
991 Ga0070681_10198635
992 Ga0070681_10700340
993 Ga0068867_100257994
994 Ga0068867_100259979
995 Ga0070706_100027065
996 Ga0070706_100038479
997 Ga0070706_100045252
998 Ga0070706_100090069
999 Ga0070706_100233626
1000 Ga0070707_100010443
1001 Ga0070707_100012413
1002 Ga0070707_100014471
1003 Ga0070707_101011500
1004 Ga0070698_100003219
1005 Ga0070698_100065898
1006 Ga0070698_100068156
1007 Ga0070698_100480315
1008 Ga0070698_100911535
1009 Ga0070698_101394679
1010 Ga0070699_100037932
1011 Ga0070699_100063431
1012 Ga0070699_100186526
1013 Ga0070699_100334911
1014 Ga0070679_100024467
1015 Ga0070679_100685245
1016 Ga0070684_101702750
1017 Ga0070697_100130858
1018 Ga0070697_100414395
1019 Ga0070697_100593093
1020 Ga0070697_101102441
1021 Ga0070697_101315149
1022 Ga0070697_101446656
1023 Ga0070697_101554003
1024 Ga0070672_100013159
1025 Ga0070686_100356003
1026 Ga0070695_100027795
1027 Ga0070695_100124337
1028 Ga0070696_100003003
1029 Ga0070696_100044176
1030 Ga0070696_100648192
1031 Ga0070696_102020260
1032 Ga0070693_100000994
1033 Ga0070665_100000700
1034 Ga0070665_100004237
1035 Ga0070665_102085204
1036 Ga0070704_100003283
1037 Ga0070704_100377124
1038 Ga0070704_100615286
1039 Ga0070704_101517299
1040 Ga0068854_100489662
1041 Ga0068854_100906868
1042 Ga0068856_100465458
1043 Ga0068864_101268011
1044 Ga0068861_101020095
1045 Ga0068870_10529830
1046 Ga0068863_100014791
1047 Ga0068858_100088230
1048 Ga0068860_100010580
1049 Ga0068860_100509204
1050 Ga0068862_100333204
1051 Ga0081455_10002585
1052 Ga0081455_10157276
1053 Ga0081538_10000250
1054 Ga0081538_10002047
1055 Ga0081538_10019032
1056 Ga0081538_10138015
1057 Ga0070715_10082874
1058 Ga0070715_10208809
1059 Ga0070715_10212958
1060 Ga0070716_100041393
1061 Ga0070716_100604165
1062 Ga0070716_101367341
1063 Ga0070712_100072105
1064 Ga0070712_100255026
1065 Ga0070712_100351408
1066 Ga0070712_100452968
1067 Ga0070712_101024728
1068 Ga0097621_100171453
1069 Ga0097621_100332534
1070 Ga0097621_100689135
1071 Ga0097621_100726987
1072 Ga0068871_100022756
1073 Ga0068871_100716246
1074 Ga0068871_101560463
1075 Ga0075428_100263152
1076 Ga0075428_100269384
1077 Ga0075428_101151503
1078 Ga0075428_102356328
1079 Ga0075430_100039669
1080 Ga0075430_100225464
1081 Ga0075430_100829049
1082 Ga0075431_100063276
1083 Ga0075431_100452149
1084 Ga0075431_101034084
1085 Ga0075431_101113721
1086 Ga0075433_10024717
1087 Ga0075433_10060259
1088 Ga0075433_10688173
1089 Ga0075433_11130862
1090 Ga0075434_100063706
1091 Ga0075434_100084572
1092 Ga0075434_101387012
1093 Ga0075429_100048515
1094 Ga0075429_100267299
1095 Ga0075429_100284342
1096 Ga0075429_100602085
1097 Ga0075429_100672111
1098 Ga0068865_100072446
1099 Ga0068865_100204745
1100 Ga0068865_100712783
1101 Ga0068865_101932220
1102 Ga0075436_100005799
1103 Ga0075436_100009783
1104 Ga0075436_100800916
1105 Ga0075435_100140998
1106 Ga0075435_100805145
1107 Ga0075435_101405799
1108 Ga0099794_10014076
1109 Ga0099794_10023888
1110 Ga0099794_10035542
1111 Ga0099794_10113447
1112 Ga0099795_10004417
1113 Ga0099795_10030072
1114 Ga0099795_10086438
1115 Ga0105250_10425161
1116 Ga0105240_10004245
1117 Ga0105240_10121109
1118 Ga0105240_10274511
1119 Ga0105240_10922690
1120 Ga0111539_10023538
1121 Ga0111539_10140216
1122 Ga0111539_10456351
1123 Ga0105245_10033891
1124 Ga0105247_10279487
1125 Ga0114129_10814565
1126 Ga0105242_10247762
1127 Ga0105242_10654675
1128 Ga0105242_10912622
1129 Ga0105242_11090234
1130 Ga0105242_12148188
1131 Ga0105248_10373894
1132 Ga0105248_11056173
1133 Ga0105248_11706920
1134 Ga0105237_10072778
1135 Ga0105237_10150945
1136 Ga0105237_10222663
1137 Ga0099796_10063694
1138 Ga0105239_10022622
1139 Ga0105239_10030499
1140 Ga0105239_10544717
1141 Ga0157340_1008626
1142 Ga0157371_10272231
1143 Ga0157371_10410538
1144 Ga0157369_11202069
1145 Ga0157374_10000801
1146 Ga0157374_10119097
1147 Ga0157378_10000272
1148 Ga0157378_10000886
1149 Ga0157378_10010996
1150 Ga0157378_10438127
1151 Ga0157378_10888802
1152 Ga0157378_11598577
1153 Ga0163162_10374288
1154 Ga0163162_11107878
1155 Ga0157372_10098714
1156 Ga0157372_12959194
1157 Ga0157375_10313280
1158 Ga0157375_11315401
1159 Ga0157375_12507451
1160 Ga0157375_12673585
1161 Ga0157380_11062915
1162 Ga0157380_13475935
1163 Ga0157377_10540728
1164 Ga0157379_10056214
1165 Ga0157379_11034308
1166 Ga0157376_10000075
1167 Ga0157376_10002707
1168 Ga0157376_10226962
1169 Ga0157376_10438194
1170 Ga0157376_12354466
1171 Ga0182007_10392064
1172 Ga0184603_100407
1173 Ga0213873_10179721
1174 Ga0213876_10024420
1175 Ga0213876_10135418
1176 Ga0256720_139491
1177 Ga0228598_1004458
1178 Ga0228598_1004932
1179 Ga0207653_10022350
1180 Ga0207642_10082809
1181 Ga0207688_10661977
1182 Ga0207685_10053011
1183 Ga0207685_10274449
1184 Ga0207699_10022332
1185 Ga0207699_10059947
1186 Ga0207699_10175452
1187 Ga0207699_10186348
1188 Ga0207699_10317275
1189 Ga0207699_10339564
1190 Ga0207699_10674165
1191 Ga0207643_10554156
1192 Ga0207705_10162926
1193 Ga0207684_10010612
1194 Ga0207684_10021082
1195 Ga0207684_10027856
1196 Ga0207684_10126378
1197 Ga0207684_10424447
1198 Ga0207707_11559912
1199 Ga0207695_10104798
1200 Ga0207695_10184944
1201 Ga0207695_10861390
1202 Ga0207671_10094363
1203 Ga0207671_10767804
1204 Ga0207671_11231216
1205 Ga0207693_10043266
1206 Ga0207693_10118572
1207 Ga0207693_10159441
1208 Ga0207693_10413993
1209 Ga0207663_10026105
1210 Ga0207663_10076628
1211 Ga0207663_10125904
1212 Ga0207663_10465398
1213 Ga0207663_10496103
1214 Ga0207663_10546106
1215 Ga0207660_10288355
1216 Ga0207662_10723882
1217 Ga0207662_10876025
1218 Ga0207652_10032823
1219 Ga0207646_10001996
1220 Ga0207646_10016678
1221 Ga0207646_10093840
1222 Ga0207646_10242931
1223 Ga0207646_10317494
1224 Ga0207646_10669651
1225 Ga0207681_10887101
1226 Ga0207694_10482770
1227 Ga0207687_10777486
1228 Ga0207700_10002600
1229 Ga0207700_10067895
1230 Ga0207700_10167004
1231 Ga0207700_10220042
1232 Ga0207664_10482958
1233 Ga0207686_10250328
1234 Ga0207686_10698442
1235 Ga0207670_10288920
1236 Ga0207670_10384233
1237 Ga0207670_10954623
1238 Ga0207670_11160662
1239 Ga0207665_10005811
1240 Ga0207665_10031807
1241 Ga0207665_10090757
1242 Ga0207665_10135097
1243 Ga0207665_10138823
1244 Ga0207665_10559080
1245 Ga0207665_10695306
1246 Ga0207691_10479356
1247 Ga0207711_10306284
1248 Ga0207689_10183463
1249 Ga0207689_10612955
1250 Ga0207661_10938254
1251 Ga0207661_11042659
1252 Ga0207651_10788706
1253 Ga0207651_11330940
1254 Ga0207651_11465341
1255 Ga0207677_10206493
1256 Ga0207703_10017399
1257 Ga0207702_11581631
1258 Ga0207641_10006158
1259 Ga0207641_10924854
1260 Ga0207641_12459694
1261 Ga0207648_10286078
1262 Ga0207648_10339454
1263 Ga0207676_11250965
1264 Ga0207675_100097252
1265 Ga0207683_10030943
1266 Ga0209179_1017684
1267 Ga0209179_1030480
1268 Ga0209588_1009968
1269 Ga0209588_1013299
1270 Ga0209588_1023729
1271 Ga0207428_10687091
1272 Ga0265354_1000344
1273 Ga0268266_10000259
1274 Ga0268266_10016375
1275 Ga0268264_10016281
1276 Ga0268264_10019364
1277 Ga0265326_10057163
1278 Ga0265319_1000006
1279 Ga0265319_1004383
1280 Ga0265319_1005558
1281 Ga0265319_1025804
1282 Ga0265334_10062672
1283 Ga0265318_10000466
1284 Ga0265318_10002149
1285 Ga0265322_10079760
1286 Ga0265336_10026034
1287 Ga0265338_10051864
1288 Ga0265338_10065699
1289 Ga0265338_10070235
1290 Ga0265338_10219663
1291 Ga0265338_10426682
1292 Ga0265338_10650042
1293 Ga0265338_10912176
1294 Ga0311001_1083056
1295 Ga0310981_1060993
1296 Ga0265324_10325219
1297 Ga0265770_1003693
1298 Ga0265765_1006543
1299 Ga0265764_102136
1300 Ga0265773_1001638
1301 Ga0265760_10000026
1302 Ga0265760_10019572
1303 Ga0265760_10021342
1304 Ga0265760_10051624
1305 Ga0265330_10044087
1306 Ga0265332_10011115
1307 Ga0265332_10125373
1308 Ga0265328_10048044
1309 Ga0265328_10154371
1310 Ga0265328_10189103
1311 Ga0265328_10192958
1312 Ga0265320_10001540
1313 Ga0265320_10033071
1314 Ga0265320_10354462
1315 Ga0265325_10012503
1316 Ga0265325_10111536
1317 Ga0265329_10004500
1318 Ga0265329_10006079
1319 Ga0265329_10008477
1320 Ga0265329_10100232
1321 Ga0265340_10017605
1322 Ga0265340_10102258
1323 Ga0265339_10001807
1324 Ga0265331_10000025
1325 Ga0265331_10002674
1326 Ga0265331_10016846
1327 Ga0265331_10277030
1328 Ga0265316_10000784
1329 Ga0265316_10001106
1330 Ga0265316_10031378
1331 Ga0265316_10124722
1332 Ga0265316_10357170
1333 Ga0265316_10612981
1334 Ga0307509_10043415
1335 Ga0307408_100071079
1336 Ga0265313_10001605
1337 Ga0265313_10018591
1338 Ga0265313_10102933
1339 Ga0265313_10156241
1340 Ga0316575_10108542
1341 Ga0316579_10019575
1342 Ga0316579_10033104
1343 Ga0316579_10057060
1344 Ga0316579_10102736
1345 Ga0316579_10109614
1346 Ga0316579_10254432
1347 Ga0265314_10000087
1348 Ga0265314_10038233
1349 Ga0265314_10063634
1350 Ga0265314_10118535
1351 Ga0265342_10000362
1352 Ga0265342_10026417
1353 Ga0265342_10038414
1354 Ga0316576_10000859
1355 Ga0316576_10050533
1356 Ga0316576_10114440
1357 Ga0316576_10277870
1358 Ga0316576_10341683
1359 Ga0316576_10419265
1360 Ga0316576_10447642
1361 Ga0316576_10453360
1362 Ga0316576_10495153
1363 Ga0316576_10631927
1364 Ga0316576_10849366
1365 Ga0316576_11060207
1366 Ga0316578_10000241
1367 Ga0316578_10004865
1368 Ga0316578_10022633
1369 Ga0316578_10105859
1370 Ga0316578_10395493
1371 Ga0307405_10222748
1372 Ga0316577_10000447
1373 Ga0307413_10748047
1374 Ga0307410_10231950
1375 Ga0307406_10062091
1376 Ga0307406_11341423
1377 Ga0307407_10357030
1378 Ga0307412_10845582
1379 Ga0307409_100265902
1380 Ga0307409_101197534
1381 Ga0307416_100407877
1382 Ga0307416_100951267
1383 Ga0307414_12323689
1384 Ga0307411_11352474
1385 Ga0307411_11786736
1386 Ga0316053_104592
1387 Ga0307415_100241717
1388 Ga0316583_10000319
1389 Ga0316583_10305313
1390 Ga0316585_10004899
1391 Ga0316585_10111936
1392 Ga0316580_10002598
1393 Ga0316580_10102712
1394 Ga0316593_10000417
1395 Ga0316593_10000589
1396 Ga0316593_10000698
1397 Ga0316593_10000765
1398 Ga0316593_10001578
1399 Ga0316593_10001601
1400 Ga0316593_10001733
1401 Ga0316593_10003549
1402 Ga0316593_10004947
1403 Ga0316593_10008436
1404 Ga0316593_10018658
1405 Ga0316593_10019627
1406 Ga0316593_10032306
1407 Ga0316593_10058392
1408 Ga0316593_10062765
1409 Ga0316593_10064218
1410 Ga0316593_10067967
1411 Ga0316593_10094507
1412 Ga0316593_10095358
1413 Ga0316593_10108047
1414 Ga0316593_10341679
1415 Ga0316593_10386520
1416 Ga0316592_1000662
1417 Ga0316592_1000955
1418 Ga0316592_1001027
1419 Ga0316592_1001802
1420 Ga0316592_1002156
1421 Ga0316592_1002445
1422 Ga0316592_1007962
1423 Ga0316592_1039484
1424 Ga0316592_1054794
1425 Ga0316592_1067077
1426 Ga0316592_1099061
1427 Ga0316592_1126026
1428 Ga0316592_1145451
1429 Ga0316586_1000181
1430 Ga0316586_1000255
1431 Ga0316586_1008483
1432 Ga0316586_1008737
1433 Ga0316586_1071432
1434 Ga0316588_1000659
1435 Ga0316588_1000759
1436 Ga0316588_1000948
1437 Ga0316588_1001353
1438 Ga0316588_1001472
1439 Ga0316588_1002494
1440 Ga0316588_1005683
1441 Ga0316588_1013709
1442 Ga0316588_1029418
1443 Ga0316588_1149495
1444 Ga0316587_1000871
1445 Ga0316587_1001166
1446 Ga0316587_1002730
1447 Ga0316587_1019796
1448 Ga0316587_1022964
1449 Ga0316587_1025453
1450 Ga0316587_1025912
1451 Ga0316587_1044150
1452 Ga0316587_1054006
1453 Ga0316587_1095463
1454 Ga0316596_1000015
1455 Ga0316596_1000019
1456 Ga0316596_1000051
1457 Ga0316596_1003186
1458 Ga0316596_1003324
1459 Ga0316596_1003362
1460 Ga0316596_1004711
1461 Ga0316596_1004760
1462 Ga0316596_1014132
1463 Ga0316596_1038286
1464 Ga0316596_1040097
1465 Ga0316596_1052486
1466 Ga0316596_1087267
1467 Ga0316596_1090373
1468 Ga0316596_1106758
1469 Ga0316596_1110717
1470 Ga0316596_1166113
1471 Ga0316212_1002571
1472 Ga0316212_1006236
1473 Ga0373926_0174374
1474 Ga0373934_0116127
1475 Ga0373934_0224577
1476 Ga0373923_0021564
1477 Ga0373923_0105810
1478 Ga0373932_0362169
1479 Ga0373953_0012646
1480 Ga0373953_0249313
1481 Ga0373954_0004146
1482 Ga0373954_0054945
1483 Ga0373956_0001921
1484 Ga0373956_0262775
1485 Ga0373956_0588856
1486 Ga0373957_0000289
1487 Ga0373946_0041980
1488 Ga0373946_0104855
1489 Ga0373955_0005175
1490 Ga0373955_0158603
1491 Ga0373955_0353005
1492 Ga0373955_0582717
1493 Ga0316574_0129363
1494 Ga0316574_0165133
1495 Ga0373924_0036091
1496 Ga0373931_0596196
1497 Ga0373935_0036026
1498 Ga0373935_0482747
1499 Ga0373927_0014376
1500 Ga0373927_0091563
1501 Ga0373933_0008697
1502 Ga0373933_0056998
1503 Ga0373933_0746621
1504 Ga0373947_0000905
1505 Ga0373947_0212700
1506 Ga0373937_0024810
1507 Ga0373937_0053565
1508 Ga0373937_0185079
1509 Ga0373937_0885021
1510 Ga0316582_0002761
1511 Ga0316582_0010159
1512 Ga0316582_0401048
1513 Ga0316582_1247372
1514 Ga0316584_0001067
1515 Ga0316584_0027859
1516 Ga0316584_0087558
1517 Ga0316584_0167910
1518 Ga0316584_0542668
1519 Ga0373925_0248932
1520 Ga0373925_0571442
1521 Ga0395899_0007266
1522 Ga0395899_0326214
1523 Ga0395900_0037779
1524 Ga0395900_0660692
1525 Ga0395900_0964913
1526 Ga0395898_0240331
1527 Ga0395898_0684801
1528 Ga0395898_0958273
1529 Ga0395905_0000376
1530 Ga0395905_0563765
1531 Ga0395905_1233340
1532 Ga0395901_0116510
1533 Ga0395901_0329662
1534 Ga0395901_1495669
1535 Ga0400483_016634
1536 Ga0400483_024254
1537 Ga0400483_121213
1538 Ga0400483_145883
1539 Ga0436365_0074160
1540 Ga0436365_1256045
1541 Ga0436361_0557259
1542 Ga0436362_0113140
1543 Ga0436362_1100490
1544 Ga0451794_33567
1545 Ga0451795_0631926
1546 Ga0451805_008458
1547 Ga0451837_0887641
1548 Ga0451852_16322
1549 Ga0451843_1239513
1550 Ga0451577_0000092
1551 Ga0451577_0002251
1552 Ga0451577_0017091
1553 Ga0451577_0037725
1554 Ga0451577_0155638
1555 Ga0451577_0225538
1556 Ga0451577_0239036
1557 Ga0451577_0418106
1558 Ga0451577_0898726
1559 Ga0451577_1002833
1560 Ga0451577_1273950
1561 Ga0453683_0000522
1562 Ga0453683_0000935
1563 Ga0453683_0006598
1564 Ga0453683_0025793
1565 Ga0453683_0028929
1566 Ga0453683_0171760
1567 Ga0453683_0310911
1568 Ga0453683_0661052
1569 Ga0453683_1056882
1570 Ga0453684_0000432
1571 Ga0453684_0001193
1572 Ga0453684_0002324
1573 Ga0453684_0048592
1574 Ga0453684_0055571
1575 Ga0453684_0058446
1576 Ga0453684_0070061
1577 Ga0453684_0073743
1578 Ga0453684_0087736
1579 Ga0453684_0141642
1580 Ga0453684_0219846
1581 Ga0453684_0267587
1582 Ga0453684_0479027
1583 Ga0453684_0589068
1584 Ga0453684_1075362
1585 Ga0453684_1309569
1586 Ga0453684_2108582
1587 Ga0453684_2291792
1588 Ga0466968_0241135
1589 Ga0466957_0834350
1590 Ga0466957_1447120
1591 Ga0466960_0038323
1592 Ga0466960_0110797
1593 Ga0466960_0418190
1594 Ga0466960_0612666
1595 Ga0451576_0000003
1596 Ga0451576_0000113
1597 Ga0451576_0001103
1598 Ga0451576_0017828
1599 Ga0451576_0067033
1600 Ga0451576_0163274
1601 Ga0451576_0208325
1602 Ga0451576_0257261
1603 Ga0451576_0524010
1604 Ga0451576_0720739
1605 Ga0451576_1642384
1606 Ga0466967_1001337
1607 Ga0495592_0000015
1608 Ga0495592_0043671
1609 Ga0495592_0051472
1610 Ga0495592_0059446
1611 Ga0495592_0116904
1612 Ga0495592_0118228
1613 Ga0495629_0491777
1614 Ga0495641_0147058
1615 Ga0495651_0036587
1616 Ga0495651_0055165
1617 Ga0495651_0072417
1618 Ga0495653_0014747
1619 Ga0495653_0168461
1620 Ga0495650_0000121
1621 Ga0495580_0054728
1622 Ga0495580_0258517
1623 Ga0495582_0258942
1624 Ga0495639_0404316
1625 Ga0495639_0489934
1626 Ga0495662_0011984
1627 Ga0495664_0060251
1628 Ga0495664_0124483
1629 Ga0495664_0133073
1630 Ga0495594_0158317
1631 Ga0495608_0008358
1632 Ga0495608_0028526
1633 Ga0495608_0082753
1634 Ga0495618_0004868
1635 Ga0495618_0247707
1636 Ga0495618_0431316
1637 Ga0495628_0000140
1638 Ga0495628_0001930
1639 Ga0495628_0108928
1640 Ga0495628_0131261
1641 Ga0495628_0398014
1642 Ga0495628_0894785
1643 Ga0495628_0983104
1644 Ga0495630_0004677
1645 Ga0495630_0008269
1646 Ga0495630_0052655
1647 Ga0495630_0091375
1648 Ga0495630_1530036
1649 Ga0495666_0051031
1650 Ga0495666_0064047
1651 Ga0495652_0014402
1652 Ga0495652_0104883
1653 Ga0495652_0186269
1654 Ga0495652_0659315
1655 Ga0495665_0003304
1656 Ga0495665_0498767
1657 Ga0495640_0016376
1658 Ga0495640_0319729
1659 Ga0495640_0847254
1660 Ga0495586_0000942
1661 Ga0495586_0035973
1662 Ga0495586_0492190
1663 Ga0495587_0002155
1664 Ga0495587_0020580
1665 Ga0495645_0002009
1666 Ga0495645_0121158
1667 Ga0495645_0247946
1668 Ga0495622_0509001
1669 Ga0495667_0017783
1670 Ga0495667_0125252
1671 Ga0495667_0359202
1672 Ga0495634_0081968
1673 Ga0495635_0049231
1674 Ga0495635_0131153
1675 Ga0495635_0181088
1676 Ga0495588_0270336
1677 Ga0495657_0066320
1678 Ga0495657_0110556
1679 Ga0495657_0151267
1680 Ga0495657_0335417
1681 Ga0495599_0021784
1682 Ga0495599_0098721
1683 Ga0495599_0177850
1684 Ga0495623_0015674
1685 Ga0495623_0137933
1686 Ga0495623_0269529
1687 Ga0495646_0014717
1688 Ga0495646_0046689
1689 Ga0495658_0002307
1690 Ga0495658_0091811
1691 Ga0495613_0180121
1692 Ga0495613_0253462
1693 Ga0495624_0016372
1694 Ga0495624_0146504
1695 Ga0495600_0303358
1696 Ga0495600_0378201
1697 Ga0495604_0002807
1698 Ga0495604_0019334
1699 Ga0495604_0081209
1700 Ga0495604_0270715
1701 Ga0495604_0506652
1702 Ga0495674_0000992
1703 Ga0495674_0015976
1704 Ga0495674_0049324
1705 Ga0495674_0072689
1706 Ga0495674_0213133
1707 Ga0495676_0026951
1708 Ga0495680_0010376
1709 Ga0495680_0037174
1710 Ga0495680_0134879
1711 Ga0495680_0161336
1712 Ga0495675_0002873
1713 Ga0495675_0004854
1714 Ga0495684_0005513
1715 Ga0495684_0036919
1716 Ga0495684_0077651
1717 Ga0495684_0111921
1718 Ga0495593_0010826
1719 Ga0495602_0090783
1720 Ga0495602_0126705
1721 Ga0495602_0262442
1722 Ga0495614_0058406
1723 Ga0495614_0174547
1724 Ga0495615_0283139
1725 Ga0496102_0463485
1726 Ga0496103_0358492
1727 Ga0496104_0639534
1728 Ga0496104_1690417
1729 Ga0496107_0590638
1730 Ga0496107_0630963
1731 Ga0496109_1297456
1732 Ga0496112_0000516
1733 Ga0496112_0256546
1734 Ga0496112_0394878
1735 Ga0496113_0032155
1736 Ga0496115_0333657
1737 Ga0496115_0730131
1738 Ga0496119_0381322
1739 Ga0496121_0006505
1740 Ga0496125_0004021
1741 Ga0496125_0010850
1742 Ga0501306_003070
1743 Ga0501306_104614
1744 Ga0501308_007513
1745 Ga0501308_034137
1746 Ga0501308_052445
1747 Ga0501309_064488
1748 Ga0501304_001315
1749 Ga0501305_116230
1750 Ga0501305_116248
1751 Ga0501307_018937
1752 Ga0501292_042392
1753 Ga0501311_026839
1754 Ga0501311_032212
1755 Ga0501312_045365
1756 Ga0501313_031423
1757 Ga0501318_084511
1758 Ga0501319_031007
1759 Ga0501320_030333
1760 Ga0501320_036925
1761 Ga0501320_066742
1762 Ga0501031_0009956
1763 Ga0501032_0199597
1764 Ga0501033_0029262
1765 Ga0501034_0095132
1766 Ga0501034_0408012
1767 Ga0501034_0990356
1768 Ga0501036_0014384
1769 Ga0501037_0108066
1770 Ga0501038_0005590
1771 Ga0501038_1259750
1772 Ga0501039_0121352
1773 Ga0501040_0359091
1774 Ga0501043_0440364
1775 Ga0501043_0695671
1776 Ga0501046_0034880
1777 Ga0501046_0778081
1778 Ga0501047_0308480
1779 Ga0501048_0008581
1780 Ga0501048_0169189
1781 Ga0501067_0006705
1782 Ga0501067_0009843
1783 Ga0501067_0391562
1784 Ga0501069_0090513
1785 Ga0501071_0061932
1786 Ga0501071_0477217
1787 Ga0501071_0988280
1788 Ga0501072_1174545
1789 Ga0501073_0159025
1790 Ga0501074_0013273
1791 Ga0501074_0130988
1792 Ga0501074_0146862
1793 Ga0501075_0220466
1794 Ga0501075_0469804
1795 Ga0501077_0230973
1796 Ga0501242_026540
1797 Ga0501257_097188
1798 Ga0501079_0665848
1799 Ga0501079_1217808
1800 Ga0501080_0191461
1801 Ga0501080_1091273
1802 Ga0501083_0041703
1803 Ga0501083_0520694
1804 Ga0501035_0040785
1805 Ga0501035_1115667
1806 Ga0501044_0013375
1807 Ga0501044_0078916
1808 Ga0501045_1230145
1809 nmdc:mga06z11_301313_c1
1810 nmdc:mga05p37_1927286_c1
1811 nmdc:mga09592_172694_c1
1812 nmdc:mga09592_185333_c1
1813 nmdc:mga09592_458615_c1
1814 nmdc:mga09592_926227_c1
1815 nmdc:mga0qj67_281355_c1
1816 nmdc:mga0qj67_3985_c2
1817 nmdc:mga06r32_268624_c1
1818 nmdc:mga06r32_319969_c1
1819 nmdc:mga06r32_54362_c1
1820 nmdc:mga08y16_18794_c1
1821 nmdc:mga08y16_468499_c1
1822 nmdc:mga08y16_932106_c1
1823 nmdc:mga0n895_2004878_c1
1824 nmdc:mga0rr50_382368_c1
1825 nmdc:mga08x19_22048_c1
1826 nmdc:mga0a205_116758_c1
1827 nmdc:mga0a205_232987_c1
1828 nmdc:mga0a205_602712_c1
1829 nmdc:mga0a205_69251_c1
1830 nmdc:mga0a205_968698_c1
1831 Ga0495601_0230599
1832 Ga0495601_0394008
1833 Ga0495612_0328643
1834 Ga0495595_0156992
1835 Ga0495595_0197946
1836 Ga0495619_0010291
1837 Ga0501084_0045171
1838 Ga0501084_0824520
1839 Ga0501084_1281179
1840 Ga0587080_081379
1841 Ga0587086_030397
1842 Ga0587090_127125
1843 Ga0587109_133264
1844 Ga0587062_081960
1845 Ga0587072_134023
1846 Ga0587072_201303
1847 Ga0587078_078141
1848 Ga0501082_0142204
1849 2511697993
1850 2545559768
1851 2578930725
1852 2631982472
1853 2651530336
1854 2674421109
1855 2695629913
1856 2717918188
1857 2788433934
1858 2809057194
1859 2817478182
1860 2857608878
1861 2860837572
1862 2877768791
1863 2880169733
1864 2897109760
1865 2904564582
1866 2916972069
1867 2962290783
1868 2964375278
1869 2969136990
1870 2969141159
1871 2969766261
1872 2969774929
1873 2971893520
1874 2980492734
1875 3006828577
1876 3006858510
1877 3006883621
1878 3006973804
1879 8022631648
1880 8022655870
1881 8051956503
1882 8052174979

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00164

Ribosom_S12_S23

Ribosomal protein S12/S23

12

124

0.97

Map