F486336

General Info

Members Datasets Scaffolds Average Seq Length
941 581 1882 349

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0052810|Ga0466963_0052810_1107_2351
Length 414
Sequence MRSRIHEFSVVPANAGAHNHRTRLLRHLGAASVPDHHGLWLWVPDRHSRCSLVRDDSGVWRMSETLSADMLKPVEDRGGVAQPLLEVKGLTKHFPVRGDLFSARKTVRAVDDVSFAVMKGETVGIVGESGCGKSTTARLLMHLMARDAGDIVYDGMQVGASLSLRELRRGMQMVFQDSYASLNPRLTVEESIAFGPKVHGMADGAARKLARELLGKVGLRPDIFANRYPHEISGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLADLKREFGLTYLFISHDLNVVRYISDRVLVMYLGEVVELGPVDEVWDHPAHPYTRALLAAMPSSDPDRRTETPPISGDPPNPIDPPPGCRFHTRCPFAEPLCAKATPKLTALDKMGHEAACYMAIAGSGHSRAPKGVNAA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
95 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
96 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
97 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
338 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
350 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
351 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
352 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
353 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
354 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
355 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
360 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
361 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
362 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
368 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
369 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
370 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
371 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
372 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
373 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
374 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
375 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
376 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
377 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
378 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
379 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
380 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
381 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
382 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
383 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
384 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
385 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
386 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
387 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
388 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
389 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
390 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
391 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
392 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
393 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
394 2547132374 Acidovorax radicis N35 Isolate Unclassified
395 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
396 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
397 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
398 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
399 2643221717 Acidovorax sp. Root267 Isolate Unclassified
400 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
401 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
402 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
403 2791355199
404 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
405 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
406 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
407 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
408 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
409 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
410 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
411 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
412 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
413 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
414 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
415 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
416 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
417 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
418 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
419 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
420 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
421 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
422 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
423 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
424 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
425 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
426 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
427 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
428 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
429 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
430 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
431 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
432 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
433 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
434 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
435 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
436 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
437 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
438 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
439 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
440 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
441 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
442 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
443 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
444 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
445 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
446 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
447 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
448 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
449 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
450 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
451 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
452 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
453 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
454 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
455 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
456 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
457 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
458 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
459 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
460 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
461 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
462 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
463 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
464 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
465 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
466 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
467 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
468 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
469 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
470 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
471 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
472 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
473 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
474 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
475 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
476 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
477 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
478 2922368715
479 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
480 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
481 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
482 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
483 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
484 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
485 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
486 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
487 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
488 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
489 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
490 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
491 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
492 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
493 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
494 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
495 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
496 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
497 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
498 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
499 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
500 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
501 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
502 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
503 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
504 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
505 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
506 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
507 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
508 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
509 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
510 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
511 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
512 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
513 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
514 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
515 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
516 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
517 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
518 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
519 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
520 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
521 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
522 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
523 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
524 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
525 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
526 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
527 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
528 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
529 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
530 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
531 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
532 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
533 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
534 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
535 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
536 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
537 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
538 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
539 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
540 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
541 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
542 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
543 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
544 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
545 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
546 641522639 Methylobacterium sp. 4-46 Isolate Nodule
547 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
548 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
549 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
550 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
551 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
552 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
553 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
554 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
555 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
556 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
557 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
558 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
559 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
560 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
561 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
562 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
563 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
564 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
565 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
566 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
567 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
568 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
569 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
570 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
571 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
572 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
573 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
574 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
575 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
576 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
577 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
578 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
579 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
580 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
581 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.85
Metatranscriptomes 0
Isolates 22.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.62
Nodule 17.22
Rhizoplane 4.68
Rhizosphere 47.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0052810 3300044694 Bacteria 2697
2 JGI24744J21845_10013094 3300002077 Bacteria 1675
3 JGI24742J22300_10010775 3300002244 Bacteria 1514
4 JGI25151J46595_10002288 3300003187 Bacteria 11731
5 JGI25406J46586_10000089 3300003203 Bacteria 41556
6 JGI25406J46586_10000885 3300003203 Bacteria 14114
7 JGI25153J46596_10001792 3300003215 Bacteria 12743
8 JGI25153J46596_10003025 3300003215 Bacteria 9506
9 JGI25153J46596_10003136 3300003215 Bacteria 9321
10 JGI25160J50197_1003913 3300003354 Bacteria 6520
11 Ga0055524_1008182 3300003775 Bacteria 4367
12 Ga0055534_1011189 3300003784 Bacteria 1838
13 Ga0055531_10002428 3300003794 Bacteria 12474
14 Ga0055543_1001518 3300004625 Bacteria 9106
15 Ga0065165_1000415 3300005262 Bacteria 67666
16 Ga0065165_1027223 3300005262 Bacteria 1867
17 Ga0070658_10161160 3300005327 Bacteria 1882
18 Ga0070683_100203991 3300005329 Bacteria 1878
19 Ga0070670_100210685 3300005331 Bacteria 1690
20 Ga0068869_100021516 3300005334 Bacteria 4438
21 Ga0068869_100060160 3300005334 Bacteria 2783
22 Ga0070666_10234444 3300005335 Bacteria 1297
23 Ga0070680_100042682 3300005336 Bacteria 3681
24 Ga0068868_100042187 3300005338 Bacteria 3559
25 Ga0070661_100041101 3300005344 Bacteria 3374
26 Ga0070668_100052513 3300005347 Bacteria 3141
27 Ga0070668_100177828 3300005347 Bacteria 1736
28 Ga0070669_100317280 3300005353 Bacteria 1258
29 Ga0070671_100062733 3300005355 Bacteria 3094
30 Ga0070659_100321938 3300005366 Bacteria 1293
31 Ga0070667_100222752 3300005367 Bacteria 1679
32 Ga0070709_10012512 3300005434 Bacteria 4750
33 Ga0070709_10031036 3300005434 Bacteria 3212
34 Ga0070709_10031633 3300005434 Bacteria 3184
35 Ga0070714_100037004 3300005435 Bacteria 4098
36 Ga0070714_100207818 3300005435 Bacteria 1793
37 Ga0070713_100029100 3300005436 Bacteria 4370
38 Ga0070710_10011173 3300005437 Bacteria 4430
39 Ga0070711_100007005 3300005439 Bacteria 6841
40 Ga0070711_100009020 3300005439 Bacteria 6124
41 Ga0070700_100045927 3300005441 Bacteria 2696
42 Ga0070708_100272628 3300005445 Bacteria 1592
43 Ga0070663_100009181 3300005455 Bacteria 6115
44 Ga0070663_100085005 3300005455 Bacteria 2334
45 Ga0070662_100023244 3300005457 Bacteria 4256
46 Ga0070685_10261494 3300005466 Bacteria 1151
47 Ga0070699_100144977 3300005518 Bacteria 2098
48 Ga0070679_100003707 3300005530 Bacteria 14002
49 Ga0070697_100131997 3300005536 Bacteria 2095
50 Ga0070672_100214609 3300005543 Bacteria 1613
51 Ga0070672_100288666 3300005543 Bacteria 1388
52 Ga0070665_100006118 3300005548 Bacteria 12305
53 Ga0070665_100034010 3300005548 Bacteria 5126
54 Ga0070665_100067568 3300005548 Bacteria 3584
55 Ga0070665_100130352 3300005548 Bacteria 2517
56 Ga0070665_100277326 3300005548 Bacteria 1678
57 Ga0068855_100005214 3300005563 Bacteria 15852
58 Ga0068855_100292750 3300005563 Bacteria 1805
59 Ga0070664_100046714 3300005564 Bacteria 3657
60 Ga0068857_100066434 3300005577 Bacteria 3209
61 Ga0068852_100295347 3300005616 Bacteria 1567
62 Ga0068852_100335321 3300005616 Bacteria 1473
63 Ga0068859_100150655 3300005617 Bacteria 2401
64 Ga0068864_100016160 3300005618 Bacteria 6211
65 Ga0068864_100038317 3300005618 Bacteria 4094
66 Ga0068861_100035761 3300005719 Bacteria 3681
67 Ga0068863_100130928 3300005841 Bacteria 2395
68 Ga0068860_100003866 3300005843 Bacteria 15387
69 Ga0068862_100462748 3300005844 Bacteria 1197
70 Ga0081455_10002667 3300005937 Bacteria 21110
71 Ga0081455_10012598 3300005937 Bacteria 8428
72 Ga0081455_10034832 3300005937 Bacteria 4507
73 Ga0081538_10002323 3300005981 Bacteria 18774
74 Ga0081540_1001266 3300005983 Bacteria 22020
75 Ga0081540_1004882 3300005983 Bacteria 10100
76 Ga0081540_1010416 3300005983 Bacteria 6301
77 Ga0081540_1010842 3300005983 Bacteria 6126
78 Ga0081540_1012305 3300005983 Bacteria 5647
79 Ga0081540_1020381 3300005983 Bacteria 3991
80 Ga0081540_1021353 3300005983 Bacteria 3860
81 Ga0081540_1030298 3300005983 Bacteria 2999
82 Ga0081540_1032237 3300005983 Bacteria 2865
83 Ga0081540_1032288 3300005983 Bacteria 2862
84 Ga0081539_10000461 3300005985 Bacteria 86158
85 Ga0081539_10000729 3300005985 Bacteria 65907
86 Ga0081539_10031929 3300005985 Bacteria 3235
87 Ga0081539_10034529 3300005985 Bacteria 3057
88 Ga0081539_10066952 3300005985 Bacteria 1945
89 Ga0070717_10019858 3300006028 Bacteria 5276
90 Ga0070717_10032483 3300006028 Bacteria 4207
91 Ga0075365_10013935 3300006038 Bacteria 4824
92 Ga0075365_10022911 3300006038 Bacteria 3920
93 Ga0075365_10044304 3300006038 Bacteria 2914
94 Ga0075365_10064888 3300006038 Bacteria 2447
95 Ga0075365_10165135 3300006038 Bacteria 1544
96 Ga0075368_10046201 3300006042 Bacteria 1722
97 Ga0075363_100003826 3300006048 Bacteria 6487
98 Ga0075363_100012251 3300006048 Bacteria 4129
99 Ga0075363_100074714 3300006048 Bacteria 1846
100 Ga0075364_10058583 3300006051 Bacteria 2524
101 Ga0075364_10132637 3300006051 Bacteria 1672
102 Ga0075364_10225373 3300006051 Bacteria 1273
103 Ga0070716_100001412 3300006173 Bacteria 10658
104 Ga0070716_100107414 3300006173 Bacteria 1723
105 Ga0070712_100196056 3300006175 Bacteria 1583
106 Ga0075367_10042045 3300006178 Bacteria 2673
107 Ga0075367_10209436 3300006178 Bacteria 1219
108 Ga0075369_10040322 3300006186 Bacteria 1995
109 Ga0075369_10043865 3300006186 Bacteria 1920
110 Ga0075366_10136676 3300006195 Bacteria 1480
111 Ga0075366_10208068 3300006195 Bacteria 1190
112 Ga0097621_100078810 3300006237 Bacteria 2737
113 Ga0075370_10068260 3300006353 Bacteria 2030
114 Ga0075434_100131833 3300006871 Bacteria 2519
115 Ga0068865_100015327 3300006881 Bacteria 4887
116 Ga0097620_100150655 3300006931 Bacteria 2401
117 Ga0099824_1006403 3300006942 Bacteria 16176
118 Ga0099824_1018082 3300006942 Bacteria 5888
119 Ga0099822_1007370 3300006943 Bacteria 14235
120 Ga0099823_1037610 3300006944 Bacteria 3651
121 Ga0099794_10002308 3300007265 Bacteria 7006
122 Ga0099795_10003024 3300007788 Bacteria 4095
123 Ga0099795_10009882 3300007788 Bacteria 2786
124 Ga0105240_10023702 3300009093 Bacteria 8106
125 Ga0105240_10285015 3300009093 Bacteria 1896
126 Ga0105240_10332893 3300009093 Bacteria 1727
127 Ga0111539_10038338 3300009094 Bacteria 5780
128 Ga0114129_10131915 3300009147 Bacteria 3430
129 Ga0105241_10040522 3300009174 Bacteria 3517
130 Ga0105241_10142573 3300009174 Bacteria 1952
131 Ga0105242_10274808 3300009176 Bacteria 1528
132 Ga0105242_10325543 3300009176 Bacteria 1411
133 Ga0105248_10163693 3300009177 Bacteria 2508
134 Ga0105248_10169254 3300009177 Bacteria 2463
135 Ga0105237_10027033 3300009545 Bacteria 5860
136 Ga0105237_10235116 3300009545 Bacteria 1834
137 Ga0105238_10256670 3300009551 Bacteria 1727
138 Ga0105249_10108707 3300009553 Bacteria 2618
139 Ga0105249_10458408 3300009553 Bacteria 1314
140 Ga0099796_10010340 3300010159 Bacteria 2562
141 Ga0099796_10022278 3300010159 Bacteria 1963
142 Ga0105239_10078922 3300010375 Bacteria 3623
143 Ga0105239_10115267 3300010375 Bacteria 2981
144 Ga0105239_10186334 3300010375 Bacteria 2322
145 Ga0105239_10223417 3300010375 Bacteria 2112
146 Ga0105246_10072422 3300011119 Bacteria 2429
147 Ga0105246_10097168 3300011119 Bacteria 2136
148 Ga0157370_10031488 3300013104 Bacteria 5187
149 Ga0157374_10295269 3300013296 Bacteria 1602
150 Ga0157378_10139081 3300013297 Bacteria 2253
151 Ga0163162_10087204 3300013306 Bacteria 3199
152 Ga0157375_10314033 3300013308 Bacteria 1731
153 Ga0163163_10024312 3300014325 Bacteria 5765
154 Ga0163163_10067992 3300014325 Bacteria 3544
155 Ga0163163_10275411 3300014325 Bacteria 1734
156 Ga0157379_10062470 3300014968 Bacteria 3331
157 Ga0214544_1000003 3300021320 Bacteria 643752
158 Ga0214542_1000022 3300021321 Bacteria 193578
159 Ga0214545_1000010 3300021324 Bacteria 193578
160 Ga0214545_1031015 3300021324 Bacteria 2207
161 Ga0214543_1000035 3300021327 Bacteria 183100
162 Ga0213872_10043969 3300021361 Bacteria 2034
163 Ga0209677_100902 3300025253 Bacteria 14537
164 Ga0209148_1000784 3300025254 Bacteria 23607
165 Ga0209233_1000543 3300025261 Bacteria 21222
166 Ga0209233_1000561 3300025261 Bacteria 19886
167 Ga0209233_1008323 3300025261 Bacteria 3219
168 Ga0209455_1001661 3300025272 Bacteria 9638
169 Ga0209675_1001296 3300025291 Bacteria 14851
170 Ga0209564_1002283 3300025295 Bacteria 15636
171 Ga0209564_1008629 3300025295 Bacteria 4995
172 Ga0209758_1000015 3300025297 Bacteria 851943
173 Ga0209758_1000306 3300025297 Bacteria 95362
174 Ga0209758_1000701 3300025297 Bacteria 49677
175 Ga0209758_1001694 3300025297 Bacteria 24817
176 Ga0209758_1004530 3300025297 Bacteria 11502
177 Ga0209256_1000272 3300025299 Bacteria 90458
178 Ga0209256_1021845 3300025299 Bacteria 1952
179 Ga0207426_1000217 3300025302 Bacteria 136180
180 Ga0207426_1001117 3300025302 Bacteria 24608
181 Ga0207426_1008688 3300025302 Bacteria 4075
182 Ga0207426_1012705 3300025302 Bacteria 3153
183 Ga0209257_1001260 3300025304 Bacteria 31244
184 Ga0209257_1007750 3300025304 Bacteria 6387
185 Ga0209257_1015800 3300025304 Bacteria 3106
186 Ga0207692_10010351 3300025898 Bacteria 3927
187 Ga0207688_10057283 3300025901 Bacteria 2190
188 Ga0207647_10012036 3300025904 Bacteria 6038
189 Ga0207685_10013754 3300025905 Bacteria 2513
190 Ga0207699_10001724 3300025906 Bacteria 10355
191 Ga0207699_10028905 3300025906 Bacteria 3086
192 Ga0207699_10047208 3300025906 Bacteria 2524
193 Ga0207643_10034912 3300025908 Bacteria 2818
194 Ga0207654_10016718 3300025911 Bacteria 3823
195 Ga0207654_10019788 3300025911 Bacteria 3559
196 Ga0207654_10056358 3300025911 Bacteria 2279
197 Ga0207695_10057666 3300025913 Bacteria 4034
198 Ga0207695_10338728 3300025913 Bacteria 1392
199 Ga0207671_10025812 3300025914 Bacteria 4409
200 Ga0207671_10149214 3300025914 Bacteria 1806
201 Ga0207671_10198784 3300025914 Bacteria 1565
202 Ga0207671_10298843 3300025914 Bacteria 1272
203 Ga0207693_10002818 3300025915 Bacteria 15062
204 Ga0207663_10004235 3300025916 Bacteria 7116
205 Ga0207663_10011381 3300025916 Bacteria 4776
206 Ga0207660_10202889 3300025917 Bacteria 1549
207 Ga0207662_10086259 3300025918 Bacteria 1924
208 Ga0207657_10165202 3300025919 Bacteria 1796
209 Ga0207657_10183138 3300025919 Bacteria 1692
210 Ga0207649_10040585 3300025920 Bacteria 2829
211 Ga0207652_10264786 3300025921 Bacteria 1550
212 Ga0207694_10143116 3300025924 Bacteria 1923
213 Ga0207694_10153665 3300025924 Bacteria 1855
214 Ga0207694_10240496 3300025924 Bacteria 1479
215 Ga0207694_10281173 3300025924 Bacteria 1367
216 Ga0207687_10069486 3300025927 Bacteria 2512
217 Ga0207700_10012595 3300025928 Bacteria 5463
218 Ga0207700_10015399 3300025928 Bacteria 5044
219 Ga0207664_10009218 3300025929 Bacteria 6915
220 Ga0207664_10060839 3300025929 Bacteria 3011
221 Ga0207664_10139733 3300025929 Bacteria 2047
222 Ga0207644_10086400 3300025931 Bacteria 2329
223 Ga0207690_10350574 3300025932 Bacteria 1167
224 Ga0207706_10097345 3300025933 Bacteria 2588
225 Ga0207706_10412083 3300025933 Bacteria 1171
226 Ga0207709_10013681 3300025935 Bacteria 4476
227 Ga0207670_10145871 3300025936 Bacteria 1750
228 Ga0207669_10031041 3300025937 Bacteria 2979
229 Ga0207665_10002759 3300025939 Bacteria 11767
230 Ga0207665_10050012 3300025939 Bacteria 2810
231 Ga0207665_10061168 3300025939 Bacteria 2552
232 Ga0207691_10173501 3300025940 Bacteria 1887
233 Ga0207711_10135997 3300025941 Bacteria 2207
234 Ga0207689_10071727 3300025942 Bacteria 2845
235 Ga0207689_10095790 3300025942 Bacteria 2438
236 Ga0207689_10108961 3300025942 Bacteria 2276
237 Ga0207667_10145163 3300025949 Bacteria 2443
238 Ga0207712_10063310 3300025961 Bacteria 2633
239 Ga0207668_10143502 3300025972 Bacteria 1839
240 Ga0207658_10283210 3300025986 Bacteria 1422
241 Ga0207703_10032866 3300026035 Bacteria 4109
242 Ga0207678_10062792 3300026067 Bacteria 3192
243 Ga0207678_10121620 3300026067 Bacteria 2228
244 Ga0207678_10255573 3300026067 Bacteria 1501
245 Ga0207678_10362892 3300026067 Bacteria 1250
246 Ga0207708_10144105 3300026075 Bacteria 1871
247 Ga0207641_10095333 3300026088 Bacteria 2612
248 Ga0207648_10043034 3300026089 Bacteria 3966
249 Ga0207648_10165856 3300026089 Bacteria 1952
250 Ga0207648_10187430 3300026089 Bacteria 1833
251 Ga0207676_10027587 3300026095 Bacteria 4231
252 Ga0207674_10129947 3300026116 Bacteria 2483
253 Ga0207675_100052832 3300026118 Bacteria 3791
254 Ga0207675_100298097 3300026118 Bacteria 1570
255 Ga0207683_10120195 3300026121 Bacteria 2358
256 Ga0207683_10143826 3300026121 Bacteria 2150
257 Ga0207683_10431938 3300026121 Bacteria 1213
258 Ga0209389_1000012 3300027296 Bacteria 213243
259 Ga0209389_1000052 3300027296 Bacteria 109624
260 Ga0209589_1000015 3300027357 Bacteria 225913
261 Ga0209589_1000058 3300027357 Bacteria 109624
262 Ga0209489_100015 3300027361 Bacteria 225913
263 Ga0209489_100019 3300027361 Bacteria 213243
264 Ga0209489_100020 3300027361 Bacteria 207541
265 Ga0209700_100018 3300027363 Bacteria 238200
266 Ga0209700_100025 3300027363 Bacteria 225913
267 Ga0209588_1000822 3300027671 Bacteria 7888
268 Ga0209813_10024637 3300027866 Bacteria 1723
269 Ga0209813_10033217 3300027866 Bacteria 1533
270 Ga0268266_10000936 3300028379 Bacteria 37196
271 Ga0268266_10001232 3300028379 Bacteria 31354
272 Ga0268266_10011944 3300028379 Bacteria 7518
273 Ga0268266_10037059 3300028379 Bacteria 4155
274 Ga0268265_10415570 3300028380 Bacteria 1247
275 Ga0268264_10000073 3300028381 Bacteria 260615
276 Ga0265319_1002449 3300028563 Bacteria 10136
277 Ga0265334_10004379 3300028573 Bacteria 6273
278 Ga0265318_10001721 3300028577 Bacteria 12527
279 Ga0265318_10014731 3300028577 Bacteria 3274
280 Ga0265323_10000822 3300028653 Bacteria 16629
281 Ga0265336_10002743 3300028666 Bacteria 7119
282 Ga0307517_10000476 3300028786 Bacteria 68696
283 Ga0307517_10140253 3300028786 Bacteria 1700
284 Ga0307515_10121156 3300028794 Bacteria 2961
285 Ga0265338_10000176 3300028800 Bacteria 118726
286 Ga0265324_10002446 3300029957 Bacteria 9477
287 Ga0265330_10017291 3300031235 Bacteria 3322
288 Ga0265330_10055412 3300031235 Bacteria 1731
289 Ga0265325_10043560 3300031241 Bacteria 2341
290 Ga0265340_10035701 3300031247 Bacteria 2468
291 Ga0265340_10046406 3300031247 Bacteria 2119
292 Ga0265339_10022304 3300031249 Bacteria 3669
293 Ga0265331_10030941 3300031250 Bacteria 2663
294 Ga0307509_10067824 3300031507 Bacteria 3735
295 Ga0307509_10106278 3300031507 Bacteria 2826
296 Ga0307509_10140559 3300031507 Bacteria 2351
297 Ga0265313_10026059 3300031595 Bacteria 3087
298 Ga0307508_10000740 3300031616 Bacteria 38713
299 Ga0307508_10176710 3300031616 Bacteria 1738
300 Ga0307508_10247379 3300031616 Bacteria 1380
301 Ga0265342_10003084 3300031712 Bacteria 13926
302 Ga0265342_10032748 3300031712 Bacteria 3203
303 Ga0265342_10047735 3300031712 Bacteria 2569
304 Ga0316576_10003774 3300031727 Bacteria 8951
305 Ga0307516_10017246 3300031730 Bacteria 7535
306 Ga0307516_10063273 3300031730 Bacteria 3582
307 Ga0307405_10183097 3300031731 Bacteria 1506
308 Ga0307411_10041450 3300032005 Bacteria 2929
309 Ga0307510_10026086 3300033180 Bacteria 6726
310 Ga0307510_10046575 3300033180 Bacteria 4659
311 Ga0307510_10055610 3300033180 Bacteria 4132
312 Ga0373934_0009613 3300035086 Bacteria 3624
313 Ga0373944_0002516 3300035089 Bacteria 4657
314 Ga0373923_0001598 3300035111 Bacteria 6593
315 Ga0373923_0007180 3300035111 Bacteria 3904
316 Ga0373923_0029285 3300035111 Bacteria 2207
317 Ga0373936_0015828 3300035113 Bacteria 2893
318 Ga0373936_0036898 3300035113 Bacteria 1950
319 Ga0373945_0007782 3300035116 Bacteria 3477
320 Ga0373953_0000365 3300035117 Bacteria 12236
321 Ga0373953_0054773 3300035117 Bacteria 1618
322 Ga0373954_0000474 3300035118 Bacteria 15068
323 Ga0373954_0024611 3300035118 Bacteria 2745
324 Ga0373956_0017676 3300035119 Bacteria 3010
325 Ga0373956_0023157 3300035119 Bacteria 2663
326 Ga0373957_0000677 3300035120 Bacteria 8772
327 Ga0373943_0001393 3300035170 Bacteria 10893
328 Ga0373946_0047144 3300035171 Bacteria 1789
329 Ga0373955_0000870 3300035172 Bacteria 12943
330 Ga0373955_0007967 3300035172 Bacteria 4896
331 Ga0373955_0084838 3300035172 Bacteria 1796
332 Ga0373924_0005372 3300035410 Bacteria 4531
333 Ga0373931_0005817 3300035691 Bacteria 5737
334 Ga0373935_0004338 3300035692 Bacteria 8319
335 Ga0373935_0046033 3300035692 Bacteria 2755
336 Ga0373935_0122777 3300035692 Bacteria 1737
337 Ga0373935_0170286 3300035692 Bacteria 1489
338 Ga0373935_0301710 3300035692 Bacteria 1132
339 Ga0373927_0006494 3300035695 Bacteria 7966
340 Ga0373927_0020110 3300035695 Bacteria 4378
341 Ga0373927_0021557 3300035695 Bacteria 4223
342 Ga0373933_0000158 3300035724 Bacteria 44104
343 Ga0373933_0001161 3300035724 Bacteria 15622
344 Ga0373933_0030660 3300035724 Bacteria 3114
345 Ga0373947_0005561 3300035725 Bacteria 7345
346 Ga0373947_0005689 3300035725 Bacteria 7269
347 Ga0373937_0008434 3300036401 Bacteria 8956
348 Ga0373937_0111845 3300036401 Bacteria 2540
349 Ga0316584_0002193 3300036712 Bacteria 12237
350 Ga0373925_0002440 3300037068 Bacteria 14906
351 Ga0373925_0009266 3300037068 Bacteria 7165
352 Ga0373925_0009840 3300037068 Bacteria 6944
353 Ga0373925_0094377 3300037068 Bacteria 2291
354 Ga0373925_0245062 3300037068 Bacteria 1436
355 Ga0395898_0254442 3300037466 Bacteria 1675
356 Ga0395905_0004146 3300037471 Bacteria 15162
357 Ga0436365_0747992 3300039437 Bacteria 1878
358 Ga0436361_0960294 3300039447 Bacteria 4628
359 Ga0436363_0039721 3300039450 Bacteria 1777
360 Ga0436362_0159823 3300039453 Bacteria 3526
361 Ga0451804_0429416 3300041463 Bacteria 1939
362 Ga0451849_0305165 3300041505 Bacteria 2051
363 Ga0450911_000210 3300042115 Bacteria 22859
364 Ga0466972_0000295 3300044658 Bacteria 30276
365 Ga0466972_0015953 3300044658 Bacteria 3756
366 Ga0466966_0002033 3300044684 Bacteria 13135
367 Ga0466961_0000087 3300044693 Bacteria 58547
368 Ga0466968_0061456 3300044735 Bacteria 1621
369 Ga0466957_0257535 3300044842 Bacteria 1162
370 Ga0466959_0002003 3300045049 Bacteria 12853
371 Ga0466967_0083170 3300045976 Bacteria 2894
372 Ga0495592_0003034 3300046454 Bacteria 11957
373 Ga0495592_0004669 3300046454 Bacteria 10039
374 Ga0495592_0019284 3300046454 Bacteria 5188
375 Ga0495592_0068558 3300046454 Bacteria 2589
376 Ga0495603_0000029 3300046455 Bacteria 60872
377 Ga0495603_0005242 3300046455 Bacteria 7732
378 Ga0495603_0036039 3300046455 Bacteria 2970
379 Ga0495603_0044791 3300046455 Bacteria 2640
380 Ga0495629_0000029 3300046459 Bacteria 127000
381 Ga0495629_0002638 3300046459 Bacteria 13739
382 Ga0495629_0028887 3300046459 Bacteria 3937
383 Ga0495629_0061905 3300046459 Bacteria 2615
384 Ga0495638_0003622 3300046460 Bacteria 12071
385 Ga0495638_0015943 3300046460 Bacteria 5036
386 Ga0495638_0016057 3300046460 Bacteria 5018
387 Ga0495638_0016277 3300046460 Bacteria 4982
388 Ga0495641_0005506 3300046461 Bacteria 8521
389 Ga0495651_0001923 3300046462 Bacteria 16068
390 Ga0495651_0002607 3300046462 Bacteria 13945
391 Ga0495651_0088625 3300046462 Bacteria 2325
392 Ga0495651_0090735 3300046462 Bacteria 2292
393 Ga0495653_0000341 3300046463 Bacteria 38030
394 Ga0495580_0005561 3300046472 Bacteria 10391
395 Ga0495580_0010591 3300046472 Bacteria 7176
396 Ga0495582_0000068 3300046473 Bacteria 53389
397 Ga0495582_0016420 3300046473 Bacteria 4057
398 Ga0495605_0083470 3300046474 Bacteria 1491
399 Ga0495639_0000006 3300046475 Bacteria 100361
400 Ga0495639_0014829 3300046475 Bacteria 3377
401 Ga0495662_0003219 3300046476 Bacteria 8248
402 Ga0495664_0004785 3300046477 Bacteria 7406
403 Ga0495664_0020110 3300046477 Bacteria 3846
404 Ga0495664_0039694 3300046477 Bacteria 2782
405 Ga0495664_0101448 3300046477 Bacteria 1734
406 Ga0495594_0000750 3300046499 Bacteria 16637
407 Ga0495596_0038323 3300046500 Bacteria 1895
408 Ga0495583_0050734 3300046506 Bacteria 1895
409 Ga0495606_0086474 3300046507 Bacteria 1937
410 Ga0495608_0000606 3300046511 Bacteria 24639
411 Ga0495608_0010182 3300046511 Bacteria 6561
412 Ga0495608_0063403 3300046511 Bacteria 2425
413 Ga0495608_0172658 3300046511 Bacteria 1370
414 Ga0495610_0095184 3300046512 Bacteria 1343
415 Ga0495618_0077613 3300046514 Bacteria 2116
416 Ga0495618_0239314 3300046514 Bacteria 1141
417 Ga0495628_0011645 3300046516 Bacteria 7430
418 Ga0495628_0027421 3300046516 Bacteria 4635
419 Ga0495630_0005874 3300046517 Bacteria 8682
420 Ga0495631_0055651 3300046518 Bacteria 1724
421 Ga0495631_0075568 3300046518 Bacteria 1454
422 Ga0495643_0054915 3300046522 Bacteria 2130
423 Ga0495644_0033143 3300046523 Bacteria 1952
424 Ga0495648_0002484 3300046524 Bacteria 16925
425 Ga0495648_0011475 3300046524 Bacteria 6668
426 Ga0495648_0036375 3300046524 Bacteria 3178
427 Ga0495648_0101093 3300046524 Bacteria 1591
428 Ga0495666_0024498 3300046526 Bacteria 2981
429 Ga0495652_0007527 3300046529 Bacteria 10035
430 Ga0495652_0012146 3300046529 Bacteria 7779
431 Ga0495652_0048701 3300046529 Bacteria 3629
432 Ga0495652_0066072 3300046529 Bacteria 3037
433 Ga0495652_0130916 3300046529 Bacteria 1986
434 Ga0495652_0285224 3300046529 Bacteria 1207
435 Ga0495654_0034752 3300046530 Bacteria 2542
436 Ga0495665_0000237 3300046531 Bacteria 27649
437 Ga0495665_0020476 3300046531 Bacteria 3553
438 Ga0495640_0005842 3300046533 Bacteria 9774
439 Ga0495640_0006116 3300046533 Bacteria 9540
440 Ga0495640_0007919 3300046533 Bacteria 8356
441 Ga0495587_0001595 3300046536 Bacteria 15102
442 Ga0495587_0002682 3300046536 Bacteria 11890
443 Ga0495645_0040515 3300046543 Bacteria 3398
444 Ga0495645_0061502 3300046543 Bacteria 2720
445 Ga0495622_0009979 3300046557 Bacteria 4392
446 Ga0495622_0021661 3300046557 Bacteria 2992
447 Ga0495667_0003214 3300046559 Bacteria 10955
448 Ga0495667_0011892 3300046559 Bacteria 5896
449 Ga0495667_0101621 3300046559 Bacteria 1860
450 Ga0495656_0044715 3300046615 Bacteria 1866
451 Ga0495668_0006062 3300046616 Bacteria 8006
452 Ga0495668_0065969 3300046616 Bacteria 1992
453 Ga0495634_0001307 3300046642 Bacteria 22759
454 Ga0495634_0010145 3300046642 Bacteria 6911
455 Ga0495634_0040885 3300046642 Bacteria 3150
456 Ga0495634_0075256 3300046642 Bacteria 2218
457 Ga0495625_0029057 3300046660 Bacteria 4139
458 Ga0495625_0218206 3300046660 Bacteria 1251
459 Ga0495635_0000092 3300046663 Bacteria 53315
460 Ga0495635_0019780 3300046663 Bacteria 4690
461 Ga0495635_0028796 3300046663 Bacteria 3860
462 Ga0495635_0047078 3300046663 Bacteria 2975
463 Ga0495661_0036570 3300046665 Bacteria 3073
464 Ga0495588_0011966 3300046674 Bacteria 4087
465 Ga0495657_0003498 3300046675 Bacteria 12806
466 Ga0495657_0006462 3300046675 Bacteria 9169
467 Ga0495657_0037121 3300046675 Bacteria 3361
468 Ga0495657_0128859 3300046675 Bacteria 1587
469 Ga0495599_0005823 3300046678 Bacteria 7403
470 Ga0495599_0007153 3300046678 Bacteria 6757
471 Ga0495623_0004160 3300046679 Bacteria 9532
472 Ga0495623_0004635 3300046679 Bacteria 9030
473 Ga0495646_0004002 3300046680 Bacteria 9229
474 Ga0495646_0052734 3300046680 Bacteria 2455
475 Ga0495646_0100800 3300046680 Bacteria 1656
476 Ga0495647_0003788 3300046681 Bacteria 4865
477 Ga0495647_0060863 3300046681 Bacteria 1489
478 Ga0495658_0002427 3300046683 Bacteria 9388
479 Ga0495613_0000582 3300046689 Bacteria 29501
480 Ga0495613_0019334 3300046689 Bacteria 5078
481 Ga0495613_0111035 3300046689 Bacteria 1975
482 Ga0495613_0188238 3300046689 Bacteria 1460
483 Ga0495624_0151330 3300046690 Bacteria 1419
484 Ga0495670_0030891 3300046691 Bacteria 2661
485 Ga0495649_0141527 3300046694 Bacteria 1266
486 Ga0495649_0164447 3300046694 Bacteria 1163
487 Ga0495600_0001905 3300046809 Bacteria 11719
488 Ga0495600_0002533 3300046809 Bacteria 10514
489 Ga0495600_0014076 3300046809 Bacteria 5039
490 Ga0495600_0038562 3300046809 Bacteria 3109
491 Ga0495600_0128684 3300046809 Bacteria 1646
492 Ga0495581_0000048 3300047315 Bacteria 45311
493 Ga0495581_0139709 3300047315 Bacteria 1413
494 Ga0495581_0190222 3300047315 Bacteria 1200
495 Ga0495581_0198818 3300047315 Bacteria 1172
496 Ga0495604_0001244 3300047317 Bacteria 20881
497 Ga0495604_0003533 3300047317 Bacteria 12462
498 Ga0495604_0058268 3300047317 Bacteria 2966
499 Ga0495604_0081406 3300047317 Bacteria 2424
500 Ga0495674_0009200 3300047319 Bacteria 9387
501 Ga0495674_0011197 3300047319 Bacteria 8470
502 Ga0495674_0016889 3300047319 Bacteria 6806
503 Ga0495674_0173317 3300047319 Bacteria 1799
504 Ga0495672_0007852 3300047320 Bacteria 7968
505 Ga0495672_0012029 3300047320 Bacteria 6060
506 Ga0495676_0053573 3300047321 Bacteria 3214
507 Ga0495680_0000546 3300047322 Bacteria 42342
508 Ga0495680_0006001 3300047322 Bacteria 11360
509 Ga0495687_043565 3300047443 Bacteria 1954
510 Ga0495675_0001333 3300047444 Bacteria 14952
511 Ga0495675_0009372 3300047444 Bacteria 6089
512 Ga0495675_0112280 3300047444 Bacteria 1701
513 Ga0495685_017516 3300047447 Bacteria 2454
514 Ga0495673_0059165 3300047469 Bacteria 1648
515 Ga0495673_0059235 3300047469 Bacteria 1647
516 Ga0495684_0000032 3300047471 Bacteria 113195
517 Ga0495684_0002955 3300047471 Bacteria 13381
518 Ga0495684_0063799 3300047471 Bacteria 2800
519 Ga0495686_0049142 3300047472 Bacteria 2655
520 Ga0495686_0049237 3300047472 Bacteria 2652
521 Ga0495593_0000556 3300047673 Bacteria 21184
522 Ga0495593_0000660 3300047673 Bacteria 19875
523 Ga0495602_0003334 3300048088 Bacteria 16577
524 Ga0495602_0006506 3300048088 Bacteria 12257
525 Ga0495602_0153553 3300048088 Bacteria 1806
526 Ga0495602_0231460 3300048088 Bacteria 1388
527 Ga0496101_0020506 3300048904 Bacteria 4527
528 Ga0496101_0325999 3300048904 Bacteria 1205
529 Ga0496102_0009365 3300048905 Bacteria 8413
530 Ga0496102_0029530 3300048905 Bacteria 4906
531 Ga0496102_0173731 3300048905 Bacteria 2028
532 Ga0496103_0039337 3300048906 Bacteria 2906
533 Ga0496103_0082413 3300048906 Bacteria 2024
534 Ga0496103_0085757 3300048906 Bacteria 1984
535 Ga0496104_0073659 3300048907 Bacteria 3249
536 Ga0496104_0084884 3300048907 Bacteria 3022
537 Ga0496105_0010801 3300048908 Bacteria 7191
538 Ga0496105_0011478 3300048908 Bacteria 7000
539 Ga0496105_0032337 3300048908 Bacteria 4292
540 Ga0496106_0004140 3300048909 Bacteria 10810
541 Ga0496106_0005511 3300048909 Bacteria 9361
542 Ga0496106_0009870 3300048909 Bacteria 7047
543 Ga0496106_0101452 3300048909 Bacteria 2232
544 Ga0496106_0229856 3300048909 Bacteria 1481
545 Ga0496106_0273268 3300048909 Bacteria 1353
546 Ga0496107_0136247 3300048910 Bacteria 1814
547 Ga0496107_0165980 3300048910 Bacteria 1637
548 Ga0496108_0067452 3300048911 Bacteria 3018
549 Ga0496108_0235856 3300048911 Bacteria 1591
550 Ga0496109_0026957 3300048912 Bacteria 5126
551 Ga0496110_0007995 3300048913 Bacteria 8475
552 Ga0496110_0024944 3300048913 Bacteria 5103
553 Ga0496110_0030548 3300048913 Bacteria 4645
554 Ga0496110_0196880 3300048913 Bacteria 1830
555 Ga0496110_0281533 3300048913 Bacteria 1514
556 Ga0496111_0109768 3300048914 Bacteria 2031
557 Ga0496112_0000169 3300048915 Bacteria 41507
558 Ga0496112_0011528 3300048915 Bacteria 8077
559 Ga0496112_0019225 3300048915 Bacteria 6443
560 Ga0496112_0062276 3300048915 Bacteria 3679
561 Ga0496112_0463508 3300048915 Bacteria 1204
562 Ga0496113_0168171 3300048916 Bacteria 1736
563 Ga0496114_0018487 3300048917 Bacteria 5636
564 Ga0496115_0000889 3300048918 Bacteria 21680
565 Ga0496115_0058415 3300048918 Bacteria 3104
566 Ga0496115_0069856 3300048918 Bacteria 2846
567 Ga0496115_0130878 3300048918 Bacteria 2068
568 Ga0496115_0147538 3300048918 Bacteria 1942
569 Ga0496116_0008611 3300048919 Bacteria 8827
570 Ga0496116_0057216 3300048919 Bacteria 2551
571 Ga0496116_0087090 3300048919 Bacteria 1913
572 Ga0496117_0023533 3300048920 Bacteria 4903
573 Ga0496117_0030017 3300048920 Bacteria 4179
574 Ga0496117_0058124 3300048920 Bacteria 2680
575 Ga0496117_0078000 3300048920 Bacteria 2189
576 Ga0496117_0099551 3300048920 Bacteria 1844
577 Ga0496118_0037060 3300048921 Bacteria 3931
578 Ga0496118_0043939 3300048921 Bacteria 3505
579 Ga0496118_0045932 3300048921 Bacteria 3402
580 Ga0496118_0073192 3300048921 Bacteria 2456
581 Ga0496118_0083401 3300048921 Bacteria 2235
582 Ga0496119_0012324 3300048922 Bacteria 6958
583 Ga0496119_0076976 3300048922 Bacteria 1934
584 Ga0496120_0062215 3300048923 Bacteria 2080
585 Ga0496121_0000155 3300048924 Bacteria 149388
586 Ga0496121_0000218 3300048924 Bacteria 126175
587 Ga0496121_0003892 3300048924 Bacteria 20737
588 Ga0496121_0007080 3300048924 Bacteria 13616
589 Ga0496121_0011030 3300048924 Bacteria 10085
590 Ga0496121_0027285 3300048924 Bacteria 5346
591 Ga0496121_0038776 3300048924 Bacteria 4211
592 Ga0496121_0069992 3300048924 Bacteria 2828
593 Ga0496122_0012396 3300048925 Bacteria 8497
594 Ga0496122_0020536 3300048925 Bacteria 5960
595 Ga0496122_0033693 3300048925 Bacteria 4207
596 Ga0496123_0022201 3300048926 Bacteria 4899
597 Ga0496123_0069865 3300048926 Bacteria 2202
598 Ga0496123_0148245 3300048926 Bacteria 1270
599 Ga0496124_0025392 3300048927 Bacteria 5366
600 Ga0496124_0059392 3300048927 Bacteria 3213
601 Ga0496124_0117718 3300048927 Bacteria 2128
602 Ga0496124_0130505 3300048927 Bacteria 1997
603 Ga0496125_0002212 3300048928 Bacteria 25927
604 Ga0496125_0003115 3300048928 Bacteria 20622
605 Ga0496125_0006315 3300048928 Bacteria 12865
606 Ga0496125_0012310 3300048928 Bacteria 8499
607 Ga0496125_0036214 3300048928 Bacteria 4313
608 Ga0496125_0040815 3300048928 Bacteria 3975
609 Ga0496125_0142561 3300048928 Bacteria 1663
610 Ga0496125_0143744 3300048928 Bacteria 1653
611 Ga0496126_0003000 3300048929 Bacteria 21903
612 Ga0496126_0005013 3300048929 Bacteria 15421
613 Ga0496126_0009925 3300048929 Bacteria 10053
614 Ga0496126_0012765 3300048929 Bacteria 8586
615 Ga0496126_0014895 3300048929 Bacteria 7842
616 Ga0496126_0019762 3300048929 Bacteria 6627
617 Ga0496126_0040827 3300048929 Bacteria 4299
618 Ga0496126_0059401 3300048929 Bacteria 3443
619 Ga0496126_0069880 3300048929 Bacteria 3130
620 Ga0496126_0088546 3300048929 Bacteria 2726
621 Ga0496126_0091578 3300048929 Bacteria 2673
622 Ga0496126_0130897 3300048929 Bacteria 2168
623 Ga0496126_0131930 3300048929 Bacteria 2158
624 Ga0496126_0143331 3300048929 Bacteria 2054
625 Ga0496126_0196426 3300048929 Bacteria 1706
626 Ga0496126_0218469 3300048929 Bacteria 1602
627 Ga0496126_0333421 3300048929 Bacteria 1244
628 Ga0501067_0091274 3300049583 Bacteria 1691
629 Ga0501067_0249615 3300049583 Bacteria 988
630 Ga0501080_0116162 3300049742 Bacteria 2481
631 nmdc:mga03n38_351_c1 3300050490 Bacteria 11225
632 nmdc:mga00v17_113578_c1 3300050491 Bacteria 1720
633 nmdc:mga00v17_128029_c1 3300050491 Bacteria 1621
634 nmdc:mga0yw44_10551_c1 3300050492 Bacteria 4726
635 nmdc:mga0yw44_133679_c1 3300050492 Bacteria 1607
636 nmdc:mga0yw44_21457_c1 3300050492 Bacteria 3602
637 nmdc:mga0yw44_41406_c1 3300050492 Bacteria 2742
638 nmdc:mga0yw44_48499_c1 3300050492 Bacteria 2561
639 nmdc:mga0yw44_72656_c1 3300050492 Bacteria 2139
640 nmdc:mga0k408_31663_c1 3300050493 Bacteria 3021
641 nmdc:mga06z11_127502_c1 3300050494 Bacteria 1425
642 nmdc:mga06z11_165679_c1 3300050494 Bacteria 1266
643 nmdc:mga06z11_40480_c1 3300050494 Bacteria 2326
644 nmdc:mga04h51_28926_c1 3300050495 Bacteria 1732
645 nmdc:mga07m45_13635_c1 3300050496 Bacteria 4317
646 nmdc:mga07m45_69152_c1 3300050496 Bacteria 2007
647 nmdc:mga07m45_93184_c1 3300050496 Bacteria 1727
648 nmdc:mga05p37_315897_c1 3300050507 Bacteria 1850
649 nmdc:mga08y16_484243_c1 3300050511 Bacteria 1258
650 nmdc:mga08y16_66493_c1 3300050511 Bacteria 3762
651 nmdc:mga0n895_127425_c1 3300050512 Bacteria 2569
652 nmdc:mga0sz30_24364_c1 3300050516 Bacteria 2469
653 Ga0495601_0001683 3300053077 Bacteria 12202
654 Ga0495601_0142735 3300053077 Bacteria 1562
655 Ga0495595_0003264 3300053084 Bacteria 6440
656 Ga0495619_0000267 3300053085 Bacteria 38050
657 Ga0495619_0065596 3300053085 Bacteria 2422
658 Ga0500643_000048 3300053087 Bacteria 147879
659 Ga0500644_0000703 3300053088 Bacteria 11861
660 Ga0500644_0019536 3300053088 Bacteria 2001
661 Ga0500646_0027563 3300053090 Bacteria 1547
662 Ga0500651_0005923 3300053093 Bacteria 7012
663 Ga0500651_0057151 3300053093 Bacteria 2442
664 Ga0500566_0000110 3300053094 Bacteria 41727
665 Ga0500566_0007240 3300053094 Bacteria 6575
666 Ga0500566_0018033 3300053094 Bacteria 4146
667 Ga0500566_0127246 3300053094 Bacteria 1367
668 Ga0500640_011481 3300053095 Bacteria 3611
669 Ga0500641_0005426 3300053096 Bacteria 4520
670 Ga0500641_0077440 3300053096 Bacteria 1407
671 Ga0500650_0026722 3300053098 Bacteria 2591
672 Ga0500650_0087658 3300053098 Bacteria 1457
673 Ga0500554_010006 3300053102 Bacteria 2292
674 Ga0500556_0000003 3300053104 Bacteria 679379
675 Ga0500556_0003783 3300053104 Bacteria 4391
676 Ga0500557_000124 3300053105 Bacteria 20414
677 Ga0500569_000744 3300053109 Bacteria 5692
678 Ga0500572_002210 3300053111 Bacteria 4761
679 Ga0500572_002958 3300053111 Bacteria 3981
680 Ga0500593_078733 3300053117 Bacteria 1417
681 Ga0500594_0005603 3300053118 Bacteria 2788
682 Ga0500595_000003 3300053119 Bacteria 419332
683 Ga0500595_002302 3300053119 Bacteria 9568
684 Ga0500595_005550 3300053119 Bacteria 5496
685 Ga0500595_011786 3300053119 Bacteria 3405
686 Ga0500595_011873 3300053119 Bacteria 3390
687 Ga0500595_013114 3300053119 Bacteria 3181
688 Ga0500608_024592 3300053122 Bacteria 2813
689 Ga0500608_031117 3300053122 Bacteria 2531
690 Ga0500614_000900 3300053123 Bacteria 7487
691 Ga0500642_0000100 3300053130 Bacteria 41454
692 Ga0500642_0000104 3300053130 Bacteria 40747
693 Ga0500652_008493 3300053131 Bacteria 3425
694 Ga0500658_0015470 3300053134 Bacteria 2833
695 Ga0500559_0000117 3300053136 Bacteria 62940
696 Ga0500559_0005440 3300053136 Bacteria 5856
697 Ga0500559_0010513 3300053136 Bacteria 3971
698 Ga0500559_0085304 3300053136 Bacteria 1440
699 Ga0500568_0007163 3300053139 Bacteria 5503
700 Ga0500568_0007686 3300053139 Bacteria 5263
701 Ga0500568_0038564 3300053139 Bacteria 1933
702 Ga0500586_000338 3300053145 Bacteria 9253
703 Ga0500590_089316 3300053148 Bacteria 1499
704 Ga0500603_000515 3300053150 Bacteria 9823
705 Ga0500603_001374 3300053150 Bacteria 5553
706 Ga0500604_0000898 3300053151 Bacteria 8222
707 Ga0500616_0000002 3300053153 Bacteria 1611257
708 Ga0500616_0000033 3300053153 Bacteria 398830
709 Ga0500622_0001002 3300053156 Bacteria 23819
710 Ga0500622_0017813 3300053156 Bacteria 3778
711 Ga0500630_004083 3300053159 Bacteria 7099
712 Ga0500633_0024503 3300053160 Bacteria 1876
713 Ga0500638_047139 3300053162 Bacteria 2087
714 Ga0500638_056257 3300053162 Bacteria 1895
715 Ga0500638_076593 3300053162 Bacteria 1593
716 Ga0500639_000598 3300053163 Bacteria 18139
717 Ga0500639_031207 3300053163 Bacteria 2817
718 Ga0500636_0000016 3300053177 Bacteria 123469
719 Ga0500636_0078196 3300053177 Bacteria 1909
720 Ga0500636_0110815 3300053177 Bacteria 1551
721 Ga0500637_0000347 3300053178 Bacteria 17551
722 Ga0500637_0003619 3300053178 Bacteria 7180
723 Ga0500625_045065 3300053729 Bacteria 2059
724 Ga0500645_000087 3300053730 Bacteria 74431
725 Ga0500645_002736 3300053730 Bacteria 7648
726 Ga0500552_004018 3300053733 Bacteria 1527
727 Ga0500596_007853 3300053735 Bacteria 1726
728 Ga0500599_002849 3300053736 Bacteria 2094
729 Ga0500601_000591 3300053737 Bacteria 5186
730 Ga0500661_000111 3300055283 Bacteria 13269
731 Ga0500661_005787 3300055283 Bacteria 2304
732 2507505825 2507262055 Bacteria 8048963
733 2508540018 2508501009 Bacteria 7784016
734 2508696093 2508501042 Bacteria 8719808
735 2509153663 2508501128 Bacteria 8613869
736 2511394514 2511231028 Bacteria 8046582
737 2513626485 2513237092 Bacteria 8341956
738 2513638874 2513237094 Bacteria 8789602
739 2513649791 2513237095 Bacteria 8976980
740 2513678178 2513237098 Bacteria 9902361
741 2513694769 2513237101 Bacteria 7952346
742 2513702980 2513237102 Bacteria 7703324
743 2513715466 2513237104 Bacteria 10034502
744 2513875457 2513237139 Bacteria 8737671
745 2513891706 2513237141 Bacteria 8496279
746 2513913357 2513237144 Bacteria 7530820
747 2514011167 2513237161 Bacteria 8871253
748 2515630825 2515154112 Bacteria 8294334
749 2517105765 2517093001 Bacteria 9002274
750 2524435495 2524023205 Bacteria 8918781
751 2524466256 2524023210 Bacteria 9029266
752 2528851060 2528768022 Bacteria 10457665
753 2545676751 2545555834 Bacteria 8130841
754 2548500555 2547132374 Bacteria 5530232
755 2585899901 2585427608 Bacteria 6544331
756 2603860414 2602042107 Bacteria 6226103
757 2617347707 2617270735 Bacteria 9163226
758 2617374436 2617270741 Bacteria 8201522
759 2644646897 2643221717 Bacteria 5676132
760 2723842198 2721755755 Bacteria 8322773
761 2745081339 2744054633 Bacteria 8678936
762 2793063687 2791355196 Bacteria 7323613
763 2793078041
764 2805921187 2802429603 Bacteria 8777136
765 2818240791 2816332527 Bacteria 8933356
766 2824603511 2824600985 Bacteria 8488197
767 2824610902 2824609381 Bacteria 8672835
768 2824619426 2824617872 Bacteria 8814715
769 2824627881 2824626560 Bacteria 8813858
770 2824636075 2824635225 Bacteria 8785348
771 2824647041 2824644064 Bacteria 8743947
772 2824653955 2824653114 Bacteria 8493680
773 2824666429 2824661429 Bacteria 9877870
774 2824677321 2824671348 Bacteria 8369588
775 2824680295 2824679649 Bacteria 8248951
776 2824693998 2824687955 Bacteria 8360029
777 2824702825 2824696289 Bacteria 8335049
778 2824710675 2824704595 Bacteria 9667483
779 2824717305 2824714736 Bacteria 8717648
780 2824726505 2824723954 Bacteria 8758240
781 2824734952 2824732956 Bacteria 7810675
782 2824748099 2824746037 Bacteria 7911610
783 2824754954 2824753945 Bacteria 9787441
784 2824765192 2824763712 Bacteria 9792355
785 2824775819 2824773399 Bacteria 8360218
786 2834644462 2834641062 Bacteria 5559922
787 2838125190 2838122688 Bacteria 8803140
788 2841945931 2841941048 Bacteria 8688029
789 2841956745 2841949485 Bacteria 8680857
790 2841963340 2841957949 Bacteria 8652217
791 2841973260 2841966195 Bacteria 8673214
792 2841979578 2841974524 Bacteria 8931498
793 2841989300 2841983080 Bacteria 8395090
794 2842044292 2842038055 Bacteria 8002051
795 2842051719 2842045827 Bacteria 8006841
796 2842333513 2842333319 Bacteria 8899485
797 2842720739 2842718218 Bacteria 4560148
798 2844321578 2844315083 Bacteria 8138177
799 2847939550 2847930680 Bacteria 9342022
800 2847941356 2847939898 Bacteria 8606328
801 2849082280 2849076700 Bacteria 7039503
802 2857513248 2857509624 Bacteria 7472071
803 2857525361 2857524615 Bacteria 6615449
804 2874592092 2874590934 Bacteria 8299676
805 2874610216 2874604998 Bacteria 7834745
806 2874620152 2874612657 Bacteria 8252029
807 2874622363 2874620515 Bacteria 8290088
808 2874633008 2874628541 Bacteria 8630250
809 2874647229 2874645413 Bacteria 8214782
810 2876761750 2876761206 Bacteria 10111113
811 2876772304 2876771140 Bacteria 8287509
812 2876809240 2876808645 Bacteria 8824342
813 2876819528 2876818435 Bacteria 8274608
814 2879075980 2879074833 Bacteria 8279565
815 2879091454 2879083081 Bacteria 8587928
816 2879106509 2879099564 Bacteria 10442239
817 2879112486 2879110137 Bacteria 8907982
818 2879130383 2879127579 Bacteria 8294491
819 2879147243 2879142872 Bacteria 8267021
820 2881369694 2881364244 Bacteria 7710352
821 2881670247 2881665667 Bacteria 8175609
822 2885367652 2885366525 Bacteria 8326213
823 2885385348 2885383462 Bacteria 9473874
824 2885417552 2885409591 Bacteria 9235467
825 2888378721 2888378607 Bacteria 9652610
826 2888421012 2888419890 Bacteria 7857137
827 2889036299 2889033259 Bacteria 9099371
828 2893066309 2893066018 Bacteria 6158120
829 2903727848 2903727486 Bacteria 8281579
830 2903771242 2903768456 Bacteria 9749579
831 2904671630 2904666416 Bacteria 8226587
832 2904714380 2904711408 Bacteria 9771557
833 2906602668 2906602504 Bacteria 8295279
834 2906630976 2906626472 Bacteria 8826946
835 2906650603 2906643746 Bacteria 8722424
836 2908776917 2908775508 Bacteria 8092255
837 2919074948 2919073203 Bacteria 6531949
838 2922377595
839 2922389290 2922386360 Bacteria 7017218
840 2922393307 2922393267 Bacteria 8285685
841 2929622373 2929615660 Bacteria 9193770
842 2929629981 2929624759 Bacteria 9339455
843 2932788094 2932784394 Bacteria 9704911
844 2932794928 2932794094 Bacteria 7915132
845 2932805281 2932801729 Bacteria 7987968
846 2932813469 2932809354 Bacteria 9135765
847 2932820166 2932818245 Bacteria 9955613
848 2932832770 2932828146 Bacteria 9745859
849 2933584013 2933577622 Bacteria 9116884
850 2935613000 2935608549 Bacteria 8203142
851 2935620258 2935616580 Bacteria 9032984
852 2935640580 2935638405 Bacteria 10015038
853 2935649281 2935648319 Bacteria 8801166
854 2935657947 2935656913 Bacteria 8965014
855 2935668772 2935665750 Bacteria 9571747
856 2935681500 2935675223 Bacteria 9928132
857 2935687079 2935684952 Bacteria 9590419
858 2935696950 2935694250 Bacteria 9291695
859 2935709718 2935703347 Bacteria 10242284
860 2935716767 2935713505 Bacteria 9608509
861 2935723108 2935722832 Bacteria 9608746
862 2935734665 2935732158 Bacteria 9706831
863 2935744544 2935741537 Bacteria 9707219
864 2935753045 2935750917 Bacteria 9590372
865 2935766941 2935760218 Bacteria 9817913
866 2935775683 2935769743 Bacteria 7878163
867 2935777865 2935777560 Bacteria 8077691
868 2935791264 2935785616 Bacteria 7962367
869 2935799576 2935793552 Bacteria 8012592
870 2935804690 2935801545 Bacteria 9301974
871 2935815842 2935810662 Bacteria 9401221
872 2935825148 2935819856 Bacteria 8261050
873 2935832086 2935827899 Bacteria 10038562
874 2935841084 2935837841 Bacteria 9454360
875 2935852367 2935847175 Bacteria 8228321
876 2935859144 2935855204 Bacteria 9035059
877 2935864328 2935864058 Bacteria 9784707
878 2935875320 2935873716 Bacteria 9632195
879 2935887636 2935883170 Bacteria 7964738
880 2935910801 2935908558 Bacteria 8568796
881 2935921983 2935916978 Bacteria 9113783
882 2935929880 2935926038 Bacteria 8601059
883 2935937548 2935934488 Bacteria 8602579
884 2935948053 2935942939 Bacteria 8599779
885 2935956748 2935951376 Bacteria 8602333
886 2935963987 2935959822 Bacteria 7869783
887 2935970995 2935967501 Bacteria 8603075
888 2935978318 2935975950 Bacteria 8347125
889 2935985559 2935984226 Bacteria 8302647
890 2935995702 2935992306 Bacteria 9802711
891 2936008119 2936002035 Bacteria 9362176
892 2936012166 2936011229 Bacteria 8801034
893 2936020753 2936019824 Bacteria 8804134
894 2936029459 2936028420 Bacteria 8965941
895 2936048217 2936046547 Bacteria 8903709
896 2936056671 2936055302 Bacteria 8785755
897 2940558958 2940556831 Bacteria 9590747
898 2941541654 2941538514 Bacteria 9402094
899 2974321543 2974320154 Bacteria 4571377
900 3003670117 3003665799 Bacteria 7279786
901 3005485762 3005483717 Bacteria 7877331
902 3005510814 3005506211 Bacteria 6943378
903 3005588754 3005587118 Bacteria 7794411
904 3005601941 3005594810 Bacteria 8716512
905 3005717669 3005710791 Bacteria 7622528
906 641642918 641522639 Bacteria 7737025
907 643600951 643348564 Bacteria 8839022
908 8003404130 8003400568 Bacteria 5535898
909 8006966409 8006964411 Bacteria 8966052
910 8006992812 8006984368 Bacteria 9651211
911 8006997072 8006994254 Bacteria 8309700
912 8016517452 8016511872 Bacteria 9921665
913 8016526847 8016522445 Bacteria 8156687
914 8016531940 8016530956 Bacteria 8155261
915 8016545140 8016539877 Bacteria 8155419
916 8016556936 8016548790 Bacteria 8155074
917 8016565287 8016557553 Bacteria 8154380
918 8016570223 8016566248 Bacteria 8158151
919 8016582778 8016575299 Bacteria 8154085
920 8016585533 8016583857 Bacteria 10421953
921 8016602930 8016595262 Bacteria 8149947
922 8016605809 8016603502 Bacteria 8731218
923 8016617712 8016613128 Bacteria 8794220
924 8016634995 8016630954 Bacteria 9217207
925 8017059160 8017057580 Bacteria 10023680
926 8019531758 8019530166 Bacteria 8155624
927 8019539776 8019538911 Bacteria 7872763
928 8019550878 8019547302 Bacteria 7996444
929 8019576472 8019576017 Bacteria 10049540
930 8019611300 8019608314 Bacteria 10042931
931 8019631249 8019629233 Bacteria 8687553
932 8019639374 8019638758 Bacteria 9062356
933 8019651803 8019648815 Bacteria 10014479
934 8019668057 8019659431 Bacteria 8577854
935 8019695574 8019687851 Bacteria 8712826
936 8055227015 8055225921 Bacteria 3341787
937 8055743377 8055742211 Bacteria 9226248
938 8056678267 8056673599 Bacteria 7871253
939 8056683499 8056681323 Bacteria 8472857
940 8056690888 8056689827 Bacteria 6712655
941 8056975451 8056967851 Bacteria 9038162
942 Ga0466963_0052810
943 JGI24744J21845_10013094
944 JGI24742J22300_10010775
945 JGI25151J46595_10002288
946 JGI25406J46586_10000089
947 JGI25406J46586_10000885
948 JGI25153J46596_10001792
949 JGI25153J46596_10003025
950 JGI25153J46596_10003136
951 JGI25160J50197_1003913
952 Ga0055524_1008182
953 Ga0055534_1011189
954 Ga0055531_10002428
955 Ga0055543_1001518
956 Ga0065165_1000415
957 Ga0065165_1027223
958 Ga0070658_10161160
959 Ga0070683_100203991
960 Ga0070670_100210685
961 Ga0068869_100021516
962 Ga0068869_100060160
963 Ga0070666_10234444
964 Ga0070680_100042682
965 Ga0068868_100042187
966 Ga0070661_100041101
967 Ga0070668_100052513
968 Ga0070668_100177828
969 Ga0070669_100317280
970 Ga0070671_100062733
971 Ga0070659_100321938
972 Ga0070667_100222752
973 Ga0070709_10012512
974 Ga0070709_10031036
975 Ga0070709_10031633
976 Ga0070714_100037004
977 Ga0070714_100207818
978 Ga0070713_100029100
979 Ga0070710_10011173
980 Ga0070711_100007005
981 Ga0070711_100009020
982 Ga0070700_100045927
983 Ga0070708_100272628
984 Ga0070663_100009181
985 Ga0070663_100085005
986 Ga0070662_100023244
987 Ga0070685_10261494
988 Ga0070699_100144977
989 Ga0070679_100003707
990 Ga0070697_100131997
991 Ga0070672_100214609
992 Ga0070672_100288666
993 Ga0070665_100006118
994 Ga0070665_100034010
995 Ga0070665_100067568
996 Ga0070665_100130352
997 Ga0070665_100277326
998 Ga0068855_100005214
999 Ga0068855_100292750
1000 Ga0070664_100046714
1001 Ga0068857_100066434
1002 Ga0068852_100295347
1003 Ga0068852_100335321
1004 Ga0068859_100150655
1005 Ga0068864_100016160
1006 Ga0068864_100038317
1007 Ga0068861_100035761
1008 Ga0068863_100130928
1009 Ga0068860_100003866
1010 Ga0068862_100462748
1011 Ga0081455_10002667
1012 Ga0081455_10012598
1013 Ga0081455_10034832
1014 Ga0081538_10002323
1015 Ga0081540_1001266
1016 Ga0081540_1004882
1017 Ga0081540_1010416
1018 Ga0081540_1010842
1019 Ga0081540_1012305
1020 Ga0081540_1020381
1021 Ga0081540_1021353
1022 Ga0081540_1030298
1023 Ga0081540_1032237
1024 Ga0081540_1032288
1025 Ga0081539_10000461
1026 Ga0081539_10000729
1027 Ga0081539_10031929
1028 Ga0081539_10034529
1029 Ga0081539_10066952
1030 Ga0070717_10019858
1031 Ga0070717_10032483
1032 Ga0075365_10013935
1033 Ga0075365_10022911
1034 Ga0075365_10044304
1035 Ga0075365_10064888
1036 Ga0075365_10165135
1037 Ga0075368_10046201
1038 Ga0075363_100003826
1039 Ga0075363_100012251
1040 Ga0075363_100074714
1041 Ga0075364_10058583
1042 Ga0075364_10132637
1043 Ga0075364_10225373
1044 Ga0070716_100001412
1045 Ga0070716_100107414
1046 Ga0070712_100196056
1047 Ga0075367_10042045
1048 Ga0075367_10209436
1049 Ga0075369_10040322
1050 Ga0075369_10043865
1051 Ga0075366_10136676
1052 Ga0075366_10208068
1053 Ga0097621_100078810
1054 Ga0075370_10068260
1055 Ga0075434_100131833
1056 Ga0068865_100015327
1057 Ga0097620_100150655
1058 Ga0099824_1006403
1059 Ga0099824_1018082
1060 Ga0099822_1007370
1061 Ga0099823_1037610
1062 Ga0099794_10002308
1063 Ga0099795_10003024
1064 Ga0099795_10009882
1065 Ga0105240_10023702
1066 Ga0105240_10285015
1067 Ga0105240_10332893
1068 Ga0111539_10038338
1069 Ga0114129_10131915
1070 Ga0105241_10040522
1071 Ga0105241_10142573
1072 Ga0105242_10274808
1073 Ga0105242_10325543
1074 Ga0105248_10163693
1075 Ga0105248_10169254
1076 Ga0105237_10027033
1077 Ga0105237_10235116
1078 Ga0105238_10256670
1079 Ga0105249_10108707
1080 Ga0105249_10458408
1081 Ga0099796_10010340
1082 Ga0099796_10022278
1083 Ga0105239_10078922
1084 Ga0105239_10115267
1085 Ga0105239_10186334
1086 Ga0105239_10223417
1087 Ga0105246_10072422
1088 Ga0105246_10097168
1089 Ga0157370_10031488
1090 Ga0157374_10295269
1091 Ga0157378_10139081
1092 Ga0163162_10087204
1093 Ga0157375_10314033
1094 Ga0163163_10024312
1095 Ga0163163_10067992
1096 Ga0163163_10275411
1097 Ga0157379_10062470
1098 Ga0214544_1000003
1099 Ga0214542_1000022
1100 Ga0214545_1000010
1101 Ga0214545_1031015
1102 Ga0214543_1000035
1103 Ga0213872_10043969
1104 Ga0209677_100902
1105 Ga0209148_1000784
1106 Ga0209233_1000543
1107 Ga0209233_1000561
1108 Ga0209233_1008323
1109 Ga0209455_1001661
1110 Ga0209675_1001296
1111 Ga0209564_1002283
1112 Ga0209564_1008629
1113 Ga0209758_1000015
1114 Ga0209758_1000306
1115 Ga0209758_1000701
1116 Ga0209758_1001694
1117 Ga0209758_1004530
1118 Ga0209256_1000272
1119 Ga0209256_1021845
1120 Ga0207426_1000217
1121 Ga0207426_1001117
1122 Ga0207426_1008688
1123 Ga0207426_1012705
1124 Ga0209257_1001260
1125 Ga0209257_1007750
1126 Ga0209257_1015800
1127 Ga0207692_10010351
1128 Ga0207688_10057283
1129 Ga0207647_10012036
1130 Ga0207685_10013754
1131 Ga0207699_10001724
1132 Ga0207699_10028905
1133 Ga0207699_10047208
1134 Ga0207643_10034912
1135 Ga0207654_10016718
1136 Ga0207654_10019788
1137 Ga0207654_10056358
1138 Ga0207695_10057666
1139 Ga0207695_10338728
1140 Ga0207671_10025812
1141 Ga0207671_10149214
1142 Ga0207671_10198784
1143 Ga0207671_10298843
1144 Ga0207693_10002818
1145 Ga0207663_10004235
1146 Ga0207663_10011381
1147 Ga0207660_10202889
1148 Ga0207662_10086259
1149 Ga0207657_10165202
1150 Ga0207657_10183138
1151 Ga0207649_10040585
1152 Ga0207652_10264786
1153 Ga0207694_10143116
1154 Ga0207694_10153665
1155 Ga0207694_10240496
1156 Ga0207694_10281173
1157 Ga0207687_10069486
1158 Ga0207700_10012595
1159 Ga0207700_10015399
1160 Ga0207664_10009218
1161 Ga0207664_10060839
1162 Ga0207664_10139733
1163 Ga0207644_10086400
1164 Ga0207690_10350574
1165 Ga0207706_10097345
1166 Ga0207706_10412083
1167 Ga0207709_10013681
1168 Ga0207670_10145871
1169 Ga0207669_10031041
1170 Ga0207665_10002759
1171 Ga0207665_10050012
1172 Ga0207665_10061168
1173 Ga0207691_10173501
1174 Ga0207711_10135997
1175 Ga0207689_10071727
1176 Ga0207689_10095790
1177 Ga0207689_10108961
1178 Ga0207667_10145163
1179 Ga0207712_10063310
1180 Ga0207668_10143502
1181 Ga0207658_10283210
1182 Ga0207703_10032866
1183 Ga0207678_10062792
1184 Ga0207678_10121620
1185 Ga0207678_10255573
1186 Ga0207678_10362892
1187 Ga0207708_10144105
1188 Ga0207641_10095333
1189 Ga0207648_10043034
1190 Ga0207648_10165856
1191 Ga0207648_10187430
1192 Ga0207676_10027587
1193 Ga0207674_10129947
1194 Ga0207675_100052832
1195 Ga0207675_100298097
1196 Ga0207683_10120195
1197 Ga0207683_10143826
1198 Ga0207683_10431938
1199 Ga0209389_1000012
1200 Ga0209389_1000052
1201 Ga0209589_1000015
1202 Ga0209589_1000058
1203 Ga0209489_100015
1204 Ga0209489_100019
1205 Ga0209489_100020
1206 Ga0209700_100018
1207 Ga0209700_100025
1208 Ga0209588_1000822
1209 Ga0209813_10024637
1210 Ga0209813_10033217
1211 Ga0268266_10000936
1212 Ga0268266_10001232
1213 Ga0268266_10011944
1214 Ga0268266_10037059
1215 Ga0268265_10415570
1216 Ga0268264_10000073
1217 Ga0265319_1002449
1218 Ga0265334_10004379
1219 Ga0265318_10001721
1220 Ga0265318_10014731
1221 Ga0265323_10000822
1222 Ga0265336_10002743
1223 Ga0307517_10000476
1224 Ga0307517_10140253
1225 Ga0307515_10121156
1226 Ga0265338_10000176
1227 Ga0265324_10002446
1228 Ga0265330_10017291
1229 Ga0265330_10055412
1230 Ga0265325_10043560
1231 Ga0265340_10035701
1232 Ga0265340_10046406
1233 Ga0265339_10022304
1234 Ga0265331_10030941
1235 Ga0307509_10067824
1236 Ga0307509_10106278
1237 Ga0307509_10140559
1238 Ga0265313_10026059
1239 Ga0307508_10000740
1240 Ga0307508_10176710
1241 Ga0307508_10247379
1242 Ga0265342_10003084
1243 Ga0265342_10032748
1244 Ga0265342_10047735
1245 Ga0316576_10003774
1246 Ga0307516_10017246
1247 Ga0307516_10063273
1248 Ga0307405_10183097
1249 Ga0307411_10041450
1250 Ga0307510_10026086
1251 Ga0307510_10046575
1252 Ga0307510_10055610
1253 Ga0373934_0009613
1254 Ga0373944_0002516
1255 Ga0373923_0001598
1256 Ga0373923_0007180
1257 Ga0373923_0029285
1258 Ga0373936_0015828
1259 Ga0373936_0036898
1260 Ga0373945_0007782
1261 Ga0373953_0000365
1262 Ga0373953_0054773
1263 Ga0373954_0000474
1264 Ga0373954_0024611
1265 Ga0373956_0017676
1266 Ga0373956_0023157
1267 Ga0373957_0000677
1268 Ga0373943_0001393
1269 Ga0373946_0047144
1270 Ga0373955_0000870
1271 Ga0373955_0007967
1272 Ga0373955_0084838
1273 Ga0373924_0005372
1274 Ga0373931_0005817
1275 Ga0373935_0004338
1276 Ga0373935_0046033
1277 Ga0373935_0122777
1278 Ga0373935_0170286
1279 Ga0373935_0301710
1280 Ga0373927_0006494
1281 Ga0373927_0020110
1282 Ga0373927_0021557
1283 Ga0373933_0000158
1284 Ga0373933_0001161
1285 Ga0373933_0030660
1286 Ga0373947_0005561
1287 Ga0373947_0005689
1288 Ga0373937_0008434
1289 Ga0373937_0111845
1290 Ga0316584_0002193
1291 Ga0373925_0002440
1292 Ga0373925_0009266
1293 Ga0373925_0009840
1294 Ga0373925_0094377
1295 Ga0373925_0245062
1296 Ga0395898_0254442
1297 Ga0395905_0004146
1298 Ga0436365_0747992
1299 Ga0436361_0960294
1300 Ga0436363_0039721
1301 Ga0436362_0159823
1302 Ga0451804_0429416
1303 Ga0451849_0305165
1304 Ga0450911_000210
1305 Ga0466972_0000295
1306 Ga0466972_0015953
1307 Ga0466966_0002033
1308 Ga0466961_0000087
1309 Ga0466968_0061456
1310 Ga0466957_0257535
1311 Ga0466959_0002003
1312 Ga0466967_0083170
1313 Ga0495592_0003034
1314 Ga0495592_0004669
1315 Ga0495592_0019284
1316 Ga0495592_0068558
1317 Ga0495603_0000029
1318 Ga0495603_0005242
1319 Ga0495603_0036039
1320 Ga0495603_0044791
1321 Ga0495629_0000029
1322 Ga0495629_0002638
1323 Ga0495629_0028887
1324 Ga0495629_0061905
1325 Ga0495638_0003622
1326 Ga0495638_0015943
1327 Ga0495638_0016057
1328 Ga0495638_0016277
1329 Ga0495641_0005506
1330 Ga0495651_0001923
1331 Ga0495651_0002607
1332 Ga0495651_0088625
1333 Ga0495651_0090735
1334 Ga0495653_0000341
1335 Ga0495580_0005561
1336 Ga0495580_0010591
1337 Ga0495582_0000068
1338 Ga0495582_0016420
1339 Ga0495605_0083470
1340 Ga0495639_0000006
1341 Ga0495639_0014829
1342 Ga0495662_0003219
1343 Ga0495664_0004785
1344 Ga0495664_0020110
1345 Ga0495664_0039694
1346 Ga0495664_0101448
1347 Ga0495594_0000750
1348 Ga0495596_0038323
1349 Ga0495583_0050734
1350 Ga0495606_0086474
1351 Ga0495608_0000606
1352 Ga0495608_0010182
1353 Ga0495608_0063403
1354 Ga0495608_0172658
1355 Ga0495610_0095184
1356 Ga0495618_0077613
1357 Ga0495618_0239314
1358 Ga0495628_0011645
1359 Ga0495628_0027421
1360 Ga0495630_0005874
1361 Ga0495631_0055651
1362 Ga0495631_0075568
1363 Ga0495643_0054915
1364 Ga0495644_0033143
1365 Ga0495648_0002484
1366 Ga0495648_0011475
1367 Ga0495648_0036375
1368 Ga0495648_0101093
1369 Ga0495666_0024498
1370 Ga0495652_0007527
1371 Ga0495652_0012146
1372 Ga0495652_0048701
1373 Ga0495652_0066072
1374 Ga0495652_0130916
1375 Ga0495652_0285224
1376 Ga0495654_0034752
1377 Ga0495665_0000237
1378 Ga0495665_0020476
1379 Ga0495640_0005842
1380 Ga0495640_0006116
1381 Ga0495640_0007919
1382 Ga0495587_0001595
1383 Ga0495587_0002682
1384 Ga0495645_0040515
1385 Ga0495645_0061502
1386 Ga0495622_0009979
1387 Ga0495622_0021661
1388 Ga0495667_0003214
1389 Ga0495667_0011892
1390 Ga0495667_0101621
1391 Ga0495656_0044715
1392 Ga0495668_0006062
1393 Ga0495668_0065969
1394 Ga0495634_0001307
1395 Ga0495634_0010145
1396 Ga0495634_0040885
1397 Ga0495634_0075256
1398 Ga0495625_0029057
1399 Ga0495625_0218206
1400 Ga0495635_0000092
1401 Ga0495635_0019780
1402 Ga0495635_0028796
1403 Ga0495635_0047078
1404 Ga0495661_0036570
1405 Ga0495588_0011966
1406 Ga0495657_0003498
1407 Ga0495657_0006462
1408 Ga0495657_0037121
1409 Ga0495657_0128859
1410 Ga0495599_0005823
1411 Ga0495599_0007153
1412 Ga0495623_0004160
1413 Ga0495623_0004635
1414 Ga0495646_0004002
1415 Ga0495646_0052734
1416 Ga0495646_0100800
1417 Ga0495647_0003788
1418 Ga0495647_0060863
1419 Ga0495658_0002427
1420 Ga0495613_0000582
1421 Ga0495613_0019334
1422 Ga0495613_0111035
1423 Ga0495613_0188238
1424 Ga0495624_0151330
1425 Ga0495670_0030891
1426 Ga0495649_0141527
1427 Ga0495649_0164447
1428 Ga0495600_0001905
1429 Ga0495600_0002533
1430 Ga0495600_0014076
1431 Ga0495600_0038562
1432 Ga0495600_0128684
1433 Ga0495581_0000048
1434 Ga0495581_0139709
1435 Ga0495581_0190222
1436 Ga0495581_0198818
1437 Ga0495604_0001244
1438 Ga0495604_0003533
1439 Ga0495604_0058268
1440 Ga0495604_0081406
1441 Ga0495674_0009200
1442 Ga0495674_0011197
1443 Ga0495674_0016889
1444 Ga0495674_0173317
1445 Ga0495672_0007852
1446 Ga0495672_0012029
1447 Ga0495676_0053573
1448 Ga0495680_0000546
1449 Ga0495680_0006001
1450 Ga0495687_043565
1451 Ga0495675_0001333
1452 Ga0495675_0009372
1453 Ga0495675_0112280
1454 Ga0495685_017516
1455 Ga0495673_0059165
1456 Ga0495673_0059235
1457 Ga0495684_0000032
1458 Ga0495684_0002955
1459 Ga0495684_0063799
1460 Ga0495686_0049142
1461 Ga0495686_0049237
1462 Ga0495593_0000556
1463 Ga0495593_0000660
1464 Ga0495602_0003334
1465 Ga0495602_0006506
1466 Ga0495602_0153553
1467 Ga0495602_0231460
1468 Ga0496101_0020506
1469 Ga0496101_0325999
1470 Ga0496102_0009365
1471 Ga0496102_0029530
1472 Ga0496102_0173731
1473 Ga0496103_0039337
1474 Ga0496103_0082413
1475 Ga0496103_0085757
1476 Ga0496104_0073659
1477 Ga0496104_0084884
1478 Ga0496105_0010801
1479 Ga0496105_0011478
1480 Ga0496105_0032337
1481 Ga0496106_0004140
1482 Ga0496106_0005511
1483 Ga0496106_0009870
1484 Ga0496106_0101452
1485 Ga0496106_0229856
1486 Ga0496106_0273268
1487 Ga0496107_0136247
1488 Ga0496107_0165980
1489 Ga0496108_0067452
1490 Ga0496108_0235856
1491 Ga0496109_0026957
1492 Ga0496110_0007995
1493 Ga0496110_0024944
1494 Ga0496110_0030548
1495 Ga0496110_0196880
1496 Ga0496110_0281533
1497 Ga0496111_0109768
1498 Ga0496112_0000169
1499 Ga0496112_0011528
1500 Ga0496112_0019225
1501 Ga0496112_0062276
1502 Ga0496112_0463508
1503 Ga0496113_0168171
1504 Ga0496114_0018487
1505 Ga0496115_0000889
1506 Ga0496115_0058415
1507 Ga0496115_0069856
1508 Ga0496115_0130878
1509 Ga0496115_0147538
1510 Ga0496116_0008611
1511 Ga0496116_0057216
1512 Ga0496116_0087090
1513 Ga0496117_0023533
1514 Ga0496117_0030017
1515 Ga0496117_0058124
1516 Ga0496117_0078000
1517 Ga0496117_0099551
1518 Ga0496118_0037060
1519 Ga0496118_0043939
1520 Ga0496118_0045932
1521 Ga0496118_0073192
1522 Ga0496118_0083401
1523 Ga0496119_0012324
1524 Ga0496119_0076976
1525 Ga0496120_0062215
1526 Ga0496121_0000155
1527 Ga0496121_0000218
1528 Ga0496121_0003892
1529 Ga0496121_0007080
1530 Ga0496121_0011030
1531 Ga0496121_0027285
1532 Ga0496121_0038776
1533 Ga0496121_0069992
1534 Ga0496122_0012396
1535 Ga0496122_0020536
1536 Ga0496122_0033693
1537 Ga0496123_0022201
1538 Ga0496123_0069865
1539 Ga0496123_0148245
1540 Ga0496124_0025392
1541 Ga0496124_0059392
1542 Ga0496124_0117718
1543 Ga0496124_0130505
1544 Ga0496125_0002212
1545 Ga0496125_0003115
1546 Ga0496125_0006315
1547 Ga0496125_0012310
1548 Ga0496125_0036214
1549 Ga0496125_0040815
1550 Ga0496125_0142561
1551 Ga0496125_0143744
1552 Ga0496126_0003000
1553 Ga0496126_0005013
1554 Ga0496126_0009925
1555 Ga0496126_0012765
1556 Ga0496126_0014895
1557 Ga0496126_0019762
1558 Ga0496126_0040827
1559 Ga0496126_0059401
1560 Ga0496126_0069880
1561 Ga0496126_0088546
1562 Ga0496126_0091578
1563 Ga0496126_0130897
1564 Ga0496126_0131930
1565 Ga0496126_0143331
1566 Ga0496126_0196426
1567 Ga0496126_0218469
1568 Ga0496126_0333421
1569 Ga0501067_0091274
1570 Ga0501067_0249615
1571 Ga0501080_0116162
1572 nmdc:mga03n38_351_c1
1573 nmdc:mga00v17_113578_c1
1574 nmdc:mga00v17_128029_c1
1575 nmdc:mga0yw44_10551_c1
1576 nmdc:mga0yw44_133679_c1
1577 nmdc:mga0yw44_21457_c1
1578 nmdc:mga0yw44_41406_c1
1579 nmdc:mga0yw44_48499_c1
1580 nmdc:mga0yw44_72656_c1
1581 nmdc:mga0k408_31663_c1
1582 nmdc:mga06z11_127502_c1
1583 nmdc:mga06z11_165679_c1
1584 nmdc:mga06z11_40480_c1
1585 nmdc:mga04h51_28926_c1
1586 nmdc:mga07m45_13635_c1
1587 nmdc:mga07m45_69152_c1
1588 nmdc:mga07m45_93184_c1
1589 nmdc:mga05p37_315897_c1
1590 nmdc:mga08y16_484243_c1
1591 nmdc:mga08y16_66493_c1
1592 nmdc:mga0n895_127425_c1
1593 nmdc:mga0sz30_24364_c1
1594 Ga0495601_0001683
1595 Ga0495601_0142735
1596 Ga0495595_0003264
1597 Ga0495619_0000267
1598 Ga0495619_0065596
1599 Ga0500643_000048
1600 Ga0500644_0000703
1601 Ga0500644_0019536
1602 Ga0500646_0027563
1603 Ga0500651_0005923
1604 Ga0500651_0057151
1605 Ga0500566_0000110
1606 Ga0500566_0007240
1607 Ga0500566_0018033
1608 Ga0500566_0127246
1609 Ga0500640_011481
1610 Ga0500641_0005426
1611 Ga0500641_0077440
1612 Ga0500650_0026722
1613 Ga0500650_0087658
1614 Ga0500554_010006
1615 Ga0500556_0000003
1616 Ga0500556_0003783
1617 Ga0500557_000124
1618 Ga0500569_000744
1619 Ga0500572_002210
1620 Ga0500572_002958
1621 Ga0500593_078733
1622 Ga0500594_0005603
1623 Ga0500595_000003
1624 Ga0500595_002302
1625 Ga0500595_005550
1626 Ga0500595_011786
1627 Ga0500595_011873
1628 Ga0500595_013114
1629 Ga0500608_024592
1630 Ga0500608_031117
1631 Ga0500614_000900
1632 Ga0500642_0000100
1633 Ga0500642_0000104
1634 Ga0500652_008493
1635 Ga0500658_0015470
1636 Ga0500559_0000117
1637 Ga0500559_0005440
1638 Ga0500559_0010513
1639 Ga0500559_0085304
1640 Ga0500568_0007163
1641 Ga0500568_0007686
1642 Ga0500568_0038564
1643 Ga0500586_000338
1644 Ga0500590_089316
1645 Ga0500603_000515
1646 Ga0500603_001374
1647 Ga0500604_0000898
1648 Ga0500616_0000002
1649 Ga0500616_0000033
1650 Ga0500622_0001002
1651 Ga0500622_0017813
1652 Ga0500630_004083
1653 Ga0500633_0024503
1654 Ga0500638_047139
1655 Ga0500638_056257
1656 Ga0500638_076593
1657 Ga0500639_000598
1658 Ga0500639_031207
1659 Ga0500636_0000016
1660 Ga0500636_0078196
1661 Ga0500636_0110815
1662 Ga0500637_0000347
1663 Ga0500637_0003619
1664 Ga0500625_045065
1665 Ga0500645_000087
1666 Ga0500645_002736
1667 Ga0500552_004018
1668 Ga0500596_007853
1669 Ga0500599_002849
1670 Ga0500601_000591
1671 Ga0500661_000111
1672 Ga0500661_005787
1673 2507505825
1674 2508540018
1675 2508696093
1676 2509153663
1677 2511394514
1678 2513626485
1679 2513638874
1680 2513649791
1681 2513678178
1682 2513694769
1683 2513702980
1684 2513715466
1685 2513875457
1686 2513891706
1687 2513913357
1688 2514011167
1689 2515630825
1690 2517105765
1691 2524435495
1692 2524466256
1693 2528851060
1694 2545676751
1695 2548500555
1696 2585899901
1697 2603860414
1698 2617347707
1699 2617374436
1700 2644646897
1701 2723842198
1702 2745081339
1703 2793063687
1704 2793078041
1705 2805921187
1706 2818240791
1707 2824603511
1708 2824610902
1709 2824619426
1710 2824627881
1711 2824636075
1712 2824647041
1713 2824653955
1714 2824666429
1715 2824677321
1716 2824680295
1717 2824693998
1718 2824702825
1719 2824710675
1720 2824717305
1721 2824726505
1722 2824734952
1723 2824748099
1724 2824754954
1725 2824765192
1726 2824775819
1727 2834644462
1728 2838125190
1729 2841945931
1730 2841956745
1731 2841963340
1732 2841973260
1733 2841979578
1734 2841989300
1735 2842044292
1736 2842051719
1737 2842333513
1738 2842720739
1739 2844321578
1740 2847939550
1741 2847941356
1742 2849082280
1743 2857513248
1744 2857525361
1745 2874592092
1746 2874610216
1747 2874620152
1748 2874622363
1749 2874633008
1750 2874647229
1751 2876761750
1752 2876772304
1753 2876809240
1754 2876819528
1755 2879075980
1756 2879091454
1757 2879106509
1758 2879112486
1759 2879130383
1760 2879147243
1761 2881369694
1762 2881670247
1763 2885367652
1764 2885385348
1765 2885417552
1766 2888378721
1767 2888421012
1768 2889036299
1769 2893066309
1770 2903727848
1771 2903771242
1772 2904671630
1773 2904714380
1774 2906602668
1775 2906630976
1776 2906650603
1777 2908776917
1778 2919074948
1779 2922377595
1780 2922389290
1781 2922393307
1782 2929622373
1783 2929629981
1784 2932788094
1785 2932794928
1786 2932805281
1787 2932813469
1788 2932820166
1789 2932832770
1790 2933584013
1791 2935613000
1792 2935620258
1793 2935640580
1794 2935649281
1795 2935657947
1796 2935668772
1797 2935681500
1798 2935687079
1799 2935696950
1800 2935709718
1801 2935716767
1802 2935723108
1803 2935734665
1804 2935744544
1805 2935753045
1806 2935766941
1807 2935775683
1808 2935777865
1809 2935791264
1810 2935799576
1811 2935804690
1812 2935815842
1813 2935825148
1814 2935832086
1815 2935841084
1816 2935852367
1817 2935859144
1818 2935864328
1819 2935875320
1820 2935887636
1821 2935910801
1822 2935921983
1823 2935929880
1824 2935937548
1825 2935948053
1826 2935956748
1827 2935963987
1828 2935970995
1829 2935978318
1830 2935985559
1831 2935995702
1832 2936008119
1833 2936012166
1834 2936020753
1835 2936029459
1836 2936048217
1837 2936056671
1838 2940558958
1839 2941541654
1840 2974321543
1841 3003670117
1842 3005485762
1843 3005510814
1844 3005588754
1845 3005601941
1846 3005717669
1847 641642918
1848 643600951
1849 8003404130
1850 8006966409
1851 8006992812
1852 8006997072
1853 8016517452
1854 8016526847
1855 8016531940
1856 8016545140
1857 8016556936
1858 8016565287
1859 8016570223
1860 8016582778
1861 8016585533
1862 8016602930
1863 8016605809
1864 8016617712
1865 8016634995
1866 8017059160
1867 8019531758
1868 8019539776
1869 8019550878
1870 8019576472
1871 8019611300
1872 8019631249
1873 8019639374
1874 8019651803
1875 8019668057
1876 8019695574
1877 8055227015
1878 8055743377
1879 8056678267
1880 8056683499
1881 8056690888
1882 8056975451

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

311

376

0.99

PF00005

ABC_tran

ABC transporter

110

260

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9417 22 264
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9347 24 279
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9267 22 273
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9262 25 272
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9261 23 250
ID Description Score Start End Superfamily
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9566 22 283 3.40.50.300
af_P0AAH8_2_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.948 22 273 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9457 25 271 3.40.50.300
af_I6Y482_280_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 24 285 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 25 272 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7K3DSM3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9666 66 281 GO:0005524
GO:0016887
GO:0055085
AF-A0A212DUA4-F1-model_v4 deleted 0.9649 109 248
AF-A0A5C6AC51-F1-model_v4 Glutathione import ATP-binding protein GsiA (EC 3.6.3.-) 0.9599 22 279 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A841PNC6-F1-model_v4 Nickel transport system ATP-binding protein 0.9538 24 255 GO:0005524
GO:0016887
GO:0055085
AF-Q3BNZ3-F1-model_v4 Methionine import ATP-binding protein MetN (EC 7.4.2.11) 0.9494 25 273 GO:0005524
GO:0005886
GO:0016887
GO:0033232

Map