F486336
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 941 | 581 | 1882 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0052810|Ga0466963_0052810_1107_2351 |
| Length | 414 |
| Sequence | MRSRIHEFSVVPANAGAHNHRTRLLRHLGAASVPDHHGLWLWVPDRHSRCSLVRDDSGVWRMSETLSADMLKPVEDRGGVAQPLLEVKGLTKHFPVRGDLFSARKTVRAVDDVSFAVMKGETVGIVGESGCGKSTTARLLMHLMARDAGDIVYDGMQVGASLSLRELRRGMQMVFQDSYASLNPRLTVEESIAFGPKVHGMADGAARKLARELLGKVGLRPDIFANRYPHEISGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLADLKREFGLTYLFISHDLNVVRYISDRVLVMYLGEVVELGPVDEVWDHPAHPYTRALLAAMPSSDPDRRTETPPISGDPPNPIDPPPGCRFHTRCPFAEPLCAKATPKLTALDKMGHEAACYMAIAGSGHSRAPKGVNAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 71 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 72 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 95 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 96 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 97 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 211 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 213 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 320 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 339 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 341 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 342 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 343 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 350 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 354 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 360 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 368 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 371 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 372 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 373 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 374 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 375 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 376 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 377 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 378 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 379 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 380 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 381 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 382 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 383 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 384 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 385 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 386 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 387 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 388 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 389 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 390 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 391 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 392 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 393 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 394 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 395 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 396 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 397 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 398 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 399 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 400 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 401 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 402 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 403 | 2791355199 | |||
| 404 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 405 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 406 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 407 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 408 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 409 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 410 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 411 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 412 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 413 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 414 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 415 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 416 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 417 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 418 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 419 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 420 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 421 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 422 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 423 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 424 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 425 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 426 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 427 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 428 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 429 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 430 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 431 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 432 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 433 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 434 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 435 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 436 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 437 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 438 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 439 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 440 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 441 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 442 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 443 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 444 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 445 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 446 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 447 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 448 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 449 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 450 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 451 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 452 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 453 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 454 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 455 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 456 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 457 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 458 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 459 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 460 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 461 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 462 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 463 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 464 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 465 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 466 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 467 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 468 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 469 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 470 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 471 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 472 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 473 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 474 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 475 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 476 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 477 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 478 | 2922368715 | |||
| 479 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 480 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 481 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 482 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 483 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 484 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 485 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 486 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 487 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 488 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 489 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 490 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 491 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 492 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 493 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 494 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 495 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 496 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 497 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 498 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 499 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 500 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 501 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 502 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 503 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 504 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 505 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 506 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 507 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 508 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 509 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 510 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 511 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 512 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 513 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 514 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 515 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 516 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 517 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 518 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 519 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 520 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 521 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 522 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 523 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 524 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 525 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 526 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 527 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 528 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 529 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 530 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 531 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 532 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 533 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 534 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 535 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 536 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 537 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 538 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 539 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 540 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 541 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 542 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 543 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 544 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 545 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 546 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 547 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 548 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 549 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 550 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 551 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 552 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 553 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 554 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 555 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 556 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 557 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 558 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 559 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 560 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 561 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 562 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 563 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 564 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 565 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 566 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 567 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 568 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 569 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 570 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 571 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 572 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 573 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 574 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 575 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 576 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 577 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 578 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 579 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 580 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 581 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.85 |
| Metatranscriptomes | 0 |
| Isolates | 22.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.62 |
| Nodule | 17.22 |
| Rhizoplane | 4.68 |
| Rhizosphere | 47.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0052810 | 3300044694 | Bacteria | 2697 |
| 2 | JGI24744J21845_10013094 | 3300002077 | Bacteria | 1675 |
| 3 | JGI24742J22300_10010775 | 3300002244 | Bacteria | 1514 |
| 4 | JGI25151J46595_10002288 | 3300003187 | Bacteria | 11731 |
| 5 | JGI25406J46586_10000089 | 3300003203 | Bacteria | 41556 |
| 6 | JGI25406J46586_10000885 | 3300003203 | Bacteria | 14114 |
| 7 | JGI25153J46596_10001792 | 3300003215 | Bacteria | 12743 |
| 8 | JGI25153J46596_10003025 | 3300003215 | Bacteria | 9506 |
| 9 | JGI25153J46596_10003136 | 3300003215 | Bacteria | 9321 |
| 10 | JGI25160J50197_1003913 | 3300003354 | Bacteria | 6520 |
| 11 | Ga0055524_1008182 | 3300003775 | Bacteria | 4367 |
| 12 | Ga0055534_1011189 | 3300003784 | Bacteria | 1838 |
| 13 | Ga0055531_10002428 | 3300003794 | Bacteria | 12474 |
| 14 | Ga0055543_1001518 | 3300004625 | Bacteria | 9106 |
| 15 | Ga0065165_1000415 | 3300005262 | Bacteria | 67666 |
| 16 | Ga0065165_1027223 | 3300005262 | Bacteria | 1867 |
| 17 | Ga0070658_10161160 | 3300005327 | Bacteria | 1882 |
| 18 | Ga0070683_100203991 | 3300005329 | Bacteria | 1878 |
| 19 | Ga0070670_100210685 | 3300005331 | Bacteria | 1690 |
| 20 | Ga0068869_100021516 | 3300005334 | Bacteria | 4438 |
| 21 | Ga0068869_100060160 | 3300005334 | Bacteria | 2783 |
| 22 | Ga0070666_10234444 | 3300005335 | Bacteria | 1297 |
| 23 | Ga0070680_100042682 | 3300005336 | Bacteria | 3681 |
| 24 | Ga0068868_100042187 | 3300005338 | Bacteria | 3559 |
| 25 | Ga0070661_100041101 | 3300005344 | Bacteria | 3374 |
| 26 | Ga0070668_100052513 | 3300005347 | Bacteria | 3141 |
| 27 | Ga0070668_100177828 | 3300005347 | Bacteria | 1736 |
| 28 | Ga0070669_100317280 | 3300005353 | Bacteria | 1258 |
| 29 | Ga0070671_100062733 | 3300005355 | Bacteria | 3094 |
| 30 | Ga0070659_100321938 | 3300005366 | Bacteria | 1293 |
| 31 | Ga0070667_100222752 | 3300005367 | Bacteria | 1679 |
| 32 | Ga0070709_10012512 | 3300005434 | Bacteria | 4750 |
| 33 | Ga0070709_10031036 | 3300005434 | Bacteria | 3212 |
| 34 | Ga0070709_10031633 | 3300005434 | Bacteria | 3184 |
| 35 | Ga0070714_100037004 | 3300005435 | Bacteria | 4098 |
| 36 | Ga0070714_100207818 | 3300005435 | Bacteria | 1793 |
| 37 | Ga0070713_100029100 | 3300005436 | Bacteria | 4370 |
| 38 | Ga0070710_10011173 | 3300005437 | Bacteria | 4430 |
| 39 | Ga0070711_100007005 | 3300005439 | Bacteria | 6841 |
| 40 | Ga0070711_100009020 | 3300005439 | Bacteria | 6124 |
| 41 | Ga0070700_100045927 | 3300005441 | Bacteria | 2696 |
| 42 | Ga0070708_100272628 | 3300005445 | Bacteria | 1592 |
| 43 | Ga0070663_100009181 | 3300005455 | Bacteria | 6115 |
| 44 | Ga0070663_100085005 | 3300005455 | Bacteria | 2334 |
| 45 | Ga0070662_100023244 | 3300005457 | Bacteria | 4256 |
| 46 | Ga0070685_10261494 | 3300005466 | Bacteria | 1151 |
| 47 | Ga0070699_100144977 | 3300005518 | Bacteria | 2098 |
| 48 | Ga0070679_100003707 | 3300005530 | Bacteria | 14002 |
| 49 | Ga0070697_100131997 | 3300005536 | Bacteria | 2095 |
| 50 | Ga0070672_100214609 | 3300005543 | Bacteria | 1613 |
| 51 | Ga0070672_100288666 | 3300005543 | Bacteria | 1388 |
| 52 | Ga0070665_100006118 | 3300005548 | Bacteria | 12305 |
| 53 | Ga0070665_100034010 | 3300005548 | Bacteria | 5126 |
| 54 | Ga0070665_100067568 | 3300005548 | Bacteria | 3584 |
| 55 | Ga0070665_100130352 | 3300005548 | Bacteria | 2517 |
| 56 | Ga0070665_100277326 | 3300005548 | Bacteria | 1678 |
| 57 | Ga0068855_100005214 | 3300005563 | Bacteria | 15852 |
| 58 | Ga0068855_100292750 | 3300005563 | Bacteria | 1805 |
| 59 | Ga0070664_100046714 | 3300005564 | Bacteria | 3657 |
| 60 | Ga0068857_100066434 | 3300005577 | Bacteria | 3209 |
| 61 | Ga0068852_100295347 | 3300005616 | Bacteria | 1567 |
| 62 | Ga0068852_100335321 | 3300005616 | Bacteria | 1473 |
| 63 | Ga0068859_100150655 | 3300005617 | Bacteria | 2401 |
| 64 | Ga0068864_100016160 | 3300005618 | Bacteria | 6211 |
| 65 | Ga0068864_100038317 | 3300005618 | Bacteria | 4094 |
| 66 | Ga0068861_100035761 | 3300005719 | Bacteria | 3681 |
| 67 | Ga0068863_100130928 | 3300005841 | Bacteria | 2395 |
| 68 | Ga0068860_100003866 | 3300005843 | Bacteria | 15387 |
| 69 | Ga0068862_100462748 | 3300005844 | Bacteria | 1197 |
| 70 | Ga0081455_10002667 | 3300005937 | Bacteria | 21110 |
| 71 | Ga0081455_10012598 | 3300005937 | Bacteria | 8428 |
| 72 | Ga0081455_10034832 | 3300005937 | Bacteria | 4507 |
| 73 | Ga0081538_10002323 | 3300005981 | Bacteria | 18774 |
| 74 | Ga0081540_1001266 | 3300005983 | Bacteria | 22020 |
| 75 | Ga0081540_1004882 | 3300005983 | Bacteria | 10100 |
| 76 | Ga0081540_1010416 | 3300005983 | Bacteria | 6301 |
| 77 | Ga0081540_1010842 | 3300005983 | Bacteria | 6126 |
| 78 | Ga0081540_1012305 | 3300005983 | Bacteria | 5647 |
| 79 | Ga0081540_1020381 | 3300005983 | Bacteria | 3991 |
| 80 | Ga0081540_1021353 | 3300005983 | Bacteria | 3860 |
| 81 | Ga0081540_1030298 | 3300005983 | Bacteria | 2999 |
| 82 | Ga0081540_1032237 | 3300005983 | Bacteria | 2865 |
| 83 | Ga0081540_1032288 | 3300005983 | Bacteria | 2862 |
| 84 | Ga0081539_10000461 | 3300005985 | Bacteria | 86158 |
| 85 | Ga0081539_10000729 | 3300005985 | Bacteria | 65907 |
| 86 | Ga0081539_10031929 | 3300005985 | Bacteria | 3235 |
| 87 | Ga0081539_10034529 | 3300005985 | Bacteria | 3057 |
| 88 | Ga0081539_10066952 | 3300005985 | Bacteria | 1945 |
| 89 | Ga0070717_10019858 | 3300006028 | Bacteria | 5276 |
| 90 | Ga0070717_10032483 | 3300006028 | Bacteria | 4207 |
| 91 | Ga0075365_10013935 | 3300006038 | Bacteria | 4824 |
| 92 | Ga0075365_10022911 | 3300006038 | Bacteria | 3920 |
| 93 | Ga0075365_10044304 | 3300006038 | Bacteria | 2914 |
| 94 | Ga0075365_10064888 | 3300006038 | Bacteria | 2447 |
| 95 | Ga0075365_10165135 | 3300006038 | Bacteria | 1544 |
| 96 | Ga0075368_10046201 | 3300006042 | Bacteria | 1722 |
| 97 | Ga0075363_100003826 | 3300006048 | Bacteria | 6487 |
| 98 | Ga0075363_100012251 | 3300006048 | Bacteria | 4129 |
| 99 | Ga0075363_100074714 | 3300006048 | Bacteria | 1846 |
| 100 | Ga0075364_10058583 | 3300006051 | Bacteria | 2524 |
| 101 | Ga0075364_10132637 | 3300006051 | Bacteria | 1672 |
| 102 | Ga0075364_10225373 | 3300006051 | Bacteria | 1273 |
| 103 | Ga0070716_100001412 | 3300006173 | Bacteria | 10658 |
| 104 | Ga0070716_100107414 | 3300006173 | Bacteria | 1723 |
| 105 | Ga0070712_100196056 | 3300006175 | Bacteria | 1583 |
| 106 | Ga0075367_10042045 | 3300006178 | Bacteria | 2673 |
| 107 | Ga0075367_10209436 | 3300006178 | Bacteria | 1219 |
| 108 | Ga0075369_10040322 | 3300006186 | Bacteria | 1995 |
| 109 | Ga0075369_10043865 | 3300006186 | Bacteria | 1920 |
| 110 | Ga0075366_10136676 | 3300006195 | Bacteria | 1480 |
| 111 | Ga0075366_10208068 | 3300006195 | Bacteria | 1190 |
| 112 | Ga0097621_100078810 | 3300006237 | Bacteria | 2737 |
| 113 | Ga0075370_10068260 | 3300006353 | Bacteria | 2030 |
| 114 | Ga0075434_100131833 | 3300006871 | Bacteria | 2519 |
| 115 | Ga0068865_100015327 | 3300006881 | Bacteria | 4887 |
| 116 | Ga0097620_100150655 | 3300006931 | Bacteria | 2401 |
| 117 | Ga0099824_1006403 | 3300006942 | Bacteria | 16176 |
| 118 | Ga0099824_1018082 | 3300006942 | Bacteria | 5888 |
| 119 | Ga0099822_1007370 | 3300006943 | Bacteria | 14235 |
| 120 | Ga0099823_1037610 | 3300006944 | Bacteria | 3651 |
| 121 | Ga0099794_10002308 | 3300007265 | Bacteria | 7006 |
| 122 | Ga0099795_10003024 | 3300007788 | Bacteria | 4095 |
| 123 | Ga0099795_10009882 | 3300007788 | Bacteria | 2786 |
| 124 | Ga0105240_10023702 | 3300009093 | Bacteria | 8106 |
| 125 | Ga0105240_10285015 | 3300009093 | Bacteria | 1896 |
| 126 | Ga0105240_10332893 | 3300009093 | Bacteria | 1727 |
| 127 | Ga0111539_10038338 | 3300009094 | Bacteria | 5780 |
| 128 | Ga0114129_10131915 | 3300009147 | Bacteria | 3430 |
| 129 | Ga0105241_10040522 | 3300009174 | Bacteria | 3517 |
| 130 | Ga0105241_10142573 | 3300009174 | Bacteria | 1952 |
| 131 | Ga0105242_10274808 | 3300009176 | Bacteria | 1528 |
| 132 | Ga0105242_10325543 | 3300009176 | Bacteria | 1411 |
| 133 | Ga0105248_10163693 | 3300009177 | Bacteria | 2508 |
| 134 | Ga0105248_10169254 | 3300009177 | Bacteria | 2463 |
| 135 | Ga0105237_10027033 | 3300009545 | Bacteria | 5860 |
| 136 | Ga0105237_10235116 | 3300009545 | Bacteria | 1834 |
| 137 | Ga0105238_10256670 | 3300009551 | Bacteria | 1727 |
| 138 | Ga0105249_10108707 | 3300009553 | Bacteria | 2618 |
| 139 | Ga0105249_10458408 | 3300009553 | Bacteria | 1314 |
| 140 | Ga0099796_10010340 | 3300010159 | Bacteria | 2562 |
| 141 | Ga0099796_10022278 | 3300010159 | Bacteria | 1963 |
| 142 | Ga0105239_10078922 | 3300010375 | Bacteria | 3623 |
| 143 | Ga0105239_10115267 | 3300010375 | Bacteria | 2981 |
| 144 | Ga0105239_10186334 | 3300010375 | Bacteria | 2322 |
| 145 | Ga0105239_10223417 | 3300010375 | Bacteria | 2112 |
| 146 | Ga0105246_10072422 | 3300011119 | Bacteria | 2429 |
| 147 | Ga0105246_10097168 | 3300011119 | Bacteria | 2136 |
| 148 | Ga0157370_10031488 | 3300013104 | Bacteria | 5187 |
| 149 | Ga0157374_10295269 | 3300013296 | Bacteria | 1602 |
| 150 | Ga0157378_10139081 | 3300013297 | Bacteria | 2253 |
| 151 | Ga0163162_10087204 | 3300013306 | Bacteria | 3199 |
| 152 | Ga0157375_10314033 | 3300013308 | Bacteria | 1731 |
| 153 | Ga0163163_10024312 | 3300014325 | Bacteria | 5765 |
| 154 | Ga0163163_10067992 | 3300014325 | Bacteria | 3544 |
| 155 | Ga0163163_10275411 | 3300014325 | Bacteria | 1734 |
| 156 | Ga0157379_10062470 | 3300014968 | Bacteria | 3331 |
| 157 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 158 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 159 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 160 | Ga0214545_1031015 | 3300021324 | Bacteria | 2207 |
| 161 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 162 | Ga0213872_10043969 | 3300021361 | Bacteria | 2034 |
| 163 | Ga0209677_100902 | 3300025253 | Bacteria | 14537 |
| 164 | Ga0209148_1000784 | 3300025254 | Bacteria | 23607 |
| 165 | Ga0209233_1000543 | 3300025261 | Bacteria | 21222 |
| 166 | Ga0209233_1000561 | 3300025261 | Bacteria | 19886 |
| 167 | Ga0209233_1008323 | 3300025261 | Bacteria | 3219 |
| 168 | Ga0209455_1001661 | 3300025272 | Bacteria | 9638 |
| 169 | Ga0209675_1001296 | 3300025291 | Bacteria | 14851 |
| 170 | Ga0209564_1002283 | 3300025295 | Bacteria | 15636 |
| 171 | Ga0209564_1008629 | 3300025295 | Bacteria | 4995 |
| 172 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 173 | Ga0209758_1000306 | 3300025297 | Bacteria | 95362 |
| 174 | Ga0209758_1000701 | 3300025297 | Bacteria | 49677 |
| 175 | Ga0209758_1001694 | 3300025297 | Bacteria | 24817 |
| 176 | Ga0209758_1004530 | 3300025297 | Bacteria | 11502 |
| 177 | Ga0209256_1000272 | 3300025299 | Bacteria | 90458 |
| 178 | Ga0209256_1021845 | 3300025299 | Bacteria | 1952 |
| 179 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 180 | Ga0207426_1001117 | 3300025302 | Bacteria | 24608 |
| 181 | Ga0207426_1008688 | 3300025302 | Bacteria | 4075 |
| 182 | Ga0207426_1012705 | 3300025302 | Bacteria | 3153 |
| 183 | Ga0209257_1001260 | 3300025304 | Bacteria | 31244 |
| 184 | Ga0209257_1007750 | 3300025304 | Bacteria | 6387 |
| 185 | Ga0209257_1015800 | 3300025304 | Bacteria | 3106 |
| 186 | Ga0207692_10010351 | 3300025898 | Bacteria | 3927 |
| 187 | Ga0207688_10057283 | 3300025901 | Bacteria | 2190 |
| 188 | Ga0207647_10012036 | 3300025904 | Bacteria | 6038 |
| 189 | Ga0207685_10013754 | 3300025905 | Bacteria | 2513 |
| 190 | Ga0207699_10001724 | 3300025906 | Bacteria | 10355 |
| 191 | Ga0207699_10028905 | 3300025906 | Bacteria | 3086 |
| 192 | Ga0207699_10047208 | 3300025906 | Bacteria | 2524 |
| 193 | Ga0207643_10034912 | 3300025908 | Bacteria | 2818 |
| 194 | Ga0207654_10016718 | 3300025911 | Bacteria | 3823 |
| 195 | Ga0207654_10019788 | 3300025911 | Bacteria | 3559 |
| 196 | Ga0207654_10056358 | 3300025911 | Bacteria | 2279 |
| 197 | Ga0207695_10057666 | 3300025913 | Bacteria | 4034 |
| 198 | Ga0207695_10338728 | 3300025913 | Bacteria | 1392 |
| 199 | Ga0207671_10025812 | 3300025914 | Bacteria | 4409 |
| 200 | Ga0207671_10149214 | 3300025914 | Bacteria | 1806 |
| 201 | Ga0207671_10198784 | 3300025914 | Bacteria | 1565 |
| 202 | Ga0207671_10298843 | 3300025914 | Bacteria | 1272 |
| 203 | Ga0207693_10002818 | 3300025915 | Bacteria | 15062 |
| 204 | Ga0207663_10004235 | 3300025916 | Bacteria | 7116 |
| 205 | Ga0207663_10011381 | 3300025916 | Bacteria | 4776 |
| 206 | Ga0207660_10202889 | 3300025917 | Bacteria | 1549 |
| 207 | Ga0207662_10086259 | 3300025918 | Bacteria | 1924 |
| 208 | Ga0207657_10165202 | 3300025919 | Bacteria | 1796 |
| 209 | Ga0207657_10183138 | 3300025919 | Bacteria | 1692 |
| 210 | Ga0207649_10040585 | 3300025920 | Bacteria | 2829 |
| 211 | Ga0207652_10264786 | 3300025921 | Bacteria | 1550 |
| 212 | Ga0207694_10143116 | 3300025924 | Bacteria | 1923 |
| 213 | Ga0207694_10153665 | 3300025924 | Bacteria | 1855 |
| 214 | Ga0207694_10240496 | 3300025924 | Bacteria | 1479 |
| 215 | Ga0207694_10281173 | 3300025924 | Bacteria | 1367 |
| 216 | Ga0207687_10069486 | 3300025927 | Bacteria | 2512 |
| 217 | Ga0207700_10012595 | 3300025928 | Bacteria | 5463 |
| 218 | Ga0207700_10015399 | 3300025928 | Bacteria | 5044 |
| 219 | Ga0207664_10009218 | 3300025929 | Bacteria | 6915 |
| 220 | Ga0207664_10060839 | 3300025929 | Bacteria | 3011 |
| 221 | Ga0207664_10139733 | 3300025929 | Bacteria | 2047 |
| 222 | Ga0207644_10086400 | 3300025931 | Bacteria | 2329 |
| 223 | Ga0207690_10350574 | 3300025932 | Bacteria | 1167 |
| 224 | Ga0207706_10097345 | 3300025933 | Bacteria | 2588 |
| 225 | Ga0207706_10412083 | 3300025933 | Bacteria | 1171 |
| 226 | Ga0207709_10013681 | 3300025935 | Bacteria | 4476 |
| 227 | Ga0207670_10145871 | 3300025936 | Bacteria | 1750 |
| 228 | Ga0207669_10031041 | 3300025937 | Bacteria | 2979 |
| 229 | Ga0207665_10002759 | 3300025939 | Bacteria | 11767 |
| 230 | Ga0207665_10050012 | 3300025939 | Bacteria | 2810 |
| 231 | Ga0207665_10061168 | 3300025939 | Bacteria | 2552 |
| 232 | Ga0207691_10173501 | 3300025940 | Bacteria | 1887 |
| 233 | Ga0207711_10135997 | 3300025941 | Bacteria | 2207 |
| 234 | Ga0207689_10071727 | 3300025942 | Bacteria | 2845 |
| 235 | Ga0207689_10095790 | 3300025942 | Bacteria | 2438 |
| 236 | Ga0207689_10108961 | 3300025942 | Bacteria | 2276 |
| 237 | Ga0207667_10145163 | 3300025949 | Bacteria | 2443 |
| 238 | Ga0207712_10063310 | 3300025961 | Bacteria | 2633 |
| 239 | Ga0207668_10143502 | 3300025972 | Bacteria | 1839 |
| 240 | Ga0207658_10283210 | 3300025986 | Bacteria | 1422 |
| 241 | Ga0207703_10032866 | 3300026035 | Bacteria | 4109 |
| 242 | Ga0207678_10062792 | 3300026067 | Bacteria | 3192 |
| 243 | Ga0207678_10121620 | 3300026067 | Bacteria | 2228 |
| 244 | Ga0207678_10255573 | 3300026067 | Bacteria | 1501 |
| 245 | Ga0207678_10362892 | 3300026067 | Bacteria | 1250 |
| 246 | Ga0207708_10144105 | 3300026075 | Bacteria | 1871 |
| 247 | Ga0207641_10095333 | 3300026088 | Bacteria | 2612 |
| 248 | Ga0207648_10043034 | 3300026089 | Bacteria | 3966 |
| 249 | Ga0207648_10165856 | 3300026089 | Bacteria | 1952 |
| 250 | Ga0207648_10187430 | 3300026089 | Bacteria | 1833 |
| 251 | Ga0207676_10027587 | 3300026095 | Bacteria | 4231 |
| 252 | Ga0207674_10129947 | 3300026116 | Bacteria | 2483 |
| 253 | Ga0207675_100052832 | 3300026118 | Bacteria | 3791 |
| 254 | Ga0207675_100298097 | 3300026118 | Bacteria | 1570 |
| 255 | Ga0207683_10120195 | 3300026121 | Bacteria | 2358 |
| 256 | Ga0207683_10143826 | 3300026121 | Bacteria | 2150 |
| 257 | Ga0207683_10431938 | 3300026121 | Bacteria | 1213 |
| 258 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 259 | Ga0209389_1000052 | 3300027296 | Bacteria | 109624 |
| 260 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 261 | Ga0209589_1000058 | 3300027357 | Bacteria | 109624 |
| 262 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 263 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 264 | Ga0209489_100020 | 3300027361 | Bacteria | 207541 |
| 265 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 266 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 267 | Ga0209588_1000822 | 3300027671 | Bacteria | 7888 |
| 268 | Ga0209813_10024637 | 3300027866 | Bacteria | 1723 |
| 269 | Ga0209813_10033217 | 3300027866 | Bacteria | 1533 |
| 270 | Ga0268266_10000936 | 3300028379 | Bacteria | 37196 |
| 271 | Ga0268266_10001232 | 3300028379 | Bacteria | 31354 |
| 272 | Ga0268266_10011944 | 3300028379 | Bacteria | 7518 |
| 273 | Ga0268266_10037059 | 3300028379 | Bacteria | 4155 |
| 274 | Ga0268265_10415570 | 3300028380 | Bacteria | 1247 |
| 275 | Ga0268264_10000073 | 3300028381 | Bacteria | 260615 |
| 276 | Ga0265319_1002449 | 3300028563 | Bacteria | 10136 |
| 277 | Ga0265334_10004379 | 3300028573 | Bacteria | 6273 |
| 278 | Ga0265318_10001721 | 3300028577 | Bacteria | 12527 |
| 279 | Ga0265318_10014731 | 3300028577 | Bacteria | 3274 |
| 280 | Ga0265323_10000822 | 3300028653 | Bacteria | 16629 |
| 281 | Ga0265336_10002743 | 3300028666 | Bacteria | 7119 |
| 282 | Ga0307517_10000476 | 3300028786 | Bacteria | 68696 |
| 283 | Ga0307517_10140253 | 3300028786 | Bacteria | 1700 |
| 284 | Ga0307515_10121156 | 3300028794 | Bacteria | 2961 |
| 285 | Ga0265338_10000176 | 3300028800 | Bacteria | 118726 |
| 286 | Ga0265324_10002446 | 3300029957 | Bacteria | 9477 |
| 287 | Ga0265330_10017291 | 3300031235 | Bacteria | 3322 |
| 288 | Ga0265330_10055412 | 3300031235 | Bacteria | 1731 |
| 289 | Ga0265325_10043560 | 3300031241 | Bacteria | 2341 |
| 290 | Ga0265340_10035701 | 3300031247 | Bacteria | 2468 |
| 291 | Ga0265340_10046406 | 3300031247 | Bacteria | 2119 |
| 292 | Ga0265339_10022304 | 3300031249 | Bacteria | 3669 |
| 293 | Ga0265331_10030941 | 3300031250 | Bacteria | 2663 |
| 294 | Ga0307509_10067824 | 3300031507 | Bacteria | 3735 |
| 295 | Ga0307509_10106278 | 3300031507 | Bacteria | 2826 |
| 296 | Ga0307509_10140559 | 3300031507 | Bacteria | 2351 |
| 297 | Ga0265313_10026059 | 3300031595 | Bacteria | 3087 |
| 298 | Ga0307508_10000740 | 3300031616 | Bacteria | 38713 |
| 299 | Ga0307508_10176710 | 3300031616 | Bacteria | 1738 |
| 300 | Ga0307508_10247379 | 3300031616 | Bacteria | 1380 |
| 301 | Ga0265342_10003084 | 3300031712 | Bacteria | 13926 |
| 302 | Ga0265342_10032748 | 3300031712 | Bacteria | 3203 |
| 303 | Ga0265342_10047735 | 3300031712 | Bacteria | 2569 |
| 304 | Ga0316576_10003774 | 3300031727 | Bacteria | 8951 |
| 305 | Ga0307516_10017246 | 3300031730 | Bacteria | 7535 |
| 306 | Ga0307516_10063273 | 3300031730 | Bacteria | 3582 |
| 307 | Ga0307405_10183097 | 3300031731 | Bacteria | 1506 |
| 308 | Ga0307411_10041450 | 3300032005 | Bacteria | 2929 |
| 309 | Ga0307510_10026086 | 3300033180 | Bacteria | 6726 |
| 310 | Ga0307510_10046575 | 3300033180 | Bacteria | 4659 |
| 311 | Ga0307510_10055610 | 3300033180 | Bacteria | 4132 |
| 312 | Ga0373934_0009613 | 3300035086 | Bacteria | 3624 |
| 313 | Ga0373944_0002516 | 3300035089 | Bacteria | 4657 |
| 314 | Ga0373923_0001598 | 3300035111 | Bacteria | 6593 |
| 315 | Ga0373923_0007180 | 3300035111 | Bacteria | 3904 |
| 316 | Ga0373923_0029285 | 3300035111 | Bacteria | 2207 |
| 317 | Ga0373936_0015828 | 3300035113 | Bacteria | 2893 |
| 318 | Ga0373936_0036898 | 3300035113 | Bacteria | 1950 |
| 319 | Ga0373945_0007782 | 3300035116 | Bacteria | 3477 |
| 320 | Ga0373953_0000365 | 3300035117 | Bacteria | 12236 |
| 321 | Ga0373953_0054773 | 3300035117 | Bacteria | 1618 |
| 322 | Ga0373954_0000474 | 3300035118 | Bacteria | 15068 |
| 323 | Ga0373954_0024611 | 3300035118 | Bacteria | 2745 |
| 324 | Ga0373956_0017676 | 3300035119 | Bacteria | 3010 |
| 325 | Ga0373956_0023157 | 3300035119 | Bacteria | 2663 |
| 326 | Ga0373957_0000677 | 3300035120 | Bacteria | 8772 |
| 327 | Ga0373943_0001393 | 3300035170 | Bacteria | 10893 |
| 328 | Ga0373946_0047144 | 3300035171 | Bacteria | 1789 |
| 329 | Ga0373955_0000870 | 3300035172 | Bacteria | 12943 |
| 330 | Ga0373955_0007967 | 3300035172 | Bacteria | 4896 |
| 331 | Ga0373955_0084838 | 3300035172 | Bacteria | 1796 |
| 332 | Ga0373924_0005372 | 3300035410 | Bacteria | 4531 |
| 333 | Ga0373931_0005817 | 3300035691 | Bacteria | 5737 |
| 334 | Ga0373935_0004338 | 3300035692 | Bacteria | 8319 |
| 335 | Ga0373935_0046033 | 3300035692 | Bacteria | 2755 |
| 336 | Ga0373935_0122777 | 3300035692 | Bacteria | 1737 |
| 337 | Ga0373935_0170286 | 3300035692 | Bacteria | 1489 |
| 338 | Ga0373935_0301710 | 3300035692 | Bacteria | 1132 |
| 339 | Ga0373927_0006494 | 3300035695 | Bacteria | 7966 |
| 340 | Ga0373927_0020110 | 3300035695 | Bacteria | 4378 |
| 341 | Ga0373927_0021557 | 3300035695 | Bacteria | 4223 |
| 342 | Ga0373933_0000158 | 3300035724 | Bacteria | 44104 |
| 343 | Ga0373933_0001161 | 3300035724 | Bacteria | 15622 |
| 344 | Ga0373933_0030660 | 3300035724 | Bacteria | 3114 |
| 345 | Ga0373947_0005561 | 3300035725 | Bacteria | 7345 |
| 346 | Ga0373947_0005689 | 3300035725 | Bacteria | 7269 |
| 347 | Ga0373937_0008434 | 3300036401 | Bacteria | 8956 |
| 348 | Ga0373937_0111845 | 3300036401 | Bacteria | 2540 |
| 349 | Ga0316584_0002193 | 3300036712 | Bacteria | 12237 |
| 350 | Ga0373925_0002440 | 3300037068 | Bacteria | 14906 |
| 351 | Ga0373925_0009266 | 3300037068 | Bacteria | 7165 |
| 352 | Ga0373925_0009840 | 3300037068 | Bacteria | 6944 |
| 353 | Ga0373925_0094377 | 3300037068 | Bacteria | 2291 |
| 354 | Ga0373925_0245062 | 3300037068 | Bacteria | 1436 |
| 355 | Ga0395898_0254442 | 3300037466 | Bacteria | 1675 |
| 356 | Ga0395905_0004146 | 3300037471 | Bacteria | 15162 |
| 357 | Ga0436365_0747992 | 3300039437 | Bacteria | 1878 |
| 358 | Ga0436361_0960294 | 3300039447 | Bacteria | 4628 |
| 359 | Ga0436363_0039721 | 3300039450 | Bacteria | 1777 |
| 360 | Ga0436362_0159823 | 3300039453 | Bacteria | 3526 |
| 361 | Ga0451804_0429416 | 3300041463 | Bacteria | 1939 |
| 362 | Ga0451849_0305165 | 3300041505 | Bacteria | 2051 |
| 363 | Ga0450911_000210 | 3300042115 | Bacteria | 22859 |
| 364 | Ga0466972_0000295 | 3300044658 | Bacteria | 30276 |
| 365 | Ga0466972_0015953 | 3300044658 | Bacteria | 3756 |
| 366 | Ga0466966_0002033 | 3300044684 | Bacteria | 13135 |
| 367 | Ga0466961_0000087 | 3300044693 | Bacteria | 58547 |
| 368 | Ga0466968_0061456 | 3300044735 | Bacteria | 1621 |
| 369 | Ga0466957_0257535 | 3300044842 | Bacteria | 1162 |
| 370 | Ga0466959_0002003 | 3300045049 | Bacteria | 12853 |
| 371 | Ga0466967_0083170 | 3300045976 | Bacteria | 2894 |
| 372 | Ga0495592_0003034 | 3300046454 | Bacteria | 11957 |
| 373 | Ga0495592_0004669 | 3300046454 | Bacteria | 10039 |
| 374 | Ga0495592_0019284 | 3300046454 | Bacteria | 5188 |
| 375 | Ga0495592_0068558 | 3300046454 | Bacteria | 2589 |
| 376 | Ga0495603_0000029 | 3300046455 | Bacteria | 60872 |
| 377 | Ga0495603_0005242 | 3300046455 | Bacteria | 7732 |
| 378 | Ga0495603_0036039 | 3300046455 | Bacteria | 2970 |
| 379 | Ga0495603_0044791 | 3300046455 | Bacteria | 2640 |
| 380 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 381 | Ga0495629_0002638 | 3300046459 | Bacteria | 13739 |
| 382 | Ga0495629_0028887 | 3300046459 | Bacteria | 3937 |
| 383 | Ga0495629_0061905 | 3300046459 | Bacteria | 2615 |
| 384 | Ga0495638_0003622 | 3300046460 | Bacteria | 12071 |
| 385 | Ga0495638_0015943 | 3300046460 | Bacteria | 5036 |
| 386 | Ga0495638_0016057 | 3300046460 | Bacteria | 5018 |
| 387 | Ga0495638_0016277 | 3300046460 | Bacteria | 4982 |
| 388 | Ga0495641_0005506 | 3300046461 | Bacteria | 8521 |
| 389 | Ga0495651_0001923 | 3300046462 | Bacteria | 16068 |
| 390 | Ga0495651_0002607 | 3300046462 | Bacteria | 13945 |
| 391 | Ga0495651_0088625 | 3300046462 | Bacteria | 2325 |
| 392 | Ga0495651_0090735 | 3300046462 | Bacteria | 2292 |
| 393 | Ga0495653_0000341 | 3300046463 | Bacteria | 38030 |
| 394 | Ga0495580_0005561 | 3300046472 | Bacteria | 10391 |
| 395 | Ga0495580_0010591 | 3300046472 | Bacteria | 7176 |
| 396 | Ga0495582_0000068 | 3300046473 | Bacteria | 53389 |
| 397 | Ga0495582_0016420 | 3300046473 | Bacteria | 4057 |
| 398 | Ga0495605_0083470 | 3300046474 | Bacteria | 1491 |
| 399 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 400 | Ga0495639_0014829 | 3300046475 | Bacteria | 3377 |
| 401 | Ga0495662_0003219 | 3300046476 | Bacteria | 8248 |
| 402 | Ga0495664_0004785 | 3300046477 | Bacteria | 7406 |
| 403 | Ga0495664_0020110 | 3300046477 | Bacteria | 3846 |
| 404 | Ga0495664_0039694 | 3300046477 | Bacteria | 2782 |
| 405 | Ga0495664_0101448 | 3300046477 | Bacteria | 1734 |
| 406 | Ga0495594_0000750 | 3300046499 | Bacteria | 16637 |
| 407 | Ga0495596_0038323 | 3300046500 | Bacteria | 1895 |
| 408 | Ga0495583_0050734 | 3300046506 | Bacteria | 1895 |
| 409 | Ga0495606_0086474 | 3300046507 | Bacteria | 1937 |
| 410 | Ga0495608_0000606 | 3300046511 | Bacteria | 24639 |
| 411 | Ga0495608_0010182 | 3300046511 | Bacteria | 6561 |
| 412 | Ga0495608_0063403 | 3300046511 | Bacteria | 2425 |
| 413 | Ga0495608_0172658 | 3300046511 | Bacteria | 1370 |
| 414 | Ga0495610_0095184 | 3300046512 | Bacteria | 1343 |
| 415 | Ga0495618_0077613 | 3300046514 | Bacteria | 2116 |
| 416 | Ga0495618_0239314 | 3300046514 | Bacteria | 1141 |
| 417 | Ga0495628_0011645 | 3300046516 | Bacteria | 7430 |
| 418 | Ga0495628_0027421 | 3300046516 | Bacteria | 4635 |
| 419 | Ga0495630_0005874 | 3300046517 | Bacteria | 8682 |
| 420 | Ga0495631_0055651 | 3300046518 | Bacteria | 1724 |
| 421 | Ga0495631_0075568 | 3300046518 | Bacteria | 1454 |
| 422 | Ga0495643_0054915 | 3300046522 | Bacteria | 2130 |
| 423 | Ga0495644_0033143 | 3300046523 | Bacteria | 1952 |
| 424 | Ga0495648_0002484 | 3300046524 | Bacteria | 16925 |
| 425 | Ga0495648_0011475 | 3300046524 | Bacteria | 6668 |
| 426 | Ga0495648_0036375 | 3300046524 | Bacteria | 3178 |
| 427 | Ga0495648_0101093 | 3300046524 | Bacteria | 1591 |
| 428 | Ga0495666_0024498 | 3300046526 | Bacteria | 2981 |
| 429 | Ga0495652_0007527 | 3300046529 | Bacteria | 10035 |
| 430 | Ga0495652_0012146 | 3300046529 | Bacteria | 7779 |
| 431 | Ga0495652_0048701 | 3300046529 | Bacteria | 3629 |
| 432 | Ga0495652_0066072 | 3300046529 | Bacteria | 3037 |
| 433 | Ga0495652_0130916 | 3300046529 | Bacteria | 1986 |
| 434 | Ga0495652_0285224 | 3300046529 | Bacteria | 1207 |
| 435 | Ga0495654_0034752 | 3300046530 | Bacteria | 2542 |
| 436 | Ga0495665_0000237 | 3300046531 | Bacteria | 27649 |
| 437 | Ga0495665_0020476 | 3300046531 | Bacteria | 3553 |
| 438 | Ga0495640_0005842 | 3300046533 | Bacteria | 9774 |
| 439 | Ga0495640_0006116 | 3300046533 | Bacteria | 9540 |
| 440 | Ga0495640_0007919 | 3300046533 | Bacteria | 8356 |
| 441 | Ga0495587_0001595 | 3300046536 | Bacteria | 15102 |
| 442 | Ga0495587_0002682 | 3300046536 | Bacteria | 11890 |
| 443 | Ga0495645_0040515 | 3300046543 | Bacteria | 3398 |
| 444 | Ga0495645_0061502 | 3300046543 | Bacteria | 2720 |
| 445 | Ga0495622_0009979 | 3300046557 | Bacteria | 4392 |
| 446 | Ga0495622_0021661 | 3300046557 | Bacteria | 2992 |
| 447 | Ga0495667_0003214 | 3300046559 | Bacteria | 10955 |
| 448 | Ga0495667_0011892 | 3300046559 | Bacteria | 5896 |
| 449 | Ga0495667_0101621 | 3300046559 | Bacteria | 1860 |
| 450 | Ga0495656_0044715 | 3300046615 | Bacteria | 1866 |
| 451 | Ga0495668_0006062 | 3300046616 | Bacteria | 8006 |
| 452 | Ga0495668_0065969 | 3300046616 | Bacteria | 1992 |
| 453 | Ga0495634_0001307 | 3300046642 | Bacteria | 22759 |
| 454 | Ga0495634_0010145 | 3300046642 | Bacteria | 6911 |
| 455 | Ga0495634_0040885 | 3300046642 | Bacteria | 3150 |
| 456 | Ga0495634_0075256 | 3300046642 | Bacteria | 2218 |
| 457 | Ga0495625_0029057 | 3300046660 | Bacteria | 4139 |
| 458 | Ga0495625_0218206 | 3300046660 | Bacteria | 1251 |
| 459 | Ga0495635_0000092 | 3300046663 | Bacteria | 53315 |
| 460 | Ga0495635_0019780 | 3300046663 | Bacteria | 4690 |
| 461 | Ga0495635_0028796 | 3300046663 | Bacteria | 3860 |
| 462 | Ga0495635_0047078 | 3300046663 | Bacteria | 2975 |
| 463 | Ga0495661_0036570 | 3300046665 | Bacteria | 3073 |
| 464 | Ga0495588_0011966 | 3300046674 | Bacteria | 4087 |
| 465 | Ga0495657_0003498 | 3300046675 | Bacteria | 12806 |
| 466 | Ga0495657_0006462 | 3300046675 | Bacteria | 9169 |
| 467 | Ga0495657_0037121 | 3300046675 | Bacteria | 3361 |
| 468 | Ga0495657_0128859 | 3300046675 | Bacteria | 1587 |
| 469 | Ga0495599_0005823 | 3300046678 | Bacteria | 7403 |
| 470 | Ga0495599_0007153 | 3300046678 | Bacteria | 6757 |
| 471 | Ga0495623_0004160 | 3300046679 | Bacteria | 9532 |
| 472 | Ga0495623_0004635 | 3300046679 | Bacteria | 9030 |
| 473 | Ga0495646_0004002 | 3300046680 | Bacteria | 9229 |
| 474 | Ga0495646_0052734 | 3300046680 | Bacteria | 2455 |
| 475 | Ga0495646_0100800 | 3300046680 | Bacteria | 1656 |
| 476 | Ga0495647_0003788 | 3300046681 | Bacteria | 4865 |
| 477 | Ga0495647_0060863 | 3300046681 | Bacteria | 1489 |
| 478 | Ga0495658_0002427 | 3300046683 | Bacteria | 9388 |
| 479 | Ga0495613_0000582 | 3300046689 | Bacteria | 29501 |
| 480 | Ga0495613_0019334 | 3300046689 | Bacteria | 5078 |
| 481 | Ga0495613_0111035 | 3300046689 | Bacteria | 1975 |
| 482 | Ga0495613_0188238 | 3300046689 | Bacteria | 1460 |
| 483 | Ga0495624_0151330 | 3300046690 | Bacteria | 1419 |
| 484 | Ga0495670_0030891 | 3300046691 | Bacteria | 2661 |
| 485 | Ga0495649_0141527 | 3300046694 | Bacteria | 1266 |
| 486 | Ga0495649_0164447 | 3300046694 | Bacteria | 1163 |
| 487 | Ga0495600_0001905 | 3300046809 | Bacteria | 11719 |
| 488 | Ga0495600_0002533 | 3300046809 | Bacteria | 10514 |
| 489 | Ga0495600_0014076 | 3300046809 | Bacteria | 5039 |
| 490 | Ga0495600_0038562 | 3300046809 | Bacteria | 3109 |
| 491 | Ga0495600_0128684 | 3300046809 | Bacteria | 1646 |
| 492 | Ga0495581_0000048 | 3300047315 | Bacteria | 45311 |
| 493 | Ga0495581_0139709 | 3300047315 | Bacteria | 1413 |
| 494 | Ga0495581_0190222 | 3300047315 | Bacteria | 1200 |
| 495 | Ga0495581_0198818 | 3300047315 | Bacteria | 1172 |
| 496 | Ga0495604_0001244 | 3300047317 | Bacteria | 20881 |
| 497 | Ga0495604_0003533 | 3300047317 | Bacteria | 12462 |
| 498 | Ga0495604_0058268 | 3300047317 | Bacteria | 2966 |
| 499 | Ga0495604_0081406 | 3300047317 | Bacteria | 2424 |
| 500 | Ga0495674_0009200 | 3300047319 | Bacteria | 9387 |
| 501 | Ga0495674_0011197 | 3300047319 | Bacteria | 8470 |
| 502 | Ga0495674_0016889 | 3300047319 | Bacteria | 6806 |
| 503 | Ga0495674_0173317 | 3300047319 | Bacteria | 1799 |
| 504 | Ga0495672_0007852 | 3300047320 | Bacteria | 7968 |
| 505 | Ga0495672_0012029 | 3300047320 | Bacteria | 6060 |
| 506 | Ga0495676_0053573 | 3300047321 | Bacteria | 3214 |
| 507 | Ga0495680_0000546 | 3300047322 | Bacteria | 42342 |
| 508 | Ga0495680_0006001 | 3300047322 | Bacteria | 11360 |
| 509 | Ga0495687_043565 | 3300047443 | Bacteria | 1954 |
| 510 | Ga0495675_0001333 | 3300047444 | Bacteria | 14952 |
| 511 | Ga0495675_0009372 | 3300047444 | Bacteria | 6089 |
| 512 | Ga0495675_0112280 | 3300047444 | Bacteria | 1701 |
| 513 | Ga0495685_017516 | 3300047447 | Bacteria | 2454 |
| 514 | Ga0495673_0059165 | 3300047469 | Bacteria | 1648 |
| 515 | Ga0495673_0059235 | 3300047469 | Bacteria | 1647 |
| 516 | Ga0495684_0000032 | 3300047471 | Bacteria | 113195 |
| 517 | Ga0495684_0002955 | 3300047471 | Bacteria | 13381 |
| 518 | Ga0495684_0063799 | 3300047471 | Bacteria | 2800 |
| 519 | Ga0495686_0049142 | 3300047472 | Bacteria | 2655 |
| 520 | Ga0495686_0049237 | 3300047472 | Bacteria | 2652 |
| 521 | Ga0495593_0000556 | 3300047673 | Bacteria | 21184 |
| 522 | Ga0495593_0000660 | 3300047673 | Bacteria | 19875 |
| 523 | Ga0495602_0003334 | 3300048088 | Bacteria | 16577 |
| 524 | Ga0495602_0006506 | 3300048088 | Bacteria | 12257 |
| 525 | Ga0495602_0153553 | 3300048088 | Bacteria | 1806 |
| 526 | Ga0495602_0231460 | 3300048088 | Bacteria | 1388 |
| 527 | Ga0496101_0020506 | 3300048904 | Bacteria | 4527 |
| 528 | Ga0496101_0325999 | 3300048904 | Bacteria | 1205 |
| 529 | Ga0496102_0009365 | 3300048905 | Bacteria | 8413 |
| 530 | Ga0496102_0029530 | 3300048905 | Bacteria | 4906 |
| 531 | Ga0496102_0173731 | 3300048905 | Bacteria | 2028 |
| 532 | Ga0496103_0039337 | 3300048906 | Bacteria | 2906 |
| 533 | Ga0496103_0082413 | 3300048906 | Bacteria | 2024 |
| 534 | Ga0496103_0085757 | 3300048906 | Bacteria | 1984 |
| 535 | Ga0496104_0073659 | 3300048907 | Bacteria | 3249 |
| 536 | Ga0496104_0084884 | 3300048907 | Bacteria | 3022 |
| 537 | Ga0496105_0010801 | 3300048908 | Bacteria | 7191 |
| 538 | Ga0496105_0011478 | 3300048908 | Bacteria | 7000 |
| 539 | Ga0496105_0032337 | 3300048908 | Bacteria | 4292 |
| 540 | Ga0496106_0004140 | 3300048909 | Bacteria | 10810 |
| 541 | Ga0496106_0005511 | 3300048909 | Bacteria | 9361 |
| 542 | Ga0496106_0009870 | 3300048909 | Bacteria | 7047 |
| 543 | Ga0496106_0101452 | 3300048909 | Bacteria | 2232 |
| 544 | Ga0496106_0229856 | 3300048909 | Bacteria | 1481 |
| 545 | Ga0496106_0273268 | 3300048909 | Bacteria | 1353 |
| 546 | Ga0496107_0136247 | 3300048910 | Bacteria | 1814 |
| 547 | Ga0496107_0165980 | 3300048910 | Bacteria | 1637 |
| 548 | Ga0496108_0067452 | 3300048911 | Bacteria | 3018 |
| 549 | Ga0496108_0235856 | 3300048911 | Bacteria | 1591 |
| 550 | Ga0496109_0026957 | 3300048912 | Bacteria | 5126 |
| 551 | Ga0496110_0007995 | 3300048913 | Bacteria | 8475 |
| 552 | Ga0496110_0024944 | 3300048913 | Bacteria | 5103 |
| 553 | Ga0496110_0030548 | 3300048913 | Bacteria | 4645 |
| 554 | Ga0496110_0196880 | 3300048913 | Bacteria | 1830 |
| 555 | Ga0496110_0281533 | 3300048913 | Bacteria | 1514 |
| 556 | Ga0496111_0109768 | 3300048914 | Bacteria | 2031 |
| 557 | Ga0496112_0000169 | 3300048915 | Bacteria | 41507 |
| 558 | Ga0496112_0011528 | 3300048915 | Bacteria | 8077 |
| 559 | Ga0496112_0019225 | 3300048915 | Bacteria | 6443 |
| 560 | Ga0496112_0062276 | 3300048915 | Bacteria | 3679 |
| 561 | Ga0496112_0463508 | 3300048915 | Bacteria | 1204 |
| 562 | Ga0496113_0168171 | 3300048916 | Bacteria | 1736 |
| 563 | Ga0496114_0018487 | 3300048917 | Bacteria | 5636 |
| 564 | Ga0496115_0000889 | 3300048918 | Bacteria | 21680 |
| 565 | Ga0496115_0058415 | 3300048918 | Bacteria | 3104 |
| 566 | Ga0496115_0069856 | 3300048918 | Bacteria | 2846 |
| 567 | Ga0496115_0130878 | 3300048918 | Bacteria | 2068 |
| 568 | Ga0496115_0147538 | 3300048918 | Bacteria | 1942 |
| 569 | Ga0496116_0008611 | 3300048919 | Bacteria | 8827 |
| 570 | Ga0496116_0057216 | 3300048919 | Bacteria | 2551 |
| 571 | Ga0496116_0087090 | 3300048919 | Bacteria | 1913 |
| 572 | Ga0496117_0023533 | 3300048920 | Bacteria | 4903 |
| 573 | Ga0496117_0030017 | 3300048920 | Bacteria | 4179 |
| 574 | Ga0496117_0058124 | 3300048920 | Bacteria | 2680 |
| 575 | Ga0496117_0078000 | 3300048920 | Bacteria | 2189 |
| 576 | Ga0496117_0099551 | 3300048920 | Bacteria | 1844 |
| 577 | Ga0496118_0037060 | 3300048921 | Bacteria | 3931 |
| 578 | Ga0496118_0043939 | 3300048921 | Bacteria | 3505 |
| 579 | Ga0496118_0045932 | 3300048921 | Bacteria | 3402 |
| 580 | Ga0496118_0073192 | 3300048921 | Bacteria | 2456 |
| 581 | Ga0496118_0083401 | 3300048921 | Bacteria | 2235 |
| 582 | Ga0496119_0012324 | 3300048922 | Bacteria | 6958 |
| 583 | Ga0496119_0076976 | 3300048922 | Bacteria | 1934 |
| 584 | Ga0496120_0062215 | 3300048923 | Bacteria | 2080 |
| 585 | Ga0496121_0000155 | 3300048924 | Bacteria | 149388 |
| 586 | Ga0496121_0000218 | 3300048924 | Bacteria | 126175 |
| 587 | Ga0496121_0003892 | 3300048924 | Bacteria | 20737 |
| 588 | Ga0496121_0007080 | 3300048924 | Bacteria | 13616 |
| 589 | Ga0496121_0011030 | 3300048924 | Bacteria | 10085 |
| 590 | Ga0496121_0027285 | 3300048924 | Bacteria | 5346 |
| 591 | Ga0496121_0038776 | 3300048924 | Bacteria | 4211 |
| 592 | Ga0496121_0069992 | 3300048924 | Bacteria | 2828 |
| 593 | Ga0496122_0012396 | 3300048925 | Bacteria | 8497 |
| 594 | Ga0496122_0020536 | 3300048925 | Bacteria | 5960 |
| 595 | Ga0496122_0033693 | 3300048925 | Bacteria | 4207 |
| 596 | Ga0496123_0022201 | 3300048926 | Bacteria | 4899 |
| 597 | Ga0496123_0069865 | 3300048926 | Bacteria | 2202 |
| 598 | Ga0496123_0148245 | 3300048926 | Bacteria | 1270 |
| 599 | Ga0496124_0025392 | 3300048927 | Bacteria | 5366 |
| 600 | Ga0496124_0059392 | 3300048927 | Bacteria | 3213 |
| 601 | Ga0496124_0117718 | 3300048927 | Bacteria | 2128 |
| 602 | Ga0496124_0130505 | 3300048927 | Bacteria | 1997 |
| 603 | Ga0496125_0002212 | 3300048928 | Bacteria | 25927 |
| 604 | Ga0496125_0003115 | 3300048928 | Bacteria | 20622 |
| 605 | Ga0496125_0006315 | 3300048928 | Bacteria | 12865 |
| 606 | Ga0496125_0012310 | 3300048928 | Bacteria | 8499 |
| 607 | Ga0496125_0036214 | 3300048928 | Bacteria | 4313 |
| 608 | Ga0496125_0040815 | 3300048928 | Bacteria | 3975 |
| 609 | Ga0496125_0142561 | 3300048928 | Bacteria | 1663 |
| 610 | Ga0496125_0143744 | 3300048928 | Bacteria | 1653 |
| 611 | Ga0496126_0003000 | 3300048929 | Bacteria | 21903 |
| 612 | Ga0496126_0005013 | 3300048929 | Bacteria | 15421 |
| 613 | Ga0496126_0009925 | 3300048929 | Bacteria | 10053 |
| 614 | Ga0496126_0012765 | 3300048929 | Bacteria | 8586 |
| 615 | Ga0496126_0014895 | 3300048929 | Bacteria | 7842 |
| 616 | Ga0496126_0019762 | 3300048929 | Bacteria | 6627 |
| 617 | Ga0496126_0040827 | 3300048929 | Bacteria | 4299 |
| 618 | Ga0496126_0059401 | 3300048929 | Bacteria | 3443 |
| 619 | Ga0496126_0069880 | 3300048929 | Bacteria | 3130 |
| 620 | Ga0496126_0088546 | 3300048929 | Bacteria | 2726 |
| 621 | Ga0496126_0091578 | 3300048929 | Bacteria | 2673 |
| 622 | Ga0496126_0130897 | 3300048929 | Bacteria | 2168 |
| 623 | Ga0496126_0131930 | 3300048929 | Bacteria | 2158 |
| 624 | Ga0496126_0143331 | 3300048929 | Bacteria | 2054 |
| 625 | Ga0496126_0196426 | 3300048929 | Bacteria | 1706 |
| 626 | Ga0496126_0218469 | 3300048929 | Bacteria | 1602 |
| 627 | Ga0496126_0333421 | 3300048929 | Bacteria | 1244 |
| 628 | Ga0501067_0091274 | 3300049583 | Bacteria | 1691 |
| 629 | Ga0501067_0249615 | 3300049583 | Bacteria | 988 |
| 630 | Ga0501080_0116162 | 3300049742 | Bacteria | 2481 |
| 631 | nmdc:mga03n38_351_c1 | 3300050490 | Bacteria | 11225 |
| 632 | nmdc:mga00v17_113578_c1 | 3300050491 | Bacteria | 1720 |
| 633 | nmdc:mga00v17_128029_c1 | 3300050491 | Bacteria | 1621 |
| 634 | nmdc:mga0yw44_10551_c1 | 3300050492 | Bacteria | 4726 |
| 635 | nmdc:mga0yw44_133679_c1 | 3300050492 | Bacteria | 1607 |
| 636 | nmdc:mga0yw44_21457_c1 | 3300050492 | Bacteria | 3602 |
| 637 | nmdc:mga0yw44_41406_c1 | 3300050492 | Bacteria | 2742 |
| 638 | nmdc:mga0yw44_48499_c1 | 3300050492 | Bacteria | 2561 |
| 639 | nmdc:mga0yw44_72656_c1 | 3300050492 | Bacteria | 2139 |
| 640 | nmdc:mga0k408_31663_c1 | 3300050493 | Bacteria | 3021 |
| 641 | nmdc:mga06z11_127502_c1 | 3300050494 | Bacteria | 1425 |
| 642 | nmdc:mga06z11_165679_c1 | 3300050494 | Bacteria | 1266 |
| 643 | nmdc:mga06z11_40480_c1 | 3300050494 | Bacteria | 2326 |
| 644 | nmdc:mga04h51_28926_c1 | 3300050495 | Bacteria | 1732 |
| 645 | nmdc:mga07m45_13635_c1 | 3300050496 | Bacteria | 4317 |
| 646 | nmdc:mga07m45_69152_c1 | 3300050496 | Bacteria | 2007 |
| 647 | nmdc:mga07m45_93184_c1 | 3300050496 | Bacteria | 1727 |
| 648 | nmdc:mga05p37_315897_c1 | 3300050507 | Bacteria | 1850 |
| 649 | nmdc:mga08y16_484243_c1 | 3300050511 | Bacteria | 1258 |
| 650 | nmdc:mga08y16_66493_c1 | 3300050511 | Bacteria | 3762 |
| 651 | nmdc:mga0n895_127425_c1 | 3300050512 | Bacteria | 2569 |
| 652 | nmdc:mga0sz30_24364_c1 | 3300050516 | Bacteria | 2469 |
| 653 | Ga0495601_0001683 | 3300053077 | Bacteria | 12202 |
| 654 | Ga0495601_0142735 | 3300053077 | Bacteria | 1562 |
| 655 | Ga0495595_0003264 | 3300053084 | Bacteria | 6440 |
| 656 | Ga0495619_0000267 | 3300053085 | Bacteria | 38050 |
| 657 | Ga0495619_0065596 | 3300053085 | Bacteria | 2422 |
| 658 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 659 | Ga0500644_0000703 | 3300053088 | Bacteria | 11861 |
| 660 | Ga0500644_0019536 | 3300053088 | Bacteria | 2001 |
| 661 | Ga0500646_0027563 | 3300053090 | Bacteria | 1547 |
| 662 | Ga0500651_0005923 | 3300053093 | Bacteria | 7012 |
| 663 | Ga0500651_0057151 | 3300053093 | Bacteria | 2442 |
| 664 | Ga0500566_0000110 | 3300053094 | Bacteria | 41727 |
| 665 | Ga0500566_0007240 | 3300053094 | Bacteria | 6575 |
| 666 | Ga0500566_0018033 | 3300053094 | Bacteria | 4146 |
| 667 | Ga0500566_0127246 | 3300053094 | Bacteria | 1367 |
| 668 | Ga0500640_011481 | 3300053095 | Bacteria | 3611 |
| 669 | Ga0500641_0005426 | 3300053096 | Bacteria | 4520 |
| 670 | Ga0500641_0077440 | 3300053096 | Bacteria | 1407 |
| 671 | Ga0500650_0026722 | 3300053098 | Bacteria | 2591 |
| 672 | Ga0500650_0087658 | 3300053098 | Bacteria | 1457 |
| 673 | Ga0500554_010006 | 3300053102 | Bacteria | 2292 |
| 674 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 675 | Ga0500556_0003783 | 3300053104 | Bacteria | 4391 |
| 676 | Ga0500557_000124 | 3300053105 | Bacteria | 20414 |
| 677 | Ga0500569_000744 | 3300053109 | Bacteria | 5692 |
| 678 | Ga0500572_002210 | 3300053111 | Bacteria | 4761 |
| 679 | Ga0500572_002958 | 3300053111 | Bacteria | 3981 |
| 680 | Ga0500593_078733 | 3300053117 | Bacteria | 1417 |
| 681 | Ga0500594_0005603 | 3300053118 | Bacteria | 2788 |
| 682 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 683 | Ga0500595_002302 | 3300053119 | Bacteria | 9568 |
| 684 | Ga0500595_005550 | 3300053119 | Bacteria | 5496 |
| 685 | Ga0500595_011786 | 3300053119 | Bacteria | 3405 |
| 686 | Ga0500595_011873 | 3300053119 | Bacteria | 3390 |
| 687 | Ga0500595_013114 | 3300053119 | Bacteria | 3181 |
| 688 | Ga0500608_024592 | 3300053122 | Bacteria | 2813 |
| 689 | Ga0500608_031117 | 3300053122 | Bacteria | 2531 |
| 690 | Ga0500614_000900 | 3300053123 | Bacteria | 7487 |
| 691 | Ga0500642_0000100 | 3300053130 | Bacteria | 41454 |
| 692 | Ga0500642_0000104 | 3300053130 | Bacteria | 40747 |
| 693 | Ga0500652_008493 | 3300053131 | Bacteria | 3425 |
| 694 | Ga0500658_0015470 | 3300053134 | Bacteria | 2833 |
| 695 | Ga0500559_0000117 | 3300053136 | Bacteria | 62940 |
| 696 | Ga0500559_0005440 | 3300053136 | Bacteria | 5856 |
| 697 | Ga0500559_0010513 | 3300053136 | Bacteria | 3971 |
| 698 | Ga0500559_0085304 | 3300053136 | Bacteria | 1440 |
| 699 | Ga0500568_0007163 | 3300053139 | Bacteria | 5503 |
| 700 | Ga0500568_0007686 | 3300053139 | Bacteria | 5263 |
| 701 | Ga0500568_0038564 | 3300053139 | Bacteria | 1933 |
| 702 | Ga0500586_000338 | 3300053145 | Bacteria | 9253 |
| 703 | Ga0500590_089316 | 3300053148 | Bacteria | 1499 |
| 704 | Ga0500603_000515 | 3300053150 | Bacteria | 9823 |
| 705 | Ga0500603_001374 | 3300053150 | Bacteria | 5553 |
| 706 | Ga0500604_0000898 | 3300053151 | Bacteria | 8222 |
| 707 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 708 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 709 | Ga0500622_0001002 | 3300053156 | Bacteria | 23819 |
| 710 | Ga0500622_0017813 | 3300053156 | Bacteria | 3778 |
| 711 | Ga0500630_004083 | 3300053159 | Bacteria | 7099 |
| 712 | Ga0500633_0024503 | 3300053160 | Bacteria | 1876 |
| 713 | Ga0500638_047139 | 3300053162 | Bacteria | 2087 |
| 714 | Ga0500638_056257 | 3300053162 | Bacteria | 1895 |
| 715 | Ga0500638_076593 | 3300053162 | Bacteria | 1593 |
| 716 | Ga0500639_000598 | 3300053163 | Bacteria | 18139 |
| 717 | Ga0500639_031207 | 3300053163 | Bacteria | 2817 |
| 718 | Ga0500636_0000016 | 3300053177 | Bacteria | 123469 |
| 719 | Ga0500636_0078196 | 3300053177 | Bacteria | 1909 |
| 720 | Ga0500636_0110815 | 3300053177 | Bacteria | 1551 |
| 721 | Ga0500637_0000347 | 3300053178 | Bacteria | 17551 |
| 722 | Ga0500637_0003619 | 3300053178 | Bacteria | 7180 |
| 723 | Ga0500625_045065 | 3300053729 | Bacteria | 2059 |
| 724 | Ga0500645_000087 | 3300053730 | Bacteria | 74431 |
| 725 | Ga0500645_002736 | 3300053730 | Bacteria | 7648 |
| 726 | Ga0500552_004018 | 3300053733 | Bacteria | 1527 |
| 727 | Ga0500596_007853 | 3300053735 | Bacteria | 1726 |
| 728 | Ga0500599_002849 | 3300053736 | Bacteria | 2094 |
| 729 | Ga0500601_000591 | 3300053737 | Bacteria | 5186 |
| 730 | Ga0500661_000111 | 3300055283 | Bacteria | 13269 |
| 731 | Ga0500661_005787 | 3300055283 | Bacteria | 2304 |
| 732 | 2507505825 | 2507262055 | Bacteria | 8048963 |
| 733 | 2508540018 | 2508501009 | Bacteria | 7784016 |
| 734 | 2508696093 | 2508501042 | Bacteria | 8719808 |
| 735 | 2509153663 | 2508501128 | Bacteria | 8613869 |
| 736 | 2511394514 | 2511231028 | Bacteria | 8046582 |
| 737 | 2513626485 | 2513237092 | Bacteria | 8341956 |
| 738 | 2513638874 | 2513237094 | Bacteria | 8789602 |
| 739 | 2513649791 | 2513237095 | Bacteria | 8976980 |
| 740 | 2513678178 | 2513237098 | Bacteria | 9902361 |
| 741 | 2513694769 | 2513237101 | Bacteria | 7952346 |
| 742 | 2513702980 | 2513237102 | Bacteria | 7703324 |
| 743 | 2513715466 | 2513237104 | Bacteria | 10034502 |
| 744 | 2513875457 | 2513237139 | Bacteria | 8737671 |
| 745 | 2513891706 | 2513237141 | Bacteria | 8496279 |
| 746 | 2513913357 | 2513237144 | Bacteria | 7530820 |
| 747 | 2514011167 | 2513237161 | Bacteria | 8871253 |
| 748 | 2515630825 | 2515154112 | Bacteria | 8294334 |
| 749 | 2517105765 | 2517093001 | Bacteria | 9002274 |
| 750 | 2524435495 | 2524023205 | Bacteria | 8918781 |
| 751 | 2524466256 | 2524023210 | Bacteria | 9029266 |
| 752 | 2528851060 | 2528768022 | Bacteria | 10457665 |
| 753 | 2545676751 | 2545555834 | Bacteria | 8130841 |
| 754 | 2548500555 | 2547132374 | Bacteria | 5530232 |
| 755 | 2585899901 | 2585427608 | Bacteria | 6544331 |
| 756 | 2603860414 | 2602042107 | Bacteria | 6226103 |
| 757 | 2617347707 | 2617270735 | Bacteria | 9163226 |
| 758 | 2617374436 | 2617270741 | Bacteria | 8201522 |
| 759 | 2644646897 | 2643221717 | Bacteria | 5676132 |
| 760 | 2723842198 | 2721755755 | Bacteria | 8322773 |
| 761 | 2745081339 | 2744054633 | Bacteria | 8678936 |
| 762 | 2793063687 | 2791355196 | Bacteria | 7323613 |
| 763 | 2793078041 | |||
| 764 | 2805921187 | 2802429603 | Bacteria | 8777136 |
| 765 | 2818240791 | 2816332527 | Bacteria | 8933356 |
| 766 | 2824603511 | 2824600985 | Bacteria | 8488197 |
| 767 | 2824610902 | 2824609381 | Bacteria | 8672835 |
| 768 | 2824619426 | 2824617872 | Bacteria | 8814715 |
| 769 | 2824627881 | 2824626560 | Bacteria | 8813858 |
| 770 | 2824636075 | 2824635225 | Bacteria | 8785348 |
| 771 | 2824647041 | 2824644064 | Bacteria | 8743947 |
| 772 | 2824653955 | 2824653114 | Bacteria | 8493680 |
| 773 | 2824666429 | 2824661429 | Bacteria | 9877870 |
| 774 | 2824677321 | 2824671348 | Bacteria | 8369588 |
| 775 | 2824680295 | 2824679649 | Bacteria | 8248951 |
| 776 | 2824693998 | 2824687955 | Bacteria | 8360029 |
| 777 | 2824702825 | 2824696289 | Bacteria | 8335049 |
| 778 | 2824710675 | 2824704595 | Bacteria | 9667483 |
| 779 | 2824717305 | 2824714736 | Bacteria | 8717648 |
| 780 | 2824726505 | 2824723954 | Bacteria | 8758240 |
| 781 | 2824734952 | 2824732956 | Bacteria | 7810675 |
| 782 | 2824748099 | 2824746037 | Bacteria | 7911610 |
| 783 | 2824754954 | 2824753945 | Bacteria | 9787441 |
| 784 | 2824765192 | 2824763712 | Bacteria | 9792355 |
| 785 | 2824775819 | 2824773399 | Bacteria | 8360218 |
| 786 | 2834644462 | 2834641062 | Bacteria | 5559922 |
| 787 | 2838125190 | 2838122688 | Bacteria | 8803140 |
| 788 | 2841945931 | 2841941048 | Bacteria | 8688029 |
| 789 | 2841956745 | 2841949485 | Bacteria | 8680857 |
| 790 | 2841963340 | 2841957949 | Bacteria | 8652217 |
| 791 | 2841973260 | 2841966195 | Bacteria | 8673214 |
| 792 | 2841979578 | 2841974524 | Bacteria | 8931498 |
| 793 | 2841989300 | 2841983080 | Bacteria | 8395090 |
| 794 | 2842044292 | 2842038055 | Bacteria | 8002051 |
| 795 | 2842051719 | 2842045827 | Bacteria | 8006841 |
| 796 | 2842333513 | 2842333319 | Bacteria | 8899485 |
| 797 | 2842720739 | 2842718218 | Bacteria | 4560148 |
| 798 | 2844321578 | 2844315083 | Bacteria | 8138177 |
| 799 | 2847939550 | 2847930680 | Bacteria | 9342022 |
| 800 | 2847941356 | 2847939898 | Bacteria | 8606328 |
| 801 | 2849082280 | 2849076700 | Bacteria | 7039503 |
| 802 | 2857513248 | 2857509624 | Bacteria | 7472071 |
| 803 | 2857525361 | 2857524615 | Bacteria | 6615449 |
| 804 | 2874592092 | 2874590934 | Bacteria | 8299676 |
| 805 | 2874610216 | 2874604998 | Bacteria | 7834745 |
| 806 | 2874620152 | 2874612657 | Bacteria | 8252029 |
| 807 | 2874622363 | 2874620515 | Bacteria | 8290088 |
| 808 | 2874633008 | 2874628541 | Bacteria | 8630250 |
| 809 | 2874647229 | 2874645413 | Bacteria | 8214782 |
| 810 | 2876761750 | 2876761206 | Bacteria | 10111113 |
| 811 | 2876772304 | 2876771140 | Bacteria | 8287509 |
| 812 | 2876809240 | 2876808645 | Bacteria | 8824342 |
| 813 | 2876819528 | 2876818435 | Bacteria | 8274608 |
| 814 | 2879075980 | 2879074833 | Bacteria | 8279565 |
| 815 | 2879091454 | 2879083081 | Bacteria | 8587928 |
| 816 | 2879106509 | 2879099564 | Bacteria | 10442239 |
| 817 | 2879112486 | 2879110137 | Bacteria | 8907982 |
| 818 | 2879130383 | 2879127579 | Bacteria | 8294491 |
| 819 | 2879147243 | 2879142872 | Bacteria | 8267021 |
| 820 | 2881369694 | 2881364244 | Bacteria | 7710352 |
| 821 | 2881670247 | 2881665667 | Bacteria | 8175609 |
| 822 | 2885367652 | 2885366525 | Bacteria | 8326213 |
| 823 | 2885385348 | 2885383462 | Bacteria | 9473874 |
| 824 | 2885417552 | 2885409591 | Bacteria | 9235467 |
| 825 | 2888378721 | 2888378607 | Bacteria | 9652610 |
| 826 | 2888421012 | 2888419890 | Bacteria | 7857137 |
| 827 | 2889036299 | 2889033259 | Bacteria | 9099371 |
| 828 | 2893066309 | 2893066018 | Bacteria | 6158120 |
| 829 | 2903727848 | 2903727486 | Bacteria | 8281579 |
| 830 | 2903771242 | 2903768456 | Bacteria | 9749579 |
| 831 | 2904671630 | 2904666416 | Bacteria | 8226587 |
| 832 | 2904714380 | 2904711408 | Bacteria | 9771557 |
| 833 | 2906602668 | 2906602504 | Bacteria | 8295279 |
| 834 | 2906630976 | 2906626472 | Bacteria | 8826946 |
| 835 | 2906650603 | 2906643746 | Bacteria | 8722424 |
| 836 | 2908776917 | 2908775508 | Bacteria | 8092255 |
| 837 | 2919074948 | 2919073203 | Bacteria | 6531949 |
| 838 | 2922377595 | |||
| 839 | 2922389290 | 2922386360 | Bacteria | 7017218 |
| 840 | 2922393307 | 2922393267 | Bacteria | 8285685 |
| 841 | 2929622373 | 2929615660 | Bacteria | 9193770 |
| 842 | 2929629981 | 2929624759 | Bacteria | 9339455 |
| 843 | 2932788094 | 2932784394 | Bacteria | 9704911 |
| 844 | 2932794928 | 2932794094 | Bacteria | 7915132 |
| 845 | 2932805281 | 2932801729 | Bacteria | 7987968 |
| 846 | 2932813469 | 2932809354 | Bacteria | 9135765 |
| 847 | 2932820166 | 2932818245 | Bacteria | 9955613 |
| 848 | 2932832770 | 2932828146 | Bacteria | 9745859 |
| 849 | 2933584013 | 2933577622 | Bacteria | 9116884 |
| 850 | 2935613000 | 2935608549 | Bacteria | 8203142 |
| 851 | 2935620258 | 2935616580 | Bacteria | 9032984 |
| 852 | 2935640580 | 2935638405 | Bacteria | 10015038 |
| 853 | 2935649281 | 2935648319 | Bacteria | 8801166 |
| 854 | 2935657947 | 2935656913 | Bacteria | 8965014 |
| 855 | 2935668772 | 2935665750 | Bacteria | 9571747 |
| 856 | 2935681500 | 2935675223 | Bacteria | 9928132 |
| 857 | 2935687079 | 2935684952 | Bacteria | 9590419 |
| 858 | 2935696950 | 2935694250 | Bacteria | 9291695 |
| 859 | 2935709718 | 2935703347 | Bacteria | 10242284 |
| 860 | 2935716767 | 2935713505 | Bacteria | 9608509 |
| 861 | 2935723108 | 2935722832 | Bacteria | 9608746 |
| 862 | 2935734665 | 2935732158 | Bacteria | 9706831 |
| 863 | 2935744544 | 2935741537 | Bacteria | 9707219 |
| 864 | 2935753045 | 2935750917 | Bacteria | 9590372 |
| 865 | 2935766941 | 2935760218 | Bacteria | 9817913 |
| 866 | 2935775683 | 2935769743 | Bacteria | 7878163 |
| 867 | 2935777865 | 2935777560 | Bacteria | 8077691 |
| 868 | 2935791264 | 2935785616 | Bacteria | 7962367 |
| 869 | 2935799576 | 2935793552 | Bacteria | 8012592 |
| 870 | 2935804690 | 2935801545 | Bacteria | 9301974 |
| 871 | 2935815842 | 2935810662 | Bacteria | 9401221 |
| 872 | 2935825148 | 2935819856 | Bacteria | 8261050 |
| 873 | 2935832086 | 2935827899 | Bacteria | 10038562 |
| 874 | 2935841084 | 2935837841 | Bacteria | 9454360 |
| 875 | 2935852367 | 2935847175 | Bacteria | 8228321 |
| 876 | 2935859144 | 2935855204 | Bacteria | 9035059 |
| 877 | 2935864328 | 2935864058 | Bacteria | 9784707 |
| 878 | 2935875320 | 2935873716 | Bacteria | 9632195 |
| 879 | 2935887636 | 2935883170 | Bacteria | 7964738 |
| 880 | 2935910801 | 2935908558 | Bacteria | 8568796 |
| 881 | 2935921983 | 2935916978 | Bacteria | 9113783 |
| 882 | 2935929880 | 2935926038 | Bacteria | 8601059 |
| 883 | 2935937548 | 2935934488 | Bacteria | 8602579 |
| 884 | 2935948053 | 2935942939 | Bacteria | 8599779 |
| 885 | 2935956748 | 2935951376 | Bacteria | 8602333 |
| 886 | 2935963987 | 2935959822 | Bacteria | 7869783 |
| 887 | 2935970995 | 2935967501 | Bacteria | 8603075 |
| 888 | 2935978318 | 2935975950 | Bacteria | 8347125 |
| 889 | 2935985559 | 2935984226 | Bacteria | 8302647 |
| 890 | 2935995702 | 2935992306 | Bacteria | 9802711 |
| 891 | 2936008119 | 2936002035 | Bacteria | 9362176 |
| 892 | 2936012166 | 2936011229 | Bacteria | 8801034 |
| 893 | 2936020753 | 2936019824 | Bacteria | 8804134 |
| 894 | 2936029459 | 2936028420 | Bacteria | 8965941 |
| 895 | 2936048217 | 2936046547 | Bacteria | 8903709 |
| 896 | 2936056671 | 2936055302 | Bacteria | 8785755 |
| 897 | 2940558958 | 2940556831 | Bacteria | 9590747 |
| 898 | 2941541654 | 2941538514 | Bacteria | 9402094 |
| 899 | 2974321543 | 2974320154 | Bacteria | 4571377 |
| 900 | 3003670117 | 3003665799 | Bacteria | 7279786 |
| 901 | 3005485762 | 3005483717 | Bacteria | 7877331 |
| 902 | 3005510814 | 3005506211 | Bacteria | 6943378 |
| 903 | 3005588754 | 3005587118 | Bacteria | 7794411 |
| 904 | 3005601941 | 3005594810 | Bacteria | 8716512 |
| 905 | 3005717669 | 3005710791 | Bacteria | 7622528 |
| 906 | 641642918 | 641522639 | Bacteria | 7737025 |
| 907 | 643600951 | 643348564 | Bacteria | 8839022 |
| 908 | 8003404130 | 8003400568 | Bacteria | 5535898 |
| 909 | 8006966409 | 8006964411 | Bacteria | 8966052 |
| 910 | 8006992812 | 8006984368 | Bacteria | 9651211 |
| 911 | 8006997072 | 8006994254 | Bacteria | 8309700 |
| 912 | 8016517452 | 8016511872 | Bacteria | 9921665 |
| 913 | 8016526847 | 8016522445 | Bacteria | 8156687 |
| 914 | 8016531940 | 8016530956 | Bacteria | 8155261 |
| 915 | 8016545140 | 8016539877 | Bacteria | 8155419 |
| 916 | 8016556936 | 8016548790 | Bacteria | 8155074 |
| 917 | 8016565287 | 8016557553 | Bacteria | 8154380 |
| 918 | 8016570223 | 8016566248 | Bacteria | 8158151 |
| 919 | 8016582778 | 8016575299 | Bacteria | 8154085 |
| 920 | 8016585533 | 8016583857 | Bacteria | 10421953 |
| 921 | 8016602930 | 8016595262 | Bacteria | 8149947 |
| 922 | 8016605809 | 8016603502 | Bacteria | 8731218 |
| 923 | 8016617712 | 8016613128 | Bacteria | 8794220 |
| 924 | 8016634995 | 8016630954 | Bacteria | 9217207 |
| 925 | 8017059160 | 8017057580 | Bacteria | 10023680 |
| 926 | 8019531758 | 8019530166 | Bacteria | 8155624 |
| 927 | 8019539776 | 8019538911 | Bacteria | 7872763 |
| 928 | 8019550878 | 8019547302 | Bacteria | 7996444 |
| 929 | 8019576472 | 8019576017 | Bacteria | 10049540 |
| 930 | 8019611300 | 8019608314 | Bacteria | 10042931 |
| 931 | 8019631249 | 8019629233 | Bacteria | 8687553 |
| 932 | 8019639374 | 8019638758 | Bacteria | 9062356 |
| 933 | 8019651803 | 8019648815 | Bacteria | 10014479 |
| 934 | 8019668057 | 8019659431 | Bacteria | 8577854 |
| 935 | 8019695574 | 8019687851 | Bacteria | 8712826 |
| 936 | 8055227015 | 8055225921 | Bacteria | 3341787 |
| 937 | 8055743377 | 8055742211 | Bacteria | 9226248 |
| 938 | 8056678267 | 8056673599 | Bacteria | 7871253 |
| 939 | 8056683499 | 8056681323 | Bacteria | 8472857 |
| 940 | 8056690888 | 8056689827 | Bacteria | 6712655 |
| 941 | 8056975451 | 8056967851 | Bacteria | 9038162 |
| 942 | Ga0466963_0052810 | |||
| 943 | JGI24744J21845_10013094 | |||
| 944 | JGI24742J22300_10010775 | |||
| 945 | JGI25151J46595_10002288 | |||
| 946 | JGI25406J46586_10000089 | |||
| 947 | JGI25406J46586_10000885 | |||
| 948 | JGI25153J46596_10001792 | |||
| 949 | JGI25153J46596_10003025 | |||
| 950 | JGI25153J46596_10003136 | |||
| 951 | JGI25160J50197_1003913 | |||
| 952 | Ga0055524_1008182 | |||
| 953 | Ga0055534_1011189 | |||
| 954 | Ga0055531_10002428 | |||
| 955 | Ga0055543_1001518 | |||
| 956 | Ga0065165_1000415 | |||
| 957 | Ga0065165_1027223 | |||
| 958 | Ga0070658_10161160 | |||
| 959 | Ga0070683_100203991 | |||
| 960 | Ga0070670_100210685 | |||
| 961 | Ga0068869_100021516 | |||
| 962 | Ga0068869_100060160 | |||
| 963 | Ga0070666_10234444 | |||
| 964 | Ga0070680_100042682 | |||
| 965 | Ga0068868_100042187 | |||
| 966 | Ga0070661_100041101 | |||
| 967 | Ga0070668_100052513 | |||
| 968 | Ga0070668_100177828 | |||
| 969 | Ga0070669_100317280 | |||
| 970 | Ga0070671_100062733 | |||
| 971 | Ga0070659_100321938 | |||
| 972 | Ga0070667_100222752 | |||
| 973 | Ga0070709_10012512 | |||
| 974 | Ga0070709_10031036 | |||
| 975 | Ga0070709_10031633 | |||
| 976 | Ga0070714_100037004 | |||
| 977 | Ga0070714_100207818 | |||
| 978 | Ga0070713_100029100 | |||
| 979 | Ga0070710_10011173 | |||
| 980 | Ga0070711_100007005 | |||
| 981 | Ga0070711_100009020 | |||
| 982 | Ga0070700_100045927 | |||
| 983 | Ga0070708_100272628 | |||
| 984 | Ga0070663_100009181 | |||
| 985 | Ga0070663_100085005 | |||
| 986 | Ga0070662_100023244 | |||
| 987 | Ga0070685_10261494 | |||
| 988 | Ga0070699_100144977 | |||
| 989 | Ga0070679_100003707 | |||
| 990 | Ga0070697_100131997 | |||
| 991 | Ga0070672_100214609 | |||
| 992 | Ga0070672_100288666 | |||
| 993 | Ga0070665_100006118 | |||
| 994 | Ga0070665_100034010 | |||
| 995 | Ga0070665_100067568 | |||
| 996 | Ga0070665_100130352 | |||
| 997 | Ga0070665_100277326 | |||
| 998 | Ga0068855_100005214 | |||
| 999 | Ga0068855_100292750 | |||
| 1000 | Ga0070664_100046714 | |||
| 1001 | Ga0068857_100066434 | |||
| 1002 | Ga0068852_100295347 | |||
| 1003 | Ga0068852_100335321 | |||
| 1004 | Ga0068859_100150655 | |||
| 1005 | Ga0068864_100016160 | |||
| 1006 | Ga0068864_100038317 | |||
| 1007 | Ga0068861_100035761 | |||
| 1008 | Ga0068863_100130928 | |||
| 1009 | Ga0068860_100003866 | |||
| 1010 | Ga0068862_100462748 | |||
| 1011 | Ga0081455_10002667 | |||
| 1012 | Ga0081455_10012598 | |||
| 1013 | Ga0081455_10034832 | |||
| 1014 | Ga0081538_10002323 | |||
| 1015 | Ga0081540_1001266 | |||
| 1016 | Ga0081540_1004882 | |||
| 1017 | Ga0081540_1010416 | |||
| 1018 | Ga0081540_1010842 | |||
| 1019 | Ga0081540_1012305 | |||
| 1020 | Ga0081540_1020381 | |||
| 1021 | Ga0081540_1021353 | |||
| 1022 | Ga0081540_1030298 | |||
| 1023 | Ga0081540_1032237 | |||
| 1024 | Ga0081540_1032288 | |||
| 1025 | Ga0081539_10000461 | |||
| 1026 | Ga0081539_10000729 | |||
| 1027 | Ga0081539_10031929 | |||
| 1028 | Ga0081539_10034529 | |||
| 1029 | Ga0081539_10066952 | |||
| 1030 | Ga0070717_10019858 | |||
| 1031 | Ga0070717_10032483 | |||
| 1032 | Ga0075365_10013935 | |||
| 1033 | Ga0075365_10022911 | |||
| 1034 | Ga0075365_10044304 | |||
| 1035 | Ga0075365_10064888 | |||
| 1036 | Ga0075365_10165135 | |||
| 1037 | Ga0075368_10046201 | |||
| 1038 | Ga0075363_100003826 | |||
| 1039 | Ga0075363_100012251 | |||
| 1040 | Ga0075363_100074714 | |||
| 1041 | Ga0075364_10058583 | |||
| 1042 | Ga0075364_10132637 | |||
| 1043 | Ga0075364_10225373 | |||
| 1044 | Ga0070716_100001412 | |||
| 1045 | Ga0070716_100107414 | |||
| 1046 | Ga0070712_100196056 | |||
| 1047 | Ga0075367_10042045 | |||
| 1048 | Ga0075367_10209436 | |||
| 1049 | Ga0075369_10040322 | |||
| 1050 | Ga0075369_10043865 | |||
| 1051 | Ga0075366_10136676 | |||
| 1052 | Ga0075366_10208068 | |||
| 1053 | Ga0097621_100078810 | |||
| 1054 | Ga0075370_10068260 | |||
| 1055 | Ga0075434_100131833 | |||
| 1056 | Ga0068865_100015327 | |||
| 1057 | Ga0097620_100150655 | |||
| 1058 | Ga0099824_1006403 | |||
| 1059 | Ga0099824_1018082 | |||
| 1060 | Ga0099822_1007370 | |||
| 1061 | Ga0099823_1037610 | |||
| 1062 | Ga0099794_10002308 | |||
| 1063 | Ga0099795_10003024 | |||
| 1064 | Ga0099795_10009882 | |||
| 1065 | Ga0105240_10023702 | |||
| 1066 | Ga0105240_10285015 | |||
| 1067 | Ga0105240_10332893 | |||
| 1068 | Ga0111539_10038338 | |||
| 1069 | Ga0114129_10131915 | |||
| 1070 | Ga0105241_10040522 | |||
| 1071 | Ga0105241_10142573 | |||
| 1072 | Ga0105242_10274808 | |||
| 1073 | Ga0105242_10325543 | |||
| 1074 | Ga0105248_10163693 | |||
| 1075 | Ga0105248_10169254 | |||
| 1076 | Ga0105237_10027033 | |||
| 1077 | Ga0105237_10235116 | |||
| 1078 | Ga0105238_10256670 | |||
| 1079 | Ga0105249_10108707 | |||
| 1080 | Ga0105249_10458408 | |||
| 1081 | Ga0099796_10010340 | |||
| 1082 | Ga0099796_10022278 | |||
| 1083 | Ga0105239_10078922 | |||
| 1084 | Ga0105239_10115267 | |||
| 1085 | Ga0105239_10186334 | |||
| 1086 | Ga0105239_10223417 | |||
| 1087 | Ga0105246_10072422 | |||
| 1088 | Ga0105246_10097168 | |||
| 1089 | Ga0157370_10031488 | |||
| 1090 | Ga0157374_10295269 | |||
| 1091 | Ga0157378_10139081 | |||
| 1092 | Ga0163162_10087204 | |||
| 1093 | Ga0157375_10314033 | |||
| 1094 | Ga0163163_10024312 | |||
| 1095 | Ga0163163_10067992 | |||
| 1096 | Ga0163163_10275411 | |||
| 1097 | Ga0157379_10062470 | |||
| 1098 | Ga0214544_1000003 | |||
| 1099 | Ga0214542_1000022 | |||
| 1100 | Ga0214545_1000010 | |||
| 1101 | Ga0214545_1031015 | |||
| 1102 | Ga0214543_1000035 | |||
| 1103 | Ga0213872_10043969 | |||
| 1104 | Ga0209677_100902 | |||
| 1105 | Ga0209148_1000784 | |||
| 1106 | Ga0209233_1000543 | |||
| 1107 | Ga0209233_1000561 | |||
| 1108 | Ga0209233_1008323 | |||
| 1109 | Ga0209455_1001661 | |||
| 1110 | Ga0209675_1001296 | |||
| 1111 | Ga0209564_1002283 | |||
| 1112 | Ga0209564_1008629 | |||
| 1113 | Ga0209758_1000015 | |||
| 1114 | Ga0209758_1000306 | |||
| 1115 | Ga0209758_1000701 | |||
| 1116 | Ga0209758_1001694 | |||
| 1117 | Ga0209758_1004530 | |||
| 1118 | Ga0209256_1000272 | |||
| 1119 | Ga0209256_1021845 | |||
| 1120 | Ga0207426_1000217 | |||
| 1121 | Ga0207426_1001117 | |||
| 1122 | Ga0207426_1008688 | |||
| 1123 | Ga0207426_1012705 | |||
| 1124 | Ga0209257_1001260 | |||
| 1125 | Ga0209257_1007750 | |||
| 1126 | Ga0209257_1015800 | |||
| 1127 | Ga0207692_10010351 | |||
| 1128 | Ga0207688_10057283 | |||
| 1129 | Ga0207647_10012036 | |||
| 1130 | Ga0207685_10013754 | |||
| 1131 | Ga0207699_10001724 | |||
| 1132 | Ga0207699_10028905 | |||
| 1133 | Ga0207699_10047208 | |||
| 1134 | Ga0207643_10034912 | |||
| 1135 | Ga0207654_10016718 | |||
| 1136 | Ga0207654_10019788 | |||
| 1137 | Ga0207654_10056358 | |||
| 1138 | Ga0207695_10057666 | |||
| 1139 | Ga0207695_10338728 | |||
| 1140 | Ga0207671_10025812 | |||
| 1141 | Ga0207671_10149214 | |||
| 1142 | Ga0207671_10198784 | |||
| 1143 | Ga0207671_10298843 | |||
| 1144 | Ga0207693_10002818 | |||
| 1145 | Ga0207663_10004235 | |||
| 1146 | Ga0207663_10011381 | |||
| 1147 | Ga0207660_10202889 | |||
| 1148 | Ga0207662_10086259 | |||
| 1149 | Ga0207657_10165202 | |||
| 1150 | Ga0207657_10183138 | |||
| 1151 | Ga0207649_10040585 | |||
| 1152 | Ga0207652_10264786 | |||
| 1153 | Ga0207694_10143116 | |||
| 1154 | Ga0207694_10153665 | |||
| 1155 | Ga0207694_10240496 | |||
| 1156 | Ga0207694_10281173 | |||
| 1157 | Ga0207687_10069486 | |||
| 1158 | Ga0207700_10012595 | |||
| 1159 | Ga0207700_10015399 | |||
| 1160 | Ga0207664_10009218 | |||
| 1161 | Ga0207664_10060839 | |||
| 1162 | Ga0207664_10139733 | |||
| 1163 | Ga0207644_10086400 | |||
| 1164 | Ga0207690_10350574 | |||
| 1165 | Ga0207706_10097345 | |||
| 1166 | Ga0207706_10412083 | |||
| 1167 | Ga0207709_10013681 | |||
| 1168 | Ga0207670_10145871 | |||
| 1169 | Ga0207669_10031041 | |||
| 1170 | Ga0207665_10002759 | |||
| 1171 | Ga0207665_10050012 | |||
| 1172 | Ga0207665_10061168 | |||
| 1173 | Ga0207691_10173501 | |||
| 1174 | Ga0207711_10135997 | |||
| 1175 | Ga0207689_10071727 | |||
| 1176 | Ga0207689_10095790 | |||
| 1177 | Ga0207689_10108961 | |||
| 1178 | Ga0207667_10145163 | |||
| 1179 | Ga0207712_10063310 | |||
| 1180 | Ga0207668_10143502 | |||
| 1181 | Ga0207658_10283210 | |||
| 1182 | Ga0207703_10032866 | |||
| 1183 | Ga0207678_10062792 | |||
| 1184 | Ga0207678_10121620 | |||
| 1185 | Ga0207678_10255573 | |||
| 1186 | Ga0207678_10362892 | |||
| 1187 | Ga0207708_10144105 | |||
| 1188 | Ga0207641_10095333 | |||
| 1189 | Ga0207648_10043034 | |||
| 1190 | Ga0207648_10165856 | |||
| 1191 | Ga0207648_10187430 | |||
| 1192 | Ga0207676_10027587 | |||
| 1193 | Ga0207674_10129947 | |||
| 1194 | Ga0207675_100052832 | |||
| 1195 | Ga0207675_100298097 | |||
| 1196 | Ga0207683_10120195 | |||
| 1197 | Ga0207683_10143826 | |||
| 1198 | Ga0207683_10431938 | |||
| 1199 | Ga0209389_1000012 | |||
| 1200 | Ga0209389_1000052 | |||
| 1201 | Ga0209589_1000015 | |||
| 1202 | Ga0209589_1000058 | |||
| 1203 | Ga0209489_100015 | |||
| 1204 | Ga0209489_100019 | |||
| 1205 | Ga0209489_100020 | |||
| 1206 | Ga0209700_100018 | |||
| 1207 | Ga0209700_100025 | |||
| 1208 | Ga0209588_1000822 | |||
| 1209 | Ga0209813_10024637 | |||
| 1210 | Ga0209813_10033217 | |||
| 1211 | Ga0268266_10000936 | |||
| 1212 | Ga0268266_10001232 | |||
| 1213 | Ga0268266_10011944 | |||
| 1214 | Ga0268266_10037059 | |||
| 1215 | Ga0268265_10415570 | |||
| 1216 | Ga0268264_10000073 | |||
| 1217 | Ga0265319_1002449 | |||
| 1218 | Ga0265334_10004379 | |||
| 1219 | Ga0265318_10001721 | |||
| 1220 | Ga0265318_10014731 | |||
| 1221 | Ga0265323_10000822 | |||
| 1222 | Ga0265336_10002743 | |||
| 1223 | Ga0307517_10000476 | |||
| 1224 | Ga0307517_10140253 | |||
| 1225 | Ga0307515_10121156 | |||
| 1226 | Ga0265338_10000176 | |||
| 1227 | Ga0265324_10002446 | |||
| 1228 | Ga0265330_10017291 | |||
| 1229 | Ga0265330_10055412 | |||
| 1230 | Ga0265325_10043560 | |||
| 1231 | Ga0265340_10035701 | |||
| 1232 | Ga0265340_10046406 | |||
| 1233 | Ga0265339_10022304 | |||
| 1234 | Ga0265331_10030941 | |||
| 1235 | Ga0307509_10067824 | |||
| 1236 | Ga0307509_10106278 | |||
| 1237 | Ga0307509_10140559 | |||
| 1238 | Ga0265313_10026059 | |||
| 1239 | Ga0307508_10000740 | |||
| 1240 | Ga0307508_10176710 | |||
| 1241 | Ga0307508_10247379 | |||
| 1242 | Ga0265342_10003084 | |||
| 1243 | Ga0265342_10032748 | |||
| 1244 | Ga0265342_10047735 | |||
| 1245 | Ga0316576_10003774 | |||
| 1246 | Ga0307516_10017246 | |||
| 1247 | Ga0307516_10063273 | |||
| 1248 | Ga0307405_10183097 | |||
| 1249 | Ga0307411_10041450 | |||
| 1250 | Ga0307510_10026086 | |||
| 1251 | Ga0307510_10046575 | |||
| 1252 | Ga0307510_10055610 | |||
| 1253 | Ga0373934_0009613 | |||
| 1254 | Ga0373944_0002516 | |||
| 1255 | Ga0373923_0001598 | |||
| 1256 | Ga0373923_0007180 | |||
| 1257 | Ga0373923_0029285 | |||
| 1258 | Ga0373936_0015828 | |||
| 1259 | Ga0373936_0036898 | |||
| 1260 | Ga0373945_0007782 | |||
| 1261 | Ga0373953_0000365 | |||
| 1262 | Ga0373953_0054773 | |||
| 1263 | Ga0373954_0000474 | |||
| 1264 | Ga0373954_0024611 | |||
| 1265 | Ga0373956_0017676 | |||
| 1266 | Ga0373956_0023157 | |||
| 1267 | Ga0373957_0000677 | |||
| 1268 | Ga0373943_0001393 | |||
| 1269 | Ga0373946_0047144 | |||
| 1270 | Ga0373955_0000870 | |||
| 1271 | Ga0373955_0007967 | |||
| 1272 | Ga0373955_0084838 | |||
| 1273 | Ga0373924_0005372 | |||
| 1274 | Ga0373931_0005817 | |||
| 1275 | Ga0373935_0004338 | |||
| 1276 | Ga0373935_0046033 | |||
| 1277 | Ga0373935_0122777 | |||
| 1278 | Ga0373935_0170286 | |||
| 1279 | Ga0373935_0301710 | |||
| 1280 | Ga0373927_0006494 | |||
| 1281 | Ga0373927_0020110 | |||
| 1282 | Ga0373927_0021557 | |||
| 1283 | Ga0373933_0000158 | |||
| 1284 | Ga0373933_0001161 | |||
| 1285 | Ga0373933_0030660 | |||
| 1286 | Ga0373947_0005561 | |||
| 1287 | Ga0373947_0005689 | |||
| 1288 | Ga0373937_0008434 | |||
| 1289 | Ga0373937_0111845 | |||
| 1290 | Ga0316584_0002193 | |||
| 1291 | Ga0373925_0002440 | |||
| 1292 | Ga0373925_0009266 | |||
| 1293 | Ga0373925_0009840 | |||
| 1294 | Ga0373925_0094377 | |||
| 1295 | Ga0373925_0245062 | |||
| 1296 | Ga0395898_0254442 | |||
| 1297 | Ga0395905_0004146 | |||
| 1298 | Ga0436365_0747992 | |||
| 1299 | Ga0436361_0960294 | |||
| 1300 | Ga0436363_0039721 | |||
| 1301 | Ga0436362_0159823 | |||
| 1302 | Ga0451804_0429416 | |||
| 1303 | Ga0451849_0305165 | |||
| 1304 | Ga0450911_000210 | |||
| 1305 | Ga0466972_0000295 | |||
| 1306 | Ga0466972_0015953 | |||
| 1307 | Ga0466966_0002033 | |||
| 1308 | Ga0466961_0000087 | |||
| 1309 | Ga0466968_0061456 | |||
| 1310 | Ga0466957_0257535 | |||
| 1311 | Ga0466959_0002003 | |||
| 1312 | Ga0466967_0083170 | |||
| 1313 | Ga0495592_0003034 | |||
| 1314 | Ga0495592_0004669 | |||
| 1315 | Ga0495592_0019284 | |||
| 1316 | Ga0495592_0068558 | |||
| 1317 | Ga0495603_0000029 | |||
| 1318 | Ga0495603_0005242 | |||
| 1319 | Ga0495603_0036039 | |||
| 1320 | Ga0495603_0044791 | |||
| 1321 | Ga0495629_0000029 | |||
| 1322 | Ga0495629_0002638 | |||
| 1323 | Ga0495629_0028887 | |||
| 1324 | Ga0495629_0061905 | |||
| 1325 | Ga0495638_0003622 | |||
| 1326 | Ga0495638_0015943 | |||
| 1327 | Ga0495638_0016057 | |||
| 1328 | Ga0495638_0016277 | |||
| 1329 | Ga0495641_0005506 | |||
| 1330 | Ga0495651_0001923 | |||
| 1331 | Ga0495651_0002607 | |||
| 1332 | Ga0495651_0088625 | |||
| 1333 | Ga0495651_0090735 | |||
| 1334 | Ga0495653_0000341 | |||
| 1335 | Ga0495580_0005561 | |||
| 1336 | Ga0495580_0010591 | |||
| 1337 | Ga0495582_0000068 | |||
| 1338 | Ga0495582_0016420 | |||
| 1339 | Ga0495605_0083470 | |||
| 1340 | Ga0495639_0000006 | |||
| 1341 | Ga0495639_0014829 | |||
| 1342 | Ga0495662_0003219 | |||
| 1343 | Ga0495664_0004785 | |||
| 1344 | Ga0495664_0020110 | |||
| 1345 | Ga0495664_0039694 | |||
| 1346 | Ga0495664_0101448 | |||
| 1347 | Ga0495594_0000750 | |||
| 1348 | Ga0495596_0038323 | |||
| 1349 | Ga0495583_0050734 | |||
| 1350 | Ga0495606_0086474 | |||
| 1351 | Ga0495608_0000606 | |||
| 1352 | Ga0495608_0010182 | |||
| 1353 | Ga0495608_0063403 | |||
| 1354 | Ga0495608_0172658 | |||
| 1355 | Ga0495610_0095184 | |||
| 1356 | Ga0495618_0077613 | |||
| 1357 | Ga0495618_0239314 | |||
| 1358 | Ga0495628_0011645 | |||
| 1359 | Ga0495628_0027421 | |||
| 1360 | Ga0495630_0005874 | |||
| 1361 | Ga0495631_0055651 | |||
| 1362 | Ga0495631_0075568 | |||
| 1363 | Ga0495643_0054915 | |||
| 1364 | Ga0495644_0033143 | |||
| 1365 | Ga0495648_0002484 | |||
| 1366 | Ga0495648_0011475 | |||
| 1367 | Ga0495648_0036375 | |||
| 1368 | Ga0495648_0101093 | |||
| 1369 | Ga0495666_0024498 | |||
| 1370 | Ga0495652_0007527 | |||
| 1371 | Ga0495652_0012146 | |||
| 1372 | Ga0495652_0048701 | |||
| 1373 | Ga0495652_0066072 | |||
| 1374 | Ga0495652_0130916 | |||
| 1375 | Ga0495652_0285224 | |||
| 1376 | Ga0495654_0034752 | |||
| 1377 | Ga0495665_0000237 | |||
| 1378 | Ga0495665_0020476 | |||
| 1379 | Ga0495640_0005842 | |||
| 1380 | Ga0495640_0006116 | |||
| 1381 | Ga0495640_0007919 | |||
| 1382 | Ga0495587_0001595 | |||
| 1383 | Ga0495587_0002682 | |||
| 1384 | Ga0495645_0040515 | |||
| 1385 | Ga0495645_0061502 | |||
| 1386 | Ga0495622_0009979 | |||
| 1387 | Ga0495622_0021661 | |||
| 1388 | Ga0495667_0003214 | |||
| 1389 | Ga0495667_0011892 | |||
| 1390 | Ga0495667_0101621 | |||
| 1391 | Ga0495656_0044715 | |||
| 1392 | Ga0495668_0006062 | |||
| 1393 | Ga0495668_0065969 | |||
| 1394 | Ga0495634_0001307 | |||
| 1395 | Ga0495634_0010145 | |||
| 1396 | Ga0495634_0040885 | |||
| 1397 | Ga0495634_0075256 | |||
| 1398 | Ga0495625_0029057 | |||
| 1399 | Ga0495625_0218206 | |||
| 1400 | Ga0495635_0000092 | |||
| 1401 | Ga0495635_0019780 | |||
| 1402 | Ga0495635_0028796 | |||
| 1403 | Ga0495635_0047078 | |||
| 1404 | Ga0495661_0036570 | |||
| 1405 | Ga0495588_0011966 | |||
| 1406 | Ga0495657_0003498 | |||
| 1407 | Ga0495657_0006462 | |||
| 1408 | Ga0495657_0037121 | |||
| 1409 | Ga0495657_0128859 | |||
| 1410 | Ga0495599_0005823 | |||
| 1411 | Ga0495599_0007153 | |||
| 1412 | Ga0495623_0004160 | |||
| 1413 | Ga0495623_0004635 | |||
| 1414 | Ga0495646_0004002 | |||
| 1415 | Ga0495646_0052734 | |||
| 1416 | Ga0495646_0100800 | |||
| 1417 | Ga0495647_0003788 | |||
| 1418 | Ga0495647_0060863 | |||
| 1419 | Ga0495658_0002427 | |||
| 1420 | Ga0495613_0000582 | |||
| 1421 | Ga0495613_0019334 | |||
| 1422 | Ga0495613_0111035 | |||
| 1423 | Ga0495613_0188238 | |||
| 1424 | Ga0495624_0151330 | |||
| 1425 | Ga0495670_0030891 | |||
| 1426 | Ga0495649_0141527 | |||
| 1427 | Ga0495649_0164447 | |||
| 1428 | Ga0495600_0001905 | |||
| 1429 | Ga0495600_0002533 | |||
| 1430 | Ga0495600_0014076 | |||
| 1431 | Ga0495600_0038562 | |||
| 1432 | Ga0495600_0128684 | |||
| 1433 | Ga0495581_0000048 | |||
| 1434 | Ga0495581_0139709 | |||
| 1435 | Ga0495581_0190222 | |||
| 1436 | Ga0495581_0198818 | |||
| 1437 | Ga0495604_0001244 | |||
| 1438 | Ga0495604_0003533 | |||
| 1439 | Ga0495604_0058268 | |||
| 1440 | Ga0495604_0081406 | |||
| 1441 | Ga0495674_0009200 | |||
| 1442 | Ga0495674_0011197 | |||
| 1443 | Ga0495674_0016889 | |||
| 1444 | Ga0495674_0173317 | |||
| 1445 | Ga0495672_0007852 | |||
| 1446 | Ga0495672_0012029 | |||
| 1447 | Ga0495676_0053573 | |||
| 1448 | Ga0495680_0000546 | |||
| 1449 | Ga0495680_0006001 | |||
| 1450 | Ga0495687_043565 | |||
| 1451 | Ga0495675_0001333 | |||
| 1452 | Ga0495675_0009372 | |||
| 1453 | Ga0495675_0112280 | |||
| 1454 | Ga0495685_017516 | |||
| 1455 | Ga0495673_0059165 | |||
| 1456 | Ga0495673_0059235 | |||
| 1457 | Ga0495684_0000032 | |||
| 1458 | Ga0495684_0002955 | |||
| 1459 | Ga0495684_0063799 | |||
| 1460 | Ga0495686_0049142 | |||
| 1461 | Ga0495686_0049237 | |||
| 1462 | Ga0495593_0000556 | |||
| 1463 | Ga0495593_0000660 | |||
| 1464 | Ga0495602_0003334 | |||
| 1465 | Ga0495602_0006506 | |||
| 1466 | Ga0495602_0153553 | |||
| 1467 | Ga0495602_0231460 | |||
| 1468 | Ga0496101_0020506 | |||
| 1469 | Ga0496101_0325999 | |||
| 1470 | Ga0496102_0009365 | |||
| 1471 | Ga0496102_0029530 | |||
| 1472 | Ga0496102_0173731 | |||
| 1473 | Ga0496103_0039337 | |||
| 1474 | Ga0496103_0082413 | |||
| 1475 | Ga0496103_0085757 | |||
| 1476 | Ga0496104_0073659 | |||
| 1477 | Ga0496104_0084884 | |||
| 1478 | Ga0496105_0010801 | |||
| 1479 | Ga0496105_0011478 | |||
| 1480 | Ga0496105_0032337 | |||
| 1481 | Ga0496106_0004140 | |||
| 1482 | Ga0496106_0005511 | |||
| 1483 | Ga0496106_0009870 | |||
| 1484 | Ga0496106_0101452 | |||
| 1485 | Ga0496106_0229856 | |||
| 1486 | Ga0496106_0273268 | |||
| 1487 | Ga0496107_0136247 | |||
| 1488 | Ga0496107_0165980 | |||
| 1489 | Ga0496108_0067452 | |||
| 1490 | Ga0496108_0235856 | |||
| 1491 | Ga0496109_0026957 | |||
| 1492 | Ga0496110_0007995 | |||
| 1493 | Ga0496110_0024944 | |||
| 1494 | Ga0496110_0030548 | |||
| 1495 | Ga0496110_0196880 | |||
| 1496 | Ga0496110_0281533 | |||
| 1497 | Ga0496111_0109768 | |||
| 1498 | Ga0496112_0000169 | |||
| 1499 | Ga0496112_0011528 | |||
| 1500 | Ga0496112_0019225 | |||
| 1501 | Ga0496112_0062276 | |||
| 1502 | Ga0496112_0463508 | |||
| 1503 | Ga0496113_0168171 | |||
| 1504 | Ga0496114_0018487 | |||
| 1505 | Ga0496115_0000889 | |||
| 1506 | Ga0496115_0058415 | |||
| 1507 | Ga0496115_0069856 | |||
| 1508 | Ga0496115_0130878 | |||
| 1509 | Ga0496115_0147538 | |||
| 1510 | Ga0496116_0008611 | |||
| 1511 | Ga0496116_0057216 | |||
| 1512 | Ga0496116_0087090 | |||
| 1513 | Ga0496117_0023533 | |||
| 1514 | Ga0496117_0030017 | |||
| 1515 | Ga0496117_0058124 | |||
| 1516 | Ga0496117_0078000 | |||
| 1517 | Ga0496117_0099551 | |||
| 1518 | Ga0496118_0037060 | |||
| 1519 | Ga0496118_0043939 | |||
| 1520 | Ga0496118_0045932 | |||
| 1521 | Ga0496118_0073192 | |||
| 1522 | Ga0496118_0083401 | |||
| 1523 | Ga0496119_0012324 | |||
| 1524 | Ga0496119_0076976 | |||
| 1525 | Ga0496120_0062215 | |||
| 1526 | Ga0496121_0000155 | |||
| 1527 | Ga0496121_0000218 | |||
| 1528 | Ga0496121_0003892 | |||
| 1529 | Ga0496121_0007080 | |||
| 1530 | Ga0496121_0011030 | |||
| 1531 | Ga0496121_0027285 | |||
| 1532 | Ga0496121_0038776 | |||
| 1533 | Ga0496121_0069992 | |||
| 1534 | Ga0496122_0012396 | |||
| 1535 | Ga0496122_0020536 | |||
| 1536 | Ga0496122_0033693 | |||
| 1537 | Ga0496123_0022201 | |||
| 1538 | Ga0496123_0069865 | |||
| 1539 | Ga0496123_0148245 | |||
| 1540 | Ga0496124_0025392 | |||
| 1541 | Ga0496124_0059392 | |||
| 1542 | Ga0496124_0117718 | |||
| 1543 | Ga0496124_0130505 | |||
| 1544 | Ga0496125_0002212 | |||
| 1545 | Ga0496125_0003115 | |||
| 1546 | Ga0496125_0006315 | |||
| 1547 | Ga0496125_0012310 | |||
| 1548 | Ga0496125_0036214 | |||
| 1549 | Ga0496125_0040815 | |||
| 1550 | Ga0496125_0142561 | |||
| 1551 | Ga0496125_0143744 | |||
| 1552 | Ga0496126_0003000 | |||
| 1553 | Ga0496126_0005013 | |||
| 1554 | Ga0496126_0009925 | |||
| 1555 | Ga0496126_0012765 | |||
| 1556 | Ga0496126_0014895 | |||
| 1557 | Ga0496126_0019762 | |||
| 1558 | Ga0496126_0040827 | |||
| 1559 | Ga0496126_0059401 | |||
| 1560 | Ga0496126_0069880 | |||
| 1561 | Ga0496126_0088546 | |||
| 1562 | Ga0496126_0091578 | |||
| 1563 | Ga0496126_0130897 | |||
| 1564 | Ga0496126_0131930 | |||
| 1565 | Ga0496126_0143331 | |||
| 1566 | Ga0496126_0196426 | |||
| 1567 | Ga0496126_0218469 | |||
| 1568 | Ga0496126_0333421 | |||
| 1569 | Ga0501067_0091274 | |||
| 1570 | Ga0501067_0249615 | |||
| 1571 | Ga0501080_0116162 | |||
| 1572 | nmdc:mga03n38_351_c1 | |||
| 1573 | nmdc:mga00v17_113578_c1 | |||
| 1574 | nmdc:mga00v17_128029_c1 | |||
| 1575 | nmdc:mga0yw44_10551_c1 | |||
| 1576 | nmdc:mga0yw44_133679_c1 | |||
| 1577 | nmdc:mga0yw44_21457_c1 | |||
| 1578 | nmdc:mga0yw44_41406_c1 | |||
| 1579 | nmdc:mga0yw44_48499_c1 | |||
| 1580 | nmdc:mga0yw44_72656_c1 | |||
| 1581 | nmdc:mga0k408_31663_c1 | |||
| 1582 | nmdc:mga06z11_127502_c1 | |||
| 1583 | nmdc:mga06z11_165679_c1 | |||
| 1584 | nmdc:mga06z11_40480_c1 | |||
| 1585 | nmdc:mga04h51_28926_c1 | |||
| 1586 | nmdc:mga07m45_13635_c1 | |||
| 1587 | nmdc:mga07m45_69152_c1 | |||
| 1588 | nmdc:mga07m45_93184_c1 | |||
| 1589 | nmdc:mga05p37_315897_c1 | |||
| 1590 | nmdc:mga08y16_484243_c1 | |||
| 1591 | nmdc:mga08y16_66493_c1 | |||
| 1592 | nmdc:mga0n895_127425_c1 | |||
| 1593 | nmdc:mga0sz30_24364_c1 | |||
| 1594 | Ga0495601_0001683 | |||
| 1595 | Ga0495601_0142735 | |||
| 1596 | Ga0495595_0003264 | |||
| 1597 | Ga0495619_0000267 | |||
| 1598 | Ga0495619_0065596 | |||
| 1599 | Ga0500643_000048 | |||
| 1600 | Ga0500644_0000703 | |||
| 1601 | Ga0500644_0019536 | |||
| 1602 | Ga0500646_0027563 | |||
| 1603 | Ga0500651_0005923 | |||
| 1604 | Ga0500651_0057151 | |||
| 1605 | Ga0500566_0000110 | |||
| 1606 | Ga0500566_0007240 | |||
| 1607 | Ga0500566_0018033 | |||
| 1608 | Ga0500566_0127246 | |||
| 1609 | Ga0500640_011481 | |||
| 1610 | Ga0500641_0005426 | |||
| 1611 | Ga0500641_0077440 | |||
| 1612 | Ga0500650_0026722 | |||
| 1613 | Ga0500650_0087658 | |||
| 1614 | Ga0500554_010006 | |||
| 1615 | Ga0500556_0000003 | |||
| 1616 | Ga0500556_0003783 | |||
| 1617 | Ga0500557_000124 | |||
| 1618 | Ga0500569_000744 | |||
| 1619 | Ga0500572_002210 | |||
| 1620 | Ga0500572_002958 | |||
| 1621 | Ga0500593_078733 | |||
| 1622 | Ga0500594_0005603 | |||
| 1623 | Ga0500595_000003 | |||
| 1624 | Ga0500595_002302 | |||
| 1625 | Ga0500595_005550 | |||
| 1626 | Ga0500595_011786 | |||
| 1627 | Ga0500595_011873 | |||
| 1628 | Ga0500595_013114 | |||
| 1629 | Ga0500608_024592 | |||
| 1630 | Ga0500608_031117 | |||
| 1631 | Ga0500614_000900 | |||
| 1632 | Ga0500642_0000100 | |||
| 1633 | Ga0500642_0000104 | |||
| 1634 | Ga0500652_008493 | |||
| 1635 | Ga0500658_0015470 | |||
| 1636 | Ga0500559_0000117 | |||
| 1637 | Ga0500559_0005440 | |||
| 1638 | Ga0500559_0010513 | |||
| 1639 | Ga0500559_0085304 | |||
| 1640 | Ga0500568_0007163 | |||
| 1641 | Ga0500568_0007686 | |||
| 1642 | Ga0500568_0038564 | |||
| 1643 | Ga0500586_000338 | |||
| 1644 | Ga0500590_089316 | |||
| 1645 | Ga0500603_000515 | |||
| 1646 | Ga0500603_001374 | |||
| 1647 | Ga0500604_0000898 | |||
| 1648 | Ga0500616_0000002 | |||
| 1649 | Ga0500616_0000033 | |||
| 1650 | Ga0500622_0001002 | |||
| 1651 | Ga0500622_0017813 | |||
| 1652 | Ga0500630_004083 | |||
| 1653 | Ga0500633_0024503 | |||
| 1654 | Ga0500638_047139 | |||
| 1655 | Ga0500638_056257 | |||
| 1656 | Ga0500638_076593 | |||
| 1657 | Ga0500639_000598 | |||
| 1658 | Ga0500639_031207 | |||
| 1659 | Ga0500636_0000016 | |||
| 1660 | Ga0500636_0078196 | |||
| 1661 | Ga0500636_0110815 | |||
| 1662 | Ga0500637_0000347 | |||
| 1663 | Ga0500637_0003619 | |||
| 1664 | Ga0500625_045065 | |||
| 1665 | Ga0500645_000087 | |||
| 1666 | Ga0500645_002736 | |||
| 1667 | Ga0500552_004018 | |||
| 1668 | Ga0500596_007853 | |||
| 1669 | Ga0500599_002849 | |||
| 1670 | Ga0500601_000591 | |||
| 1671 | Ga0500661_000111 | |||
| 1672 | Ga0500661_005787 | |||
| 1673 | 2507505825 | |||
| 1674 | 2508540018 | |||
| 1675 | 2508696093 | |||
| 1676 | 2509153663 | |||
| 1677 | 2511394514 | |||
| 1678 | 2513626485 | |||
| 1679 | 2513638874 | |||
| 1680 | 2513649791 | |||
| 1681 | 2513678178 | |||
| 1682 | 2513694769 | |||
| 1683 | 2513702980 | |||
| 1684 | 2513715466 | |||
| 1685 | 2513875457 | |||
| 1686 | 2513891706 | |||
| 1687 | 2513913357 | |||
| 1688 | 2514011167 | |||
| 1689 | 2515630825 | |||
| 1690 | 2517105765 | |||
| 1691 | 2524435495 | |||
| 1692 | 2524466256 | |||
| 1693 | 2528851060 | |||
| 1694 | 2545676751 | |||
| 1695 | 2548500555 | |||
| 1696 | 2585899901 | |||
| 1697 | 2603860414 | |||
| 1698 | 2617347707 | |||
| 1699 | 2617374436 | |||
| 1700 | 2644646897 | |||
| 1701 | 2723842198 | |||
| 1702 | 2745081339 | |||
| 1703 | 2793063687 | |||
| 1704 | 2793078041 | |||
| 1705 | 2805921187 | |||
| 1706 | 2818240791 | |||
| 1707 | 2824603511 | |||
| 1708 | 2824610902 | |||
| 1709 | 2824619426 | |||
| 1710 | 2824627881 | |||
| 1711 | 2824636075 | |||
| 1712 | 2824647041 | |||
| 1713 | 2824653955 | |||
| 1714 | 2824666429 | |||
| 1715 | 2824677321 | |||
| 1716 | 2824680295 | |||
| 1717 | 2824693998 | |||
| 1718 | 2824702825 | |||
| 1719 | 2824710675 | |||
| 1720 | 2824717305 | |||
| 1721 | 2824726505 | |||
| 1722 | 2824734952 | |||
| 1723 | 2824748099 | |||
| 1724 | 2824754954 | |||
| 1725 | 2824765192 | |||
| 1726 | 2824775819 | |||
| 1727 | 2834644462 | |||
| 1728 | 2838125190 | |||
| 1729 | 2841945931 | |||
| 1730 | 2841956745 | |||
| 1731 | 2841963340 | |||
| 1732 | 2841973260 | |||
| 1733 | 2841979578 | |||
| 1734 | 2841989300 | |||
| 1735 | 2842044292 | |||
| 1736 | 2842051719 | |||
| 1737 | 2842333513 | |||
| 1738 | 2842720739 | |||
| 1739 | 2844321578 | |||
| 1740 | 2847939550 | |||
| 1741 | 2847941356 | |||
| 1742 | 2849082280 | |||
| 1743 | 2857513248 | |||
| 1744 | 2857525361 | |||
| 1745 | 2874592092 | |||
| 1746 | 2874610216 | |||
| 1747 | 2874620152 | |||
| 1748 | 2874622363 | |||
| 1749 | 2874633008 | |||
| 1750 | 2874647229 | |||
| 1751 | 2876761750 | |||
| 1752 | 2876772304 | |||
| 1753 | 2876809240 | |||
| 1754 | 2876819528 | |||
| 1755 | 2879075980 | |||
| 1756 | 2879091454 | |||
| 1757 | 2879106509 | |||
| 1758 | 2879112486 | |||
| 1759 | 2879130383 | |||
| 1760 | 2879147243 | |||
| 1761 | 2881369694 | |||
| 1762 | 2881670247 | |||
| 1763 | 2885367652 | |||
| 1764 | 2885385348 | |||
| 1765 | 2885417552 | |||
| 1766 | 2888378721 | |||
| 1767 | 2888421012 | |||
| 1768 | 2889036299 | |||
| 1769 | 2893066309 | |||
| 1770 | 2903727848 | |||
| 1771 | 2903771242 | |||
| 1772 | 2904671630 | |||
| 1773 | 2904714380 | |||
| 1774 | 2906602668 | |||
| 1775 | 2906630976 | |||
| 1776 | 2906650603 | |||
| 1777 | 2908776917 | |||
| 1778 | 2919074948 | |||
| 1779 | 2922377595 | |||
| 1780 | 2922389290 | |||
| 1781 | 2922393307 | |||
| 1782 | 2929622373 | |||
| 1783 | 2929629981 | |||
| 1784 | 2932788094 | |||
| 1785 | 2932794928 | |||
| 1786 | 2932805281 | |||
| 1787 | 2932813469 | |||
| 1788 | 2932820166 | |||
| 1789 | 2932832770 | |||
| 1790 | 2933584013 | |||
| 1791 | 2935613000 | |||
| 1792 | 2935620258 | |||
| 1793 | 2935640580 | |||
| 1794 | 2935649281 | |||
| 1795 | 2935657947 | |||
| 1796 | 2935668772 | |||
| 1797 | 2935681500 | |||
| 1798 | 2935687079 | |||
| 1799 | 2935696950 | |||
| 1800 | 2935709718 | |||
| 1801 | 2935716767 | |||
| 1802 | 2935723108 | |||
| 1803 | 2935734665 | |||
| 1804 | 2935744544 | |||
| 1805 | 2935753045 | |||
| 1806 | 2935766941 | |||
| 1807 | 2935775683 | |||
| 1808 | 2935777865 | |||
| 1809 | 2935791264 | |||
| 1810 | 2935799576 | |||
| 1811 | 2935804690 | |||
| 1812 | 2935815842 | |||
| 1813 | 2935825148 | |||
| 1814 | 2935832086 | |||
| 1815 | 2935841084 | |||
| 1816 | 2935852367 | |||
| 1817 | 2935859144 | |||
| 1818 | 2935864328 | |||
| 1819 | 2935875320 | |||
| 1820 | 2935887636 | |||
| 1821 | 2935910801 | |||
| 1822 | 2935921983 | |||
| 1823 | 2935929880 | |||
| 1824 | 2935937548 | |||
| 1825 | 2935948053 | |||
| 1826 | 2935956748 | |||
| 1827 | 2935963987 | |||
| 1828 | 2935970995 | |||
| 1829 | 2935978318 | |||
| 1830 | 2935985559 | |||
| 1831 | 2935995702 | |||
| 1832 | 2936008119 | |||
| 1833 | 2936012166 | |||
| 1834 | 2936020753 | |||
| 1835 | 2936029459 | |||
| 1836 | 2936048217 | |||
| 1837 | 2936056671 | |||
| 1838 | 2940558958 | |||
| 1839 | 2941541654 | |||
| 1840 | 2974321543 | |||
| 1841 | 3003670117 | |||
| 1842 | 3005485762 | |||
| 1843 | 3005510814 | |||
| 1844 | 3005588754 | |||
| 1845 | 3005601941 | |||
| 1846 | 3005717669 | |||
| 1847 | 641642918 | |||
| 1848 | 643600951 | |||
| 1849 | 8003404130 | |||
| 1850 | 8006966409 | |||
| 1851 | 8006992812 | |||
| 1852 | 8006997072 | |||
| 1853 | 8016517452 | |||
| 1854 | 8016526847 | |||
| 1855 | 8016531940 | |||
| 1856 | 8016545140 | |||
| 1857 | 8016556936 | |||
| 1858 | 8016565287 | |||
| 1859 | 8016570223 | |||
| 1860 | 8016582778 | |||
| 1861 | 8016585533 | |||
| 1862 | 8016602930 | |||
| 1863 | 8016605809 | |||
| 1864 | 8016617712 | |||
| 1865 | 8016634995 | |||
| 1866 | 8017059160 | |||
| 1867 | 8019531758 | |||
| 1868 | 8019539776 | |||
| 1869 | 8019550878 | |||
| 1870 | 8019576472 | |||
| 1871 | 8019611300 | |||
| 1872 | 8019631249 | |||
| 1873 | 8019639374 | |||
| 1874 | 8019651803 | |||
| 1875 | 8019668057 | |||
| 1876 | 8019695574 | |||
| 1877 | 8055227015 | |||
| 1878 | 8055743377 | |||
| 1879 | 8056678267 | |||
| 1880 | 8056683499 | |||
| 1881 | 8056690888 | |||
| 1882 | 8056975451 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9417 | 22 | 264 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9347 | 24 | 279 |
| 3c41-assembly1.cif.gz_K | abc protein artp in complex with amp-pnp/mg2+ | 0.9267 | 22 | 273 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9262 | 25 | 272 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9261 | 23 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75796_311_605_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9566 | 22 | 283 | 3.40.50.300 |
| af_P0AAH8_2_263_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.948 | 22 | 273 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9457 | 25 | 271 | 3.40.50.300 |
| af_I6Y482_280_547_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9438 | 24 | 285 | 3.40.50.300 |
| af_O69724_1_242_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.943 | 25 | 272 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K3DSM3-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9666 | 66 | 281 |
GO:0005524
GO:0016887 GO:0055085 |
| AF-A0A212DUA4-F1-model_v4 | deleted | 0.9649 | 109 | 248 |
|
| AF-A0A5C6AC51-F1-model_v4 | Glutathione import ATP-binding protein GsiA (EC 3.6.3.-) | 0.9599 | 22 | 279 |
GO:0005524
GO:0015833 GO:0016887 GO:0055085 |
| AF-A0A841PNC6-F1-model_v4 | Nickel transport system ATP-binding protein | 0.9538 | 24 | 255 |
GO:0005524
GO:0016887 GO:0055085 |
| AF-Q3BNZ3-F1-model_v4 | Methionine import ATP-binding protein MetN (EC 7.4.2.11) | 0.9494 | 25 | 273 |
GO:0005524
GO:0005886 GO:0016887 GO:0033232 |