F486354

General Info

Members Datasets Scaffolds Average Seq Length
942 446 942 58

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100986570|Ga0068859_1009865702
Length 69
Sequence MINSTPPQAPTLGSDEERVDAIVRSGPSGAIAVAGIATAVVIALWFAFYLFVFLPRSVEHDDRGGSRHR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
250 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
251 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
254 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
255 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
256 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
260 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
261 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
269 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
302 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
361 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
411 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
414 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
415 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
416 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
417 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
418 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
419 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
420 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
421 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
422 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
423 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
424 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
429 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
430 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
431 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
434 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
435 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
436 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
437 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
438 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
439 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
440 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
441 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
442 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0
Rhizoplane 8.92
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1069384 3300001904 Bacteria 549
2 JGI24739J22299_10113909 3300001989 Bacteria 811
3 JGI24735J21928_10002229 3300002067 Bacteria 6796
4 JGI25153J46596_10004677 3300003215 Bacteria 7315
5 JGI25404J52841_10000254 3300003659 Bacteria 6695
6 Ga0065715_10748971 3300005293 Bacteria 595
7 Ga0070658_10002866 3300005327 Bacteria 14324
8 Ga0070658_10075593 3300005327 Bacteria 2763
9 Ga0070658_10116973 3300005327 Bacteria 2213
10 Ga0070658_10295883 3300005327 Bacteria 1380
11 Ga0070658_10944468 3300005327 Bacteria 750
12 Ga0070658_11518580 3300005327 Bacteria 581
13 Ga0070676_10492300 3300005328 Bacteria 869
14 Ga0070676_10536251 3300005328 Bacteria 836
15 Ga0070683_100086605 3300005329 Bacteria 2937
16 Ga0070683_101093560 3300005329 Bacteria 766
17 Ga0070690_100352478 3300005330 Bacteria 1068
18 Ga0070690_100704672 3300005330 Bacteria 776
19 Ga0070670_100109295 3300005331 Bacteria 2382
20 Ga0070670_100433001 3300005331 Bacteria 1164
21 Ga0070677_10647422 3300005333 Bacteria 590
22 Ga0068869_100017200 3300005334 Bacteria 4895
23 Ga0068869_100181849 3300005334 Bacteria 1648
24 Ga0068869_100830396 3300005334 Bacteria 796
25 Ga0070666_10359545 3300005335 Bacteria 1043
26 Ga0070666_10449063 3300005335 Bacteria 931
27 Ga0070666_10450053 3300005335 Bacteria 930
28 Ga0070680_100043042 3300005336 Bacteria 3667
29 Ga0070682_100042469 3300005337 Bacteria 2807
30 Ga0070682_100157416 3300005337 Bacteria 1565
31 Ga0070682_101350930 3300005337 Bacteria 607
32 Ga0068868_100006547 3300005338 Bacteria 8248
33 Ga0068868_100069042 3300005338 Bacteria 2815
34 Ga0068868_100203216 3300005338 Bacteria 1652
35 Ga0070660_100064724 3300005339 Bacteria 2845
36 Ga0070689_100230654 3300005340 Bacteria 1522
37 Ga0070689_100543029 3300005340 Bacteria 1001
38 Ga0070689_100574766 3300005340 Bacteria 973
39 Ga0070691_10111683 3300005341 Bacteria 1368
40 Ga0070661_100202483 3300005344 Bacteria 1517
41 Ga0070661_100558505 3300005344 Bacteria 922
42 Ga0070661_100985189 3300005344 Bacteria 699
43 Ga0070661_101196721 3300005344 Bacteria 635
44 Ga0070692_10372284 3300005345 Bacteria 894
45 Ga0070668_100045256 3300005347 Bacteria 3377
46 Ga0070668_100104644 3300005347 Bacteria 2246
47 Ga0070668_100182551 3300005347 Bacteria 1715
48 Ga0070668_100320697 3300005347 Bacteria 1304
49 Ga0070668_100409293 3300005347 Bacteria 1159
50 Ga0070668_100673548 3300005347 Bacteria 910
51 Ga0070668_100871306 3300005347 Bacteria 803
52 Ga0070669_100971608 3300005353 Bacteria 728
53 Ga0070669_102052703 3300005353 Bacteria 500
54 Ga0070675_102234345 3300005354 Bacteria 504
55 Ga0070671_100267604 3300005355 Bacteria 1453
56 Ga0070671_100880541 3300005355 Bacteria 782
57 Ga0070671_100907065 3300005355 Bacteria 770
58 Ga0070674_100021173 3300005356 Bacteria 4169
59 Ga0070674_100142087 3300005356 Bacteria 1802
60 Ga0070674_100406354 3300005356 Bacteria 1114
61 Ga0070674_101206939 3300005356 Bacteria 672
62 Ga0070673_100059256 3300005364 Bacteria 3030
63 Ga0070673_100150917 3300005364 Bacteria 1968
64 Ga0070673_101663386 3300005364 Bacteria 604
65 Ga0070688_100239557 3300005365 Bacteria 1287
66 Ga0070688_100332589 3300005365 Bacteria 1107
67 Ga0070688_101601867 3300005365 Bacteria 532
68 Ga0070659_100032739 3300005366 Bacteria 4034
69 Ga0070659_100302808 3300005366 Bacteria 1333
70 Ga0070659_100483469 3300005366 Bacteria 1054
71 Ga0070667_100244921 3300005367 Bacteria 1602
72 Ga0070667_100748564 3300005367 Bacteria 906
73 Ga0070667_100830546 3300005367 Bacteria 859
74 Ga0070667_100885727 3300005367 Bacteria 830
75 Ga0070667_101507393 3300005367 Bacteria 631
76 Ga0070709_10554080 3300005434 Bacteria 880
77 Ga0070714_101245849 3300005435 Bacteria 726
78 Ga0070713_101550238 3300005436 Bacteria 643
79 Ga0070710_10080672 3300005437 Bacteria 1898
80 Ga0070701_10104741 3300005438 Bacteria 1572
81 Ga0070701_10150986 3300005438 Bacteria 1338
82 Ga0070711_100111738 3300005439 Bacteria 2006
83 Ga0070711_100150626 3300005439 Bacteria 1754
84 Ga0070705_100798108 3300005440 Bacteria 751
85 Ga0070700_100396324 3300005441 Bacteria 1037
86 Ga0070694_100626303 3300005444 Bacteria 869
87 Ga0070663_100016240 3300005455 Bacteria 4829
88 Ga0070663_100020052 3300005455 Bacteria 4419
89 Ga0070663_100123056 3300005455 Bacteria 1961
90 Ga0070663_100437512 3300005455 Bacteria 1075
91 Ga0070663_100596433 3300005455 Bacteria 928
92 Ga0070663_101660418 3300005455 Bacteria 571
93 Ga0070663_101930476 3300005455 Bacteria 530
94 Ga0070678_100003659 3300005456 Bacteria 8584
95 Ga0070678_100017610 3300005456 Bacteria 4607
96 Ga0070678_100037277 3300005456 Bacteria 3412
97 Ga0070678_100067668 3300005456 Bacteria 2659
98 Ga0070662_100035529 3300005457 Bacteria 3520
99 Ga0070662_100534799 3300005457 Bacteria 981
100 Ga0070662_101609019 3300005457 Bacteria 561
101 Ga0070681_10058589 3300005458 Bacteria 3831
102 Ga0070681_10706778 3300005458 Bacteria 924
103 Ga0070681_11890369 3300005458 Unclassified 524
104 Ga0068867_100049914 3300005459 Bacteria 3081
105 Ga0068867_100709248 3300005459 Bacteria 889
106 Ga0070685_10181990 3300005466 Bacteria 1354
107 Ga0070706_100366354 3300005467 Bacteria 1343
108 Ga0070699_100857343 3300005518 Bacteria 832
109 Ga0070699_102180762 3300005518 Bacteria 506
110 Ga0070679_100021982 3300005530 Bacteria 6232
111 Ga0070679_102074267 3300005530 Bacteria 518
112 Ga0070684_100132369 3300005535 Bacteria 2250
113 Ga0070684_101966184 3300005535 Bacteria 552
114 Ga0070697_102008836 3300005536 Bacteria 518
115 Ga0068853_100014537 3300005539 Bacteria 6451
116 Ga0068853_100205235 3300005539 Bacteria 1795
117 Ga0068853_100206278 3300005539 Bacteria 1790
118 Ga0068853_100391277 3300005539 Bacteria 1300
119 Ga0068853_102007754 3300005539 Bacteria 561
120 Ga0070672_100215342 3300005543 Bacteria 1610
121 Ga0070672_100670484 3300005543 Bacteria 907
122 Ga0070672_100882149 3300005543 Bacteria 790
123 Ga0070672_101204631 3300005543 Bacteria 675
124 Ga0070686_100177039 3300005544 Bacteria 1513
125 Ga0070686_100573155 3300005544 Bacteria 886
126 Ga0070686_100643605 3300005544 Bacteria 840
127 Ga0070686_101235180 3300005544 Bacteria 622
128 Ga0070696_100348194 3300005546 Bacteria 1147
129 Ga0070693_100091362 3300005547 Bacteria 1836
130 Ga0070665_100069675 3300005548 Bacteria 3525
131 Ga0070665_100203937 3300005548 Bacteria 1978
132 Ga0070665_100358774 3300005548 Bacteria 1463
133 Ga0070704_100137670 3300005549 Bacteria 1902
134 Ga0068855_100014574 3300005563 Bacteria 9470
135 Ga0068855_100036502 3300005563 Bacteria 5849
136 Ga0068855_100037055 3300005563 Bacteria 5802
137 Ga0068855_100066675 3300005563 Bacteria 4196
138 Ga0068855_100778579 3300005563 Bacteria 1018
139 Ga0068855_100985620 3300005563 Bacteria 886
140 Ga0068855_101197574 3300005563 Bacteria 790
141 Ga0070664_100021262 3300005564 Bacteria 5346
142 Ga0068857_102144183 3300005577 Bacteria 548
143 Ga0068854_100587721 3300005578 Bacteria 949
144 Ga0068854_100778395 3300005578 Bacteria 832
145 Ga0068856_100489788 3300005614 Bacteria 1250
146 Ga0068856_100662677 3300005614 Bacteria 1064
147 Ga0068856_100832589 3300005614 Bacteria 942
148 Ga0068856_100907486 3300005614 Bacteria 900
149 Ga0070702_100061421 3300005615 Bacteria 2188
150 Ga0070702_100630948 3300005615 Bacteria 808
151 Ga0070702_100832092 3300005615 Bacteria 717
152 Ga0068852_100022692 3300005616 Bacteria 5039
153 Ga0068852_100223284 3300005616 Bacteria 1793
154 Ga0068852_100772596 3300005616 Bacteria 974
155 Ga0068852_101379056 3300005616 Bacteria 727
156 Ga0068859_100237233 3300005617 Bacteria 1912
157 Ga0068859_100986570 3300005617 Bacteria 925
158 Ga0068859_102459925 3300005617 Bacteria 573
159 Ga0068864_100073671 3300005618 Bacteria 2977
160 Ga0068864_101985841 3300005618 Bacteria 588
161 Ga0068866_10149422 3300005718 Bacteria 1351
162 Ga0068866_10195073 3300005718 Bacteria 1206
163 Ga0068866_10319886 3300005718 Bacteria 976
164 Ga0068866_10857445 3300005718 Bacteria 636
165 Ga0068861_100052716 3300005719 Bacteria 3093
166 Ga0068861_100259325 3300005719 Bacteria 1487
167 Ga0068861_101148943 3300005719 Bacteria 748
168 Ga0068861_101801330 3300005719 Bacteria 607
169 Ga0068861_102322041 3300005719 Bacteria 538
170 Ga0068851_10383285 3300005834 Bacteria 824
171 Ga0068851_10499761 3300005834 Bacteria 729
172 Ga0068870_10088952 3300005840 Bacteria 1723
173 Ga0068863_100133864 3300005841 Bacteria 2367
174 Ga0068863_101629419 3300005841 Bacteria 655
175 Ga0068858_100023425 3300005842 Bacteria 5752
176 Ga0068858_100060057 3300005842 Bacteria 3514
177 Ga0068858_100514881 3300005842 Bacteria 1157
178 Ga0068858_100938665 3300005842 Bacteria 847
179 Ga0068858_101559705 3300005842 Bacteria 652
180 Ga0068858_101650519 3300005842 Bacteria 633
181 Ga0068860_100292362 3300005843 Bacteria 1594
182 Ga0068860_101077622 3300005843 Bacteria 822
183 Ga0068860_102009637 3300005843 Bacteria 599
184 Ga0068862_100145699 3300005844 Bacteria 2104
185 Ga0068862_100502129 3300005844 Bacteria 1151
186 Ga0068862_101100731 3300005844 Bacteria 789
187 Ga0068862_101222327 3300005844 Bacteria 750
188 Ga0081455_10000895 3300005937 Bacteria 38448
189 Ga0081455_10208227 3300005937 Bacteria 1459
190 Ga0081540_1002053 3300005983 Bacteria 16798
191 Ga0081540_1002582 3300005983 Bacteria 14701
192 Ga0081540_1003838 3300005983 Bacteria 11758
193 Ga0081540_1005208 3300005983 Bacteria 9729
194 Ga0081540_1007807 3300005983 Bacteria 7570
195 Ga0081540_1011448 3300005983 Bacteria 5926
196 Ga0081540_1053737 3300005983 Bacteria 1973
197 Ga0081540_1315350 3300005983 Bacteria 537
198 Ga0070717_10331799 3300006028 Bacteria 1357
199 Ga0070717_10651567 3300006028 Bacteria 956
200 Ga0070717_11674234 3300006028 Bacteria 576
201 Ga0075365_10031510 3300006038 Bacteria 3401
202 Ga0075365_10114109 3300006038 Bacteria 1859
203 Ga0075368_10002535 3300006042 Bacteria 5974
204 Ga0075363_100084189 3300006048 Bacteria 1743
205 Ga0075363_100831096 3300006048 Bacteria 563
206 Ga0075364_10040099 3300006051 Bacteria 3037
207 Ga0070716_100564558 3300006173 Bacteria 851
208 Ga0070716_101130306 3300006173 Bacteria 626
209 Ga0070712_100098016 3300006175 Bacteria 2162
210 Ga0070712_100452239 3300006175 Bacteria 1070
211 Ga0070712_100736895 3300006175 Bacteria 843
212 Ga0075362_10062304 3300006177 Bacteria 1689
213 Ga0075362_10191086 3300006177 Bacteria 994
214 Ga0075362_10305662 3300006177 Bacteria 790
215 Ga0075367_10032918 3300006178 Bacteria 2985
216 Ga0075367_10165209 3300006178 Bacteria 1377
217 Ga0075367_10546170 3300006178 Bacteria 736
218 Ga0075369_10145910 3300006186 Bacteria 1080
219 Ga0075366_10155615 3300006195 Bacteria 1384
220 Ga0097621_100045438 3300006237 Bacteria 3548
221 Ga0097621_100097225 3300006237 Bacteria 2472
222 Ga0097621_101183157 3300006237 Bacteria 720
223 Ga0097621_102332976 3300006237 Bacteria 512
224 Ga0075370_10114646 3300006353 Bacteria 1566
225 Ga0068871_100031318 3300006358 Bacteria 4194
226 Ga0068871_100563371 3300006358 Bacteria 1033
227 Ga0075434_100207988 3300006871 Bacteria 1978
228 Ga0068865_100039829 3300006881 Bacteria 3189
229 Ga0068865_100442397 3300006881 Bacteria 1073
230 Ga0068865_101867429 3300006881 Bacteria 544
231 Ga0097620_100237229 3300006931 Bacteria 1912
232 Ga0097620_100986525 3300006931 Bacteria 925
233 Ga0097620_102459913 3300006931 Bacteria 573
234 Ga0075435_100040178 3300007076 Bacteria 3735
235 Ga0099795_10001567 3300007788 Bacteria 5035
236 Ga0099795_10333478 3300007788 Bacteria 675
237 Ga0105251_10099205 3300009011 Bacteria 1332
238 Ga0105240_10381267 3300009093 Bacteria 1592
239 Ga0105240_10445166 3300009093 Bacteria 1451
240 Ga0105240_10696767 3300009093 Bacteria 1109
241 Ga0105240_12057348 3300009093 Bacteria 593
242 Ga0111539_11695168 3300009094 Bacteria 733
243 Ga0105245_10027787 3300009098 Bacteria 4985
244 Ga0105245_10266547 3300009098 Bacteria 1669
245 Ga0105247_10121527 3300009101 Bacteria 1692
246 Ga0105247_10431196 3300009101 Bacteria 946
247 Ga0105247_10981074 3300009101 Bacteria 658
248 Ga0105243_10011026 3300009148 Bacteria 6835
249 Ga0105243_10104731 3300009148 Bacteria 2355
250 Ga0105243_11376315 3300009148 Bacteria 725
251 Ga0105243_12011325 3300009148 Bacteria 612
252 Ga0105241_10302898 3300009174 Bacteria 1372
253 Ga0105241_11128652 3300009174 Bacteria 739
254 Ga0105242_10483835 3300009176 Bacteria 1174
255 Ga0105242_10921034 3300009176 Bacteria 876
256 Ga0105242_11784149 3300009176 Bacteria 653
257 Ga0105242_11855893 3300009176 Bacteria 642
258 Ga0105242_11930074 3300009176 Bacteria 631
259 Ga0105248_10034971 3300009177 Bacteria 5622
260 Ga0105248_10578130 3300009177 Bacteria 1267
261 Ga0105248_11000293 3300009177 Bacteria 944
262 Ga0105248_12066583 3300009177 Bacteria 648
263 Ga0105237_10043449 3300009545 Bacteria 4526
264 Ga0105237_10099940 3300009545 Bacteria 2892
265 Ga0105237_10167236 3300009545 Bacteria 2198
266 Ga0105237_10412156 3300009545 Bacteria 1356
267 Ga0105237_11103806 3300009545 Bacteria 800
268 Ga0105237_11690252 3300009545 Bacteria 640
269 Ga0105237_12131593 3300009545 Unclassified 570
270 Ga0105238_10189353 3300009551 Bacteria 2034
271 Ga0105238_10380360 3300009551 Bacteria 1403
272 Ga0105238_10822089 3300009551 Bacteria 945
273 Ga0105238_11570745 3300009551 Bacteria 688
274 Ga0105238_11643913 3300009551 Bacteria 673
275 Ga0105249_10071994 3300009553 Bacteria 3195
276 Ga0105249_12135119 3300009553 Bacteria 633
277 Ga0105239_10010954 3300010375 Bacteria 10129
278 Ga0105239_10120429 3300010375 Bacteria 2914
279 Ga0105239_10223977 3300010375 Bacteria 2109
280 Ga0105239_10320168 3300010375 Bacteria 1749
281 Ga0105239_12453475 3300010375 Bacteria 607
282 Ga0105239_12647613 3300010375 Bacteria 585
283 Ga0105239_13516621 3300010375 Bacteria 509
284 Ga0105246_10037993 3300011119 Bacteria 3234
285 Ga0105246_10834135 3300011119 Bacteria 821
286 Ga0157373_10514487 3300013100 Bacteria 866
287 Ga0157371_10027801 3300013102 Bacteria 4099
288 Ga0157370_10016923 3300013104 Bacteria 7371
289 Ga0157370_10034059 3300013104 Bacteria 4963
290 Ga0157370_10038959 3300013104 Bacteria 4597
291 Ga0157370_11088082 3300013104 Bacteria 722
292 Ga0157369_10000362 3300013105 Bacteria 60506
293 Ga0157369_10000808 3300013105 Bacteria 39992
294 Ga0157374_10003326 3300013296 Bacteria 13512
295 Ga0157374_10266765 3300013296 Bacteria 1688
296 Ga0157374_10721465 3300013296 Bacteria 1011
297 Ga0157378_10260553 3300013297 Bacteria 1663
298 Ga0157378_10745098 3300013297 Bacteria 1002
299 Ga0157378_10793243 3300013297 Bacteria 972
300 Ga0157378_10816321 3300013297 Bacteria 959
301 Ga0163162_10015168 3300013306 Bacteria 7526
302 Ga0163162_10055092 3300013306 Bacteria 4002
303 Ga0163162_10116218 3300013306 Bacteria 2776
304 Ga0163162_11248021 3300013306 Bacteria 844
305 Ga0163162_12015453 3300013306 Bacteria 661
306 Ga0163162_12767914 3300013306 Bacteria 565
307 Ga0157372_10234078 3300013307 Bacteria 2130
308 Ga0157372_11808161 3300013307 Bacteria 703
309 Ga0157375_10008539 3300013308 Bacteria 8967
310 Ga0157375_10114306 3300013308 Bacteria 2801
311 Ga0157375_10309505 3300013308 Bacteria 1744
312 Ga0157375_11563643 3300013308 Bacteria 779
313 Ga0163163_10007553 3300014325 Bacteria 9597
314 Ga0163163_10341033 3300014325 Bacteria 1554
315 Ga0163163_10607263 3300014325 Bacteria 1157
316 Ga0163163_12792390 3300014325 Bacteria 545
317 Ga0157380_12592928 3300014326 Bacteria 573
318 Ga0157377_10369659 3300014745 Bacteria 968
319 Ga0157377_10420363 3300014745 Bacteria 915
320 Ga0157377_10426601 3300014745 Bacteria 909
321 Ga0157379_10385425 3300014968 Bacteria 1286
322 Ga0157379_10463328 3300014968 Bacteria 1171
323 Ga0157379_11760015 3300014968 Bacteria 608
324 Ga0157376_10017469 3300014969 Bacteria 5473
325 Ga0157376_10645767 3300014969 Bacteria 1058
326 Ga0157376_10768259 3300014969 Bacteria 974
327 Ga0157376_10919498 3300014969 Bacteria 894
328 Ga0163161_10123768 3300017792 Bacteria 1945
329 Ga0163161_10779376 3300017792 Bacteria 802
330 Ga0163161_10923186 3300017792 Bacteria 741
331 Ga0163161_11426617 3300017792 Bacteria 605
332 Ga0163161_11988853 3300017792 Bacteria 517
333 Ga0197907_10425857 3300020069 Bacteria 525
334 Ga0206356_11624406 3300020070 Bacteria 1641
335 Ga0206350_10387633 3300020080 Bacteria 659
336 Ga0206354_10084247 3300020081 Bacteria 921
337 Ga0206353_10739046 3300020082 Bacteria 1863
338 Ga0224712_10000787 3300022467 Bacteria 6666
339 Ga0209672_100948 3300025228 Bacteria 12951
340 Ga0209759_1001867 3300025256 Bacteria 10461
341 Ga0209758_1003142 3300025297 Bacteria 15539
342 Ga0207697_10062646 3300025315 Bacteria 1549
343 Ga0207697_10335915 3300025315 Bacteria 671
344 Ga0207656_10149549 3300025321 Bacteria 1105
345 Ga0207653_10195040 3300025885 Bacteria 762
346 Ga0207692_10090497 3300025898 Bacteria 1658
347 Ga0207692_10587239 3300025898 Bacteria 715
348 Ga0207642_10057363 3300025899 Bacteria 1791
349 Ga0207710_10071000 3300025900 Bacteria 1597
350 Ga0207710_10292122 3300025900 Bacteria 822
351 Ga0207688_10030058 3300025901 Bacteria 2994
352 Ga0207688_10104915 3300025901 Bacteria 1635
353 Ga0207680_10259017 3300025903 Bacteria 1203
354 Ga0207680_10421109 3300025903 Bacteria 946
355 Ga0207647_10000340 3300025904 Bacteria 38070
356 Ga0207647_10564080 3300025904 Bacteria 631
357 Ga0207647_10726151 3300025904 Bacteria 539
358 Ga0207685_10078092 3300025905 Bacteria 1362
359 Ga0207699_10011455 3300025906 Bacteria 4480
360 Ga0207699_10464097 3300025906 Bacteria 910
361 Ga0207645_10401305 3300025907 Bacteria 922
362 Ga0207645_10821891 3300025907 Bacteria 632
363 Ga0207643_10033308 3300025908 Bacteria 2882
364 Ga0207705_10000352 3300025909 Bacteria 41499
365 Ga0207705_10057990 3300025909 Bacteria 2794
366 Ga0207705_10102825 3300025909 Bacteria 2104
367 Ga0207705_10113468 3300025909 Bacteria 2004
368 Ga0207705_10357462 3300025909 Bacteria 1126
369 Ga0207705_10642038 3300025909 Bacteria 825
370 Ga0207684_10575771 3300025910 Bacteria 962
371 Ga0207654_10372332 3300025911 Bacteria 988
372 Ga0207707_10306841 3300025912 Bacteria 1372
373 Ga0207707_10798221 3300025912 Bacteria 786
374 Ga0207707_11494105 3300025912 Unclassified 536
375 Ga0207695_10047671 3300025913 Bacteria 4531
376 Ga0207695_10137206 3300025913 Bacteria 2398
377 Ga0207695_10349841 3300025913 Bacteria 1365
378 Ga0207671_10327034 3300025914 Bacteria 1214
379 Ga0207671_10370802 3300025914 Bacteria 1137
380 Ga0207671_10385238 3300025914 Bacteria 1114
381 Ga0207671_10424414 3300025914 Bacteria 1058
382 Ga0207693_10031699 3300025915 Bacteria 4176
383 Ga0207693_10050481 3300025915 Bacteria 3267
384 Ga0207693_10066564 3300025915 Bacteria 2821
385 Ga0207663_10021008 3300025916 Bacteria 3708
386 Ga0207663_10867856 3300025916 Bacteria 721
387 Ga0207660_10163892 3300025917 Bacteria 1717
388 Ga0207660_11317332 3300025917 Bacteria 586
389 Ga0207662_10143963 3300025918 Bacteria 1511
390 Ga0207657_10202353 3300025919 Bacteria 1597
391 Ga0207657_10527779 3300025919 Bacteria 924
392 Ga0207649_10802599 3300025920 Bacteria 735
393 Ga0207649_11052109 3300025920 Bacteria 641
394 Ga0207652_10156528 3300025921 Bacteria 2042
395 Ga0207646_11119044 3300025922 Bacteria 693
396 Ga0207681_10337974 3300025923 Bacteria 1202
397 Ga0207681_11028151 3300025923 Bacteria 691
398 Ga0207694_10471411 3300025924 Bacteria 1049
399 Ga0207694_10575780 3300025924 Bacteria 946
400 Ga0207694_10579713 3300025924 Bacteria 943
401 Ga0207694_11126951 3300025924 Bacteria 664
402 Ga0207650_11098057 3300025925 Bacteria 677
403 Ga0207687_10023036 3300025927 Bacteria 4148
404 Ga0207687_10075061 3300025927 Bacteria 2425
405 Ga0207700_10043969 3300025928 Bacteria 3285
406 Ga0207644_10119591 3300025931 Bacteria 2004
407 Ga0207644_11004590 3300025931 Bacteria 700
408 Ga0207690_10006937 3300025932 Bacteria 6715
409 Ga0207690_10299993 3300025932 Bacteria 1257
410 Ga0207690_10962236 3300025932 Bacteria 709
411 Ga0207690_11162511 3300025932 Bacteria 644
412 Ga0207706_10060448 3300025933 Bacteria 3337
413 Ga0207706_10250929 3300025933 Bacteria 1545
414 Ga0207706_11242256 3300025933 Bacteria 618
415 Ga0207706_11443281 3300025933 Bacteria 563
416 Ga0207686_10251825 3300025934 Bacteria 1291
417 Ga0207686_10760956 3300025934 Bacteria 774
418 Ga0207686_10881960 3300025934 Bacteria 721
419 Ga0207686_10890236 3300025934 Bacteria 718
420 Ga0207709_10028413 3300025935 Bacteria 3233
421 Ga0207709_10067476 3300025935 Bacteria 2257
422 Ga0207709_11744745 3300025935 Bacteria 518
423 Ga0207670_10048644 3300025936 Bacteria 2831
424 Ga0207670_10437426 3300025936 Bacteria 1052
425 Ga0207669_10012350 3300025937 Bacteria 4196
426 Ga0207669_10042118 3300025937 Bacteria 2663
427 Ga0207669_10702625 3300025937 Bacteria 831
428 Ga0207669_11136797 3300025937 Bacteria 660
429 Ga0207669_11143130 3300025937 Bacteria 658
430 Ga0207704_10042466 3300025938 Bacteria 2677
431 Ga0207704_10369105 3300025938 Bacteria 1123
432 Ga0207704_10708282 3300025938 Bacteria 834
433 Ga0207704_10931018 3300025938 Bacteria 732
434 Ga0207704_11429730 3300025938 Bacteria 593
435 Ga0207665_10376901 3300025939 Bacteria 1076
436 Ga0207665_10569974 3300025939 Bacteria 881
437 Ga0207665_11496642 3300025939 Bacteria 536
438 Ga0207691_10059924 3300025940 Bacteria 3460
439 Ga0207691_10971201 3300025940 Bacteria 709
440 Ga0207691_11150710 3300025940 Bacteria 644
441 Ga0207711_10518245 3300025941 Bacteria 1112
442 Ga0207711_10566025 3300025941 Bacteria 1060
443 Ga0207711_11003573 3300025941 Bacteria 774
444 Ga0207711_11128492 3300025941 Bacteria 725
445 Ga0207689_10075529 3300025942 Bacteria 2770
446 Ga0207689_10091812 3300025942 Bacteria 2494
447 Ga0207689_11200102 3300025942 Bacteria 639
448 Ga0207689_11684504 3300025942 Bacteria 526
449 Ga0207661_10615357 3300025944 Bacteria 997
450 Ga0207679_10048953 3300025945 Bacteria 3080
451 Ga0207667_10002243 3300025949 Bacteria 24288
452 Ga0207667_10010756 3300025949 Bacteria 10672
453 Ga0207667_10011404 3300025949 Bacteria 10330
454 Ga0207667_10074694 3300025949 Bacteria 3521
455 Ga0207667_11037481 3300025949 Bacteria 806
456 Ga0207667_11921973 3300025949 Bacteria 553
457 Ga0207651_10072156 3300025960 Bacteria 2450
458 Ga0207651_10091652 3300025960 Bacteria 2226
459 Ga0207651_11159675 3300025960 Bacteria 693
460 Ga0207712_10057081 3300025961 Bacteria 2753
461 Ga0207712_10124192 3300025961 Bacteria 1957
462 Ga0207712_11806335 3300025961 Bacteria 548
463 Ga0207668_10019967 3300025972 Bacteria 4248
464 Ga0207668_10036022 3300025972 Bacteria 3300
465 Ga0207668_10290683 3300025972 Bacteria 1344
466 Ga0207668_10767587 3300025972 Bacteria 851
467 Ga0207668_11650731 3300025972 Bacteria 579
468 Ga0207668_11651264 3300025972 Bacteria 578
469 Ga0207640_10041183 3300025981 Bacteria 2936
470 Ga0207640_10284821 3300025981 Bacteria 1300
471 Ga0207640_11985875 3300025981 Bacteria 527
472 Ga0207658_10317607 3300025986 Bacteria 1347
473 Ga0207658_10903315 3300025986 Bacteria 804
474 Ga0207658_11080908 3300025986 Bacteria 733
475 Ga0207658_12145365 3300025986 Bacteria 507
476 Ga0207677_10011044 3300026023 Bacteria 5132
477 Ga0207677_10091669 3300026023 Bacteria 2211
478 Ga0207677_10424507 3300026023 Bacteria 1133
479 Ga0207677_11001803 3300026023 Bacteria 758
480 Ga0207703_10075453 3300026035 Bacteria 2794
481 Ga0207703_10489198 3300026035 Bacteria 1154
482 Ga0207703_11888044 3300026035 Bacteria 573
483 Ga0207703_12076511 3300026035 Bacteria 544
484 Ga0207639_10127272 3300026041 Bacteria 2103
485 Ga0207639_10131727 3300026041 Bacteria 2071
486 Ga0207639_10203783 3300026041 Bacteria 1698
487 Ga0207639_10408168 3300026041 Bacteria 1225
488 Ga0207639_11840782 3300026041 Bacteria 566
489 Ga0207678_10010552 3300026067 Bacteria 8114
490 Ga0207678_10022770 3300026067 Bacteria 5486
491 Ga0207678_10203891 3300026067 Bacteria 1691
492 Ga0207678_10585696 3300026067 Bacteria 977
493 Ga0207678_10737917 3300026067 Bacteria 868
494 Ga0207708_10184300 3300026075 Bacteria 1658
495 Ga0207702_10462376 3300026078 Bacteria 1233
496 Ga0207702_10628896 3300026078 Bacteria 1055
497 Ga0207702_11008951 3300026078 Bacteria 826
498 Ga0207702_11251691 3300026078 Bacteria 736
499 Ga0207641_10062468 3300026088 Bacteria 3179
500 Ga0207641_11298147 3300026088 Bacteria 728
501 Ga0207648_10197558 3300026089 Bacteria 1784
502 Ga0207648_10307061 3300026089 Bacteria 1424
503 Ga0207648_10550576 3300026089 Bacteria 1060
504 Ga0207676_12208683 3300026095 Bacteria 548
505 Ga0207674_10111119 3300026116 Bacteria 2715
506 Ga0207675_100101117 3300026118 Bacteria 2716
507 Ga0207675_100111822 3300026118 Bacteria 2577
508 Ga0207675_100199723 3300026118 Bacteria 1920
509 Ga0207675_100437879 3300026118 Bacteria 1293
510 Ga0207683_10014660 3300026121 Bacteria 6675
511 Ga0207683_10044880 3300026121 Bacteria 3864
512 Ga0207683_11014122 3300026121 Bacteria 770
513 Ga0207683_12039011 3300026121 Bacteria 522
514 Ga0207698_10102309 3300026142 Bacteria 2378
515 Ga0207698_10282368 3300026142 Bacteria 1536
516 Ga0207698_10716743 3300026142 Bacteria 997
517 Ga0209813_10356145 3300027866 Bacteria 581
518 Ga0268266_10019219 3300028379 Bacteria 5818
519 Ga0268266_10073912 3300028379 Bacteria 2959
520 Ga0268265_10791409 3300028380 Bacteria 923
521 Ga0268265_10927281 3300028380 Bacteria 856
522 Ga0268265_11356582 3300028380 Bacteria 712
523 Ga0268264_10257991 3300028381 Bacteria 1622
524 Ga0268264_11786333 3300028381 Bacteria 625
525 Ga0268264_12142705 3300028381 Bacteria 567
526 Ga0307517_10308361 3300028786 Bacteria 883
527 Ga0307515_10393531 3300028794 Bacteria 1014
528 Ga0307511_10210668 3300030521 Bacteria 993
529 Ga0265763_1028070 3300030763 Bacteria 626
530 Ga0265760_10293071 3300031090 Bacteria 575
531 Ga0265332_10369523 3300031238 Bacteria 592
532 Ga0265331_10030702 3300031250 Bacteria 2674
533 Ga0307513_10193775 3300031456 Bacteria 1881
534 Ga0307509_10272187 3300031507 Bacteria 1460
535 Ga0307508_10565863 3300031616 Bacteria 736
536 Ga0265314_10059242 3300031711 Bacteria 2620
537 Ga0265314_10548549 3300031711 Bacteria 602
538 Ga0265342_10010007 3300031712 Bacteria 6621
539 Ga0265342_10079738 3300031712 Bacteria 1893
540 Ga0307516_10213055 3300031730 Bacteria 1645
541 Ga0307516_10999018 3300031730 Bacteria 509
542 Ga0307415_100020263 3300032126 Bacteria 4058
543 Ga0307507_10596065 3300033179 Bacteria 572
544 Ga0307510_10009746 3300033180 Bacteria 11432
545 Ga0373930_0043898 3300034816 Bacteria 960
546 Ga0373959_0017186 3300034820 Bacteria 1349
547 Ga0373938_0080798 3300034957 Bacteria 791
548 Ga0373929_0064173 3300035085 Bacteria 866
549 Ga0373944_0117981 3300035089 Bacteria 912
550 Ga0373923_0000827 3300035111 Bacteria 8121
551 Ga0373936_0041112 3300035113 Bacteria 1854
552 Ga0373936_0061770 3300035113 Bacteria 1531
553 Ga0373953_0002753 3300035117 Bacteria 5341
554 Ga0373954_0000634 3300035118 Bacteria 13429
555 Ga0373954_0036508 3300035118 Bacteria 2281
556 Ga0373956_0001884 3300035119 Bacteria 8647
557 Ga0373957_0000200 3300035120 Bacteria 15408
558 Ga0373946_0078970 3300035171 Bacteria 1437
559 Ga0373955_0005004 3300035172 Bacteria 5921
560 Ga0373942_0040611 3300035207 Bacteria 1269
561 Ga0373961_0122618 3300035241 Bacteria 863
562 Ga0373924_0052392 3300035410 Bacteria 1694
563 Ga0373931_0050522 3300035691 Bacteria 2212
564 Ga0373935_0103925 3300035692 Bacteria 1877
565 Ga0373927_0054881 3300035695 Bacteria 2577
566 Ga0373933_0002159 3300035724 Bacteria 11266
567 Ga0373933_0831574 3300035724 Bacteria 608
568 Ga0373947_0706203 3300035725 Bacteria 688
569 Ga0373937_0014785 3300036401 Bacteria 6891
570 Ga0372808_001672 3300036459 Bacteria 2374
571 Ga0373925_1009403 3300037068 Bacteria 685
572 Ga0395899_0000007 3300037312 Bacteria 629129
573 Ga0395899_0021494 3300037312 Bacteria 4895
574 Ga0395899_0037652 3300037312 Bacteria 3626
575 Ga0395899_0070803 3300037312 Bacteria 2552
576 Ga0395900_0003760 3300037418 Bacteria 16301
577 Ga0395900_0006222 3300037418 Bacteria 12463
578 Ga0395900_0019019 3300037418 Bacteria 7005
579 Ga0395900_0077073 3300037418 Bacteria 3425
580 Ga0395900_0363491 3300037418 Bacteria 1418
581 Ga0395900_0671412 3300037418 Bacteria 971
582 Ga0395898_0000276 3300037466 Bacteria 124774
583 Ga0395898_0012584 3300037466 Bacteria 8748
584 Ga0395898_0148480 3300037466 Bacteria 2243
585 Ga0395905_0392592 3300037471 Bacteria 1282
586 Ga0395905_1286533 3300037471 Bacteria 635
587 Ga0395901_0000017 3300038443 Bacteria 345003
588 Ga0395901_0000410 3300038443 Bacteria 50670
589 Ga0395901_0002433 3300038443 Bacteria 18893
590 Ga0395901_0007409 3300038443 Bacteria 11070
591 Ga0451787_030782 3300041441 Bacteria 634
592 Ga0451787_437186 3300041441 Bacteria 656
593 Ga0451789_0439858 3300041443 Bacteria 927
594 Ga0451791_1349316 3300041451 Bacteria 1067
595 Ga0451793_0751178 3300041452 Bacteria 500
596 Ga0451797_0172161 3300041453 Bacteria 958
597 Ga0451795_1524981 3300041456 Bacteria 542
598 Ga0451798_1057041 3300041458 Bacteria 766
599 Ga0451800_1604853 3300041459 Bacteria 581
600 Ga0451802_0019777 3300041460 Bacteria 653
601 Ga0451802_0304564 3300041460 Bacteria 573
602 Ga0451807_1607086 3300041486 Bacteria 514
603 Ga0451833_1216072 3300041491 Bacteria 661
604 Ga0451845_0985256 3300041501 Bacteria 598
605 Ga0451851_1322556 3300041507 Bacteria 572
606 Ga0451843_0728618 3300041509 Bacteria 846
607 Ga0451853_1746509 3300041512 Bacteria 1980
608 Ga0451853_1810983 3300041512 Bacteria 776
609 Ga0451853_4067572 3300041512 Bacteria 604
610 Ga0439448_0000098 3300042005 Bacteria 15629
611 Ga0439455_0179302 3300042012 Bacteria 610
612 Ga0466969_0000523 3300044656 Bacteria 21109
613 Ga0466972_0007257 3300044658 Bacteria 5566
614 Ga0466973_0019878 3300044659 Bacteria 6407
615 Ga0466974_0175636 3300044660 Bacteria 1365
616 Ga0466965_0076266 3300044683 Bacteria 1691
617 Ga0466966_0223709 3300044684 Bacteria 1136
618 Ga0466961_0175977 3300044693 Bacteria 1329
619 Ga0466963_0031580 3300044694 Bacteria 3424
620 Ga0466964_0187202 3300044706 Bacteria 985
621 Ga0466971_0188451 3300044719 Bacteria 971
622 Ga0466971_0241865 3300044719 Bacteria 858
623 Ga0466970_0000982 3300044765 Bacteria 13717
624 Ga0466957_0007915 3300044842 Bacteria 6027
625 Ga0466959_0074060 3300045049 Bacteria 2462
626 Ga0466959_0152395 3300045049 Bacteria 1629
627 Ga0466959_0415505 3300045049 Bacteria 913
628 Ga0466958_0005985 3300045836 Bacteria 6584
629 Ga0466958_0007577 3300045836 Bacteria 5977
630 Ga0495617_019330 3300046452 Bacteria 2303
631 Ga0495627_098214 3300046453 Bacteria 838
632 Ga0495592_0002897 3300046454 Bacteria 12205
633 Ga0495603_0017151 3300046455 Bacteria 4384
634 Ga0495603_0031419 3300046455 Bacteria 3196
635 Ga0495603_0238001 3300046455 Bacteria 1049
636 Ga0495603_0399053 3300046455 Bacteria 788
637 Ga0495590_0035683 3300046457 Bacteria 1735
638 Ga0495591_057252 3300046458 Bacteria 1046
639 Ga0495629_0002158 3300046459 Bacteria 15190
640 Ga0495629_0682498 3300046459 Bacteria 683
641 Ga0495629_0755711 3300046459 Bacteria 643
642 Ga0495638_0131924 3300046460 Bacteria 1466
643 Ga0495638_0343294 3300046460 Bacteria 791
644 Ga0495641_0295354 3300046461 Bacteria 730
645 Ga0495651_0057664 3300046462 Bacteria 2981
646 Ga0495651_0101857 3300046462 Bacteria 2136
647 Ga0495653_0017446 3300046463 Bacteria 5838
648 Ga0495650_0146812 3300046471 Bacteria 850
649 Ga0495582_0201669 3300046473 Bacteria 1136
650 Ga0495582_0535426 3300046473 Bacteria 677
651 Ga0495605_0191943 3300046474 Bacteria 893
652 Ga0495639_0189724 3300046475 Bacteria 1003
653 Ga0495662_0050496 3300046476 Bacteria 2008
654 Ga0495664_0136401 3300046477 Bacteria 1487
655 Ga0495664_0304389 3300046477 Bacteria 962
656 Ga0495664_0870317 3300046477 Bacteria 528
657 Ga0495584_0368802 3300046491 Bacteria 729
658 Ga0495585_0019025 3300046492 Bacteria 3963
659 Ga0495594_0499582 3300046499 Bacteria 691
660 Ga0495596_0152289 3300046500 Bacteria 898
661 Ga0495607_0072805 3300046501 Bacteria 1912
662 Ga0495583_0087005 3300046506 Bacteria 1351
663 Ga0495606_0104556 3300046507 Bacteria 1718
664 Ga0495606_0151584 3300046507 Bacteria 1360
665 Ga0495606_0189315 3300046507 Bacteria 1180
666 Ga0495608_0002218 3300046511 Bacteria 14020
667 Ga0495608_0882922 3300046511 Bacteria 524
668 Ga0495610_0121293 3300046512 Bacteria 1145
669 Ga0495616_0370522 3300046513 Bacteria 593
670 Ga0495620_0070690 3300046515 Bacteria 1429
671 Ga0495620_0415190 3300046515 Bacteria 509
672 Ga0495628_0038487 3300046516 Bacteria 3828
673 Ga0495631_0229711 3300046518 Bacteria 791
674 Ga0495643_0287355 3300046522 Bacteria 754
675 Ga0495643_0481943 3300046522 Bacteria 536
676 Ga0495644_0097550 3300046523 Bacteria 1111
677 Ga0495648_0095285 3300046524 Bacteria 1656
678 Ga0495663_0153991 3300046525 Bacteria 786
679 Ga0495642_0175473 3300046528 Bacteria 932
680 Ga0495652_0038809 3300046529 Bacteria 4122
681 Ga0495652_0309464 3300046529 Bacteria 1145
682 Ga0495654_0065774 3300046530 Bacteria 1730
683 Ga0495665_0604613 3300046531 Bacteria 548
684 Ga0495640_0005616 3300046533 Bacteria 9978
685 Ga0495587_0025519 3300046536 Bacteria 3611
686 Ga0495587_0824488 3300046536 Bacteria 506
687 Ga0495598_0145952 3300046537 Bacteria 822
688 Ga0495598_0169757 3300046537 Bacteria 772
689 Ga0495609_0029965 3300046538 Bacteria 2476
690 Ga0495597_0066671 3300046542 Bacteria 1559
691 Ga0495645_0213847 3300046543 Bacteria 1300
692 Ga0495645_0251676 3300046543 Bacteria 1174
693 Ga0495645_0784040 3300046543 Bacteria 573
694 Ga0495622_0005946 3300046557 Bacteria 5670
695 Ga0495633_0217864 3300046558 Bacteria 874
696 Ga0495667_0009980 3300046559 Bacteria 6430
697 Ga0495656_0068283 3300046615 Bacteria 1571
698 Ga0495656_0125502 3300046615 Bacteria 1216
699 Ga0495656_0151554 3300046615 Bacteria 1120
700 Ga0495668_0070449 3300046616 Bacteria 1922
701 Ga0495668_0260170 3300046616 Bacteria 950
702 Ga0495634_0034579 3300046642 Bacteria 3467
703 Ga0495634_0762418 3300046642 Bacteria 553
704 Ga0495634_0874064 3300046642 Bacteria 510
705 Ga0495611_0229269 3300046648 Bacteria 863
706 Ga0495625_0427815 3300046660 Bacteria 822
707 Ga0495635_0001058 3300046663 Bacteria 18230
708 Ga0495635_0534498 3300046663 Bacteria 770
709 Ga0495635_0653495 3300046663 Bacteria 684
710 Ga0495588_0289516 3300046674 Bacteria 863
711 Ga0495588_0630690 3300046674 Bacteria 561
712 Ga0495657_0011523 3300046675 Bacteria 6606
713 Ga0495599_0003523 3300046678 Bacteria 9167
714 Ga0495599_0163130 3300046678 Bacteria 1377
715 Ga0495623_0006259 3300046679 Bacteria 7742
716 Ga0495623_0023756 3300046679 Bacteria 3955
717 Ga0495646_0000934 3300046680 Bacteria 16609
718 Ga0495646_0125268 3300046680 Bacteria 1450
719 Ga0495669_0003832 3300046684 Bacteria 6181
720 Ga0495669_0584821 3300046684 Bacteria 543
721 Ga0495613_0306306 3300046689 Bacteria 1099
722 Ga0495624_0612487 3300046690 Bacteria 649
723 Ga0495649_0257830 3300046694 Bacteria 894
724 Ga0495589_0384953 3300046794 Bacteria 644
725 Ga0495589_0405868 3300046794 Bacteria 625
726 Ga0495600_0001795 3300046809 Bacteria 11997
727 Ga0495600_0319738 3300046809 Bacteria 976
728 Ga0495600_0586700 3300046809 Bacteria 678
729 Ga0495581_0523461 3300047315 Bacteria 689
730 Ga0495581_0637219 3300047315 Bacteria 616
731 Ga0495581_0670891 3300047315 Bacteria 599
732 Ga0495581_0858503 3300047315 Bacteria 519
733 Ga0495604_0014661 3300047317 Bacteria 6247
734 Ga0495604_0091763 3300047317 Bacteria 2251
735 Ga0495604_0864322 3300047317 Bacteria 567
736 Ga0495674_0007182 3300047319 Bacteria 10654
737 Ga0495674_0269727 3300047319 Bacteria 1397
738 Ga0495674_0943608 3300047319 Bacteria 664
739 Ga0495672_0046495 3300047320 Bacteria 2588
740 Ga0495672_0420365 3300047320 Bacteria 608
741 Ga0495676_0304106 3300047321 Bacteria 1075
742 Ga0495676_0325429 3300047321 Bacteria 1032
743 Ga0495676_1101575 3300047321 Bacteria 505
744 Ga0495680_0233868 3300047322 Bacteria 1307
745 Ga0495683_0104787 3300047323 Bacteria 1356
746 Ga0495675_0002644 3300047444 Bacteria 10732
747 Ga0495675_0004307 3300047444 Bacteria 8610
748 Ga0495677_0124151 3300047445 Bacteria 986
749 Ga0495677_0156220 3300047445 Bacteria 879
750 Ga0495679_099085 3300047446 Bacteria 811
751 Ga0495685_090611 3300047447 Bacteria 1014
752 Ga0495685_130572 3300047447 Bacteria 821
753 Ga0495673_0160260 3300047469 Bacteria 864
754 Ga0495684_0016173 3300047471 Bacteria 5745
755 Ga0495686_0065615 3300047472 Bacteria 2244
756 Ga0495686_0269147 3300047472 Bacteria 951
757 Ga0495686_0400024 3300047472 Bacteria 737
758 Ga0495593_0007370 3300047673 Bacteria 6445
759 Ga0495593_0329846 3300047673 Bacteria 763
760 Ga0495602_0027742 3300048088 Bacteria 5436
761 Ga0495602_0048110 3300048088 Bacteria 3836
762 Ga0495615_0018636 3300048090 Bacteria 1531
763 Ga0495626_0179278 3300048091 Bacteria 879
764 Ga0496100_0009207 3300048903 Bacteria 5541
765 Ga0496100_0013579 3300048903 Bacteria 4703
766 Ga0496100_0035542 3300048903 Bacteria 3135
767 Ga0496100_0193147 3300048903 Bacteria 1479
768 Ga0496100_0347828 3300048903 Bacteria 1119
769 Ga0496100_0863678 3300048903 Bacteria 710
770 Ga0496101_0000875 3300048904 Bacteria 17763
771 Ga0496101_0176638 3300048904 Bacteria 1643
772 Ga0496101_0227712 3300048904 Bacteria 1448
773 Ga0496101_0328408 3300048904 Bacteria 1200
774 Ga0496102_0009695 3300048905 Bacteria 8280
775 Ga0496102_0037392 3300048905 Bacteria 4379
776 Ga0496102_0248458 3300048905 Bacteria 1677
777 Ga0496102_0564003 3300048905 Bacteria 1061
778 Ga0496103_0006163 3300048906 Bacteria 7164
779 Ga0496103_0364652 3300048906 Bacteria 929
780 Ga0496103_0759658 3300048906 Bacteria 613
781 Ga0496104_0036083 3300048907 Bacteria 4618
782 Ga0496104_0879326 3300048907 Bacteria 801
783 Ga0496104_0894838 3300048907 Bacteria 793
784 Ga0496104_1502371 3300048907 Bacteria 576
785 Ga0496105_0017743 3300048908 Bacteria 5710
786 Ga0496105_0101141 3300048908 Bacteria 2380
787 Ga0496105_0668324 3300048908 Bacteria 800
788 Ga0496106_0016638 3300048909 Bacteria 5441
789 Ga0496106_0132381 3300048909 Bacteria 1956
790 Ga0496106_0320307 3300048909 Bacteria 1244
791 Ga0496106_0375713 3300048909 Bacteria 1142
792 Ga0496106_0516371 3300048909 Bacteria 959
793 Ga0496106_0533776 3300048909 Bacteria 942
794 Ga0496106_0787576 3300048909 Bacteria 755
795 Ga0496107_0015387 3300048910 Bacteria 5360
796 Ga0496107_0112310 3300048910 Bacteria 2003
797 Ga0496107_0255773 3300048910 Bacteria 1303
798 Ga0496107_0406021 3300048910 Bacteria 1013
799 Ga0496107_0686432 3300048910 Bacteria 754
800 Ga0496107_0978125 3300048910 Bacteria 615
801 Ga0496108_0002192 3300048911 Bacteria 15654
802 Ga0496108_0330641 3300048911 Bacteria 1329
803 Ga0496108_0449741 3300048911 Bacteria 1125
804 Ga0496108_1590037 3300048911 Bacteria 541
805 Ga0496109_0010462 3300048912 Bacteria 7926
806 Ga0496109_0079860 3300048912 Bacteria 3014
807 Ga0496109_0189821 3300048912 Bacteria 1931
808 Ga0496109_0316599 3300048912 Bacteria 1472
809 Ga0496109_0471486 3300048912 Bacteria 1185
810 Ga0496110_0026863 3300048913 Bacteria 4929
811 Ga0496110_0173863 3300048913 Bacteria 1954
812 Ga0496110_0599451 3300048913 Bacteria 999
813 Ga0496111_0018238 3300048914 Bacteria 4860
814 Ga0496111_0037599 3300048914 Bacteria 3464
815 Ga0496111_0211959 3300048914 Bacteria 1439
816 Ga0496112_0016391 3300048915 Bacteria 6941
817 Ga0496112_0018840 3300048915 Bacteria 6503
818 Ga0496112_0109577 3300048915 Bacteria 2731
819 Ga0496112_1690878 3300048915 Bacteria 545
820 Ga0496113_0001312 3300048916 Bacteria 13745
821 Ga0496113_0082648 3300048916 Bacteria 2463
822 Ga0496113_0405020 3300048916 Bacteria 1095
823 Ga0496113_0610121 3300048916 Bacteria 874
824 Ga0496113_1489394 3300048916 Bacteria 522
825 Ga0496114_0004461 3300048917 Bacteria 10865
826 Ga0496114_0108754 3300048917 Bacteria 2373
827 Ga0496114_0227293 3300048917 Bacteria 1639
828 Ga0496114_0263839 3300048917 Bacteria 1517
829 Ga0496114_0544542 3300048917 Bacteria 1026
830 Ga0496115_0009019 3300048918 Bacteria 7400
831 Ga0496115_0009478 3300048918 Bacteria 7232
832 Ga0496115_0039849 3300048918 Bacteria 3733
833 Ga0496115_0792938 3300048918 Bacteria 738
834 Ga0496115_0948707 3300048918 Bacteria 661
835 Ga0496115_1450641 3300048918 Bacteria 505
836 Ga0496116_0108802 3300048919 Bacteria 1636
837 Ga0496117_0290918 3300048920 Bacteria 870
838 Ga0496117_0329210 3300048920 Bacteria 797
839 Ga0496118_0562123 3300048921 Bacteria 554
840 Ga0496119_0308491 3300048922 Bacteria 778
841 Ga0496119_0541226 3300048922 Bacteria 537
842 Ga0496120_0492318 3300048923 Bacteria 528
843 Ga0496121_0000330 3300048924 Bacteria 98687
844 Ga0496121_0117819 3300048924 Bacteria 2011
845 Ga0496121_0228466 3300048924 Bacteria 1305
846 Ga0496121_0361152 3300048924 Bacteria 964
847 Ga0496121_0394458 3300048924 Bacteria 908
848 Ga0496121_0455971 3300048924 Bacteria 823
849 Ga0496121_0487080 3300048924 Bacteria 786
850 Ga0496122_0011608 3300048925 Bacteria 8893
851 Ga0496123_0115403 3300048926 Bacteria 1524
852 Ga0496124_0221282 3300048927 Bacteria 1423
853 Ga0496124_0624549 3300048927 Bacteria 696
854 Ga0496124_0670127 3300048927 Bacteria 662
855 Ga0496125_0200197 3300048928 Bacteria 1308
856 Ga0496125_0326519 3300048928 Bacteria 927
857 Ga0496125_0503762 3300048928 Bacteria 681
858 Ga0496125_0637333 3300048928 Bacteria 576
859 Ga0496126_0003590 3300048929 Bacteria 19439
860 Ga0496126_0004961 3300048929 Bacteria 15521
861 Ga0496126_0141728 3300048929 Bacteria 2068
862 Ga0496126_0508953 3300048929 Bacteria 961
863 Ga0496126_0803743 3300048929 Bacteria 721
864 Ga0496126_0911493 3300048929 Bacteria 666
865 Ga0496126_1379753 3300048929 Unclassified 510
866 Ga0495682_0163941 3300049460 Bacteria 791
867 Ga0501034_0317047 3300049571 Bacteria 1492
868 Ga0501044_0260348 3300049823 Bacteria 1673
869 nmdc:mga03683_130945_c1 3300050489 Bacteria 1122
870 nmdc:mga03n38_576503_c1 3300050490 Bacteria 639
871 nmdc:mga03n38_641608_c1 3300050490 Bacteria 608
872 nmdc:mga00v17_355964_c1 3300050491 Bacteria 952
873 nmdc:mga0yw44_1187532_c1 3300050492 Bacteria 515
874 nmdc:mga0yw44_162553_c1 3300050492 Bacteria 1462
875 nmdc:mga0yw44_259422_c1 3300050492 Bacteria 1158
876 nmdc:mga0yw44_945852_c1 3300050492 Bacteria 584
877 nmdc:mga0k408_133036_c1 3300050493 Bacteria 1477
878 nmdc:mga06z11_160840_c1 3300050494 Bacteria 1283
879 nmdc:mga06z11_779412_c1 3300050494 Bacteria 583
880 nmdc:mga06z11_832089_c1 3300050494 Bacteria 562
881 nmdc:mga07m45_506050_c1 3300050496 Bacteria 699
882 nmdc:mga08y16_1965971_c1 3300050511 Bacteria 534
883 nmdc:mga0sz30_179116_c1 3300050516 Bacteria 940
884 Ga0495601_0016288 3300053077 Bacteria 4504
885 Ga0495612_0262925 3300053078 Bacteria 769
886 Ga0500635_0418585 3300053080 Bacteria 531
887 Ga0500635_0425954 3300053080 Bacteria 526
888 Ga0495655_0004786 3300053083 Bacteria 2344
889 Ga0495595_0000335 3300053084 Bacteria 18133
890 Ga0495619_0001292 3300053085 Bacteria 16456
891 Ga0495619_0494582 3300053085 Bacteria 841
892 Ga0500644_0516922 3300053088 Bacteria 526
893 Ga0500583_0068458 3300053092 Bacteria 1693
894 Ga0500651_0323447 3300053093 Bacteria 880
895 Ga0500566_0011427 3300053094 Bacteria 5229
896 Ga0500566_0493869 3300053094 Bacteria 528
897 Ga0500640_215211 3300053095 Bacteria 655
898 Ga0500641_0032365 3300053096 Bacteria 2068
899 Ga0500641_0223095 3300053096 Bacteria 799
900 Ga0500554_018197 3300053102 Bacteria 1892
901 Ga0500555_139554 3300053103 Bacteria 598
902 Ga0500556_0047237 3300053104 Bacteria 1544
903 Ga0500562_063611 3300053108 Bacteria 992
904 Ga0500569_326036 3300053109 Bacteria 513
905 Ga0500592_089901 3300053116 Bacteria 515
906 Ga0500594_0196453 3300053118 Bacteria 662
907 Ga0500594_0230160 3300053118 Bacteria 614
908 Ga0500595_000468 3300053119 Bacteria 24982
909 Ga0500595_013495 3300053119 Bacteria 3128
910 Ga0500595_025974 3300053119 Bacteria 2023
911 Ga0500617_208270 3300053124 Bacteria 709
912 Ga0500642_0112653 3300053130 Bacteria 1271
913 Ga0500655_058888 3300053133 Bacteria 772
914 Ga0500658_0130238 3300053134 Bacteria 1121
915 Ga0500559_0145617 3300053136 Bacteria 1111
916 Ga0500561_0204129 3300053137 Bacteria 625
917 Ga0500568_0003017 3300053139 Bacteria 9628
918 Ga0500568_0300981 3300053139 Bacteria 582
919 Ga0500588_0303387 3300053146 Bacteria 604
920 Ga0500589_111338 3300053147 Bacteria 1173
921 Ga0500589_307102 3300053147 Bacteria 559
922 Ga0500590_210120 3300053148 Bacteria 814
923 Ga0500603_161253 3300053150 Bacteria 699
924 Ga0500604_0317164 3300053151 Bacteria 541
925 Ga0500622_0125384 3300053156 Bacteria 1241
926 Ga0500622_0217827 3300053156 Bacteria 858
927 Ga0500627_0131079 3300053158 Bacteria 1132
928 Ga0500634_0306566 3300053161 Bacteria 627
929 Ga0500638_002107 3300053162 Bacteria 6750
930 Ga0500638_068294 3300053162 Bacteria 1702
931 Ga0500636_0164781 3300053177 Bacteria 1205
932 Ga0500637_0000546 3300053178 Bacteria 14728
933 Ga0500637_0064084 3300053178 Bacteria 2108
934 Ga0500637_0171751 3300053178 Bacteria 1246
935 Ga0500611_141671 3300053727 Bacteria 655
936 Ga0500609_028950 3300053731 Bacteria 760
937 Ga0500656_003876 3300053732 Bacteria 1420
938 Ga0500596_070711 3300053735 Bacteria 596
939 Ga0501084_0203487 3300054114 Bacteria 1671
940 Ga0500661_000782 3300055283 Bacteria 5933
941 Ga0501082_0013785 3300060353 Bacteria 6950
942 Ga0466962_0018323 3300061719 Bacteria 3367

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0260348 Ga0501044_0260348_1508_1654 48
2 3300005563 Ga0068855_100985620 Ga0068855_1009856202 55
3 3300005578 Ga0068854_100778395 Ga0068854_1007783952 55
4 3300025949 Ga0207667_11921973 Ga0207667_119219732 55
5 3300025981 Ga0207640_10041183 Ga0207640_100411833 55
6 3300031712 Ga0265342_10079738 Ga0265342_100797382 55
7 3300005293 Ga0065715_10748971 Ga0065715_107489712 56
8 3300005329 Ga0070683_101093560 Ga0070683_1010935602 56
9 3300005365 Ga0070688_100332589 Ga0070688_1003325892 56
10 3300005539 Ga0068853_100205235 Ga0068853_1002052353 56
11 3300005544 Ga0070686_101235180 Ga0070686_1012351802 56
12 3300005615 Ga0070702_100832092 Ga0070702_1008320922 56
13 3300005618 Ga0068864_101985841 Ga0068864_1019858412 56
14 3300005718 Ga0068866_10149422 Ga0068866_101494222 56
15 3300005842 Ga0068858_101559705 Ga0068858_1015597052 56
16 3300006048 Ga0075363_100831096 Ga0075363_1008310962 56
17 3300006237 Ga0097621_101183157 Ga0097621_1011831572 56
18 3300009177 Ga0105248_10034971 Ga0105248_100349715 56
19 3300009545 Ga0105237_10043449 Ga0105237_100434494 56
20 3300009551 Ga0105238_11570745 Ga0105238_115707452 56
21 3300010375 Ga0105239_10223977 Ga0105239_102239773 56
22 3300011119 Ga0105246_10834135 Ga0105246_108341352 56
23 3300013306 Ga0163162_12767914 Ga0163162_127679142 56
24 3300014325 Ga0163163_10341033 Ga0163163_103410332 56
25 3300017792 Ga0163161_10923186 Ga0163161_109231861 56
26 3300017792 Ga0163161_11988853 Ga0163161_119888532 56
27 3300025315 Ga0207697_10335915 Ga0207697_103359152 56
28 3300025904 Ga0207647_10726151 Ga0207647_107261511 56
29 3300025924 Ga0207694_10579713 Ga0207694_105797132 56
30 3300025931 Ga0207644_11004590 Ga0207644_110045902 56
31 3300025937 Ga0207669_10702625 Ga0207669_107026252 56
32 3300025938 Ga0207704_10931018 Ga0207704_109310181 56
33 3300025941 Ga0207711_10566025 Ga0207711_105660252 56
34 3300026035 Ga0207703_12076511 Ga0207703_120765112 56
35 3300026041 Ga0207639_10203783 Ga0207639_102037832 56
36 3300026089 Ga0207648_10550576 Ga0207648_105505762 56
37 3300028381 Ga0268264_12142705 Ga0268264_121427052 56
38 3300034816 Ga0373930_0043898 Ga0373930_0043898_327_497 56
39 3300034957 Ga0373938_0080798 Ga0373938_0080798_334_504 56
40 3300035085 Ga0373929_0064173 Ga0373929_0064173_639_809 56
41 3300035089 Ga0373944_0117981 Ga0373944_0117981_135_305 56
42 3300035171 Ga0373946_0078970 Ga0373946_0078970_866_1036 56
43 3300035207 Ga0373942_0040611 Ga0373942_0040611_1031_1201 56
44 3300035241 Ga0373961_0122618 Ga0373961_0122618_94_264 56
45 3300035691 Ga0373931_0050522 Ga0373931_0050522_1591_1761 56
46 3300035692 Ga0373935_0103925 Ga0373935_0103925_598_768 56
47 3300035695 Ga0373927_0054881 Ga0373927_0054881_1031_1201 56
48 3300035725 Ga0373947_0706203 Ga0373947_0706203_488_658 56
49 3300036459 Ga0372808_001672 Ga0372808_001672_551_721 56
50 3300046515 Ga0495620_0415190 Ga0495620_0415190_114_284 56
51 3300046660 Ga0495625_0427815 Ga0495625_0427815_136_306 56
52 3300046663 Ga0495635_0534498 Ga0495635_0534498_41_220 56
53 3300047319 Ga0495674_0269727 Ga0495674_0269727_255_425 56
54 3300048903 Ga0496100_0013579 Ga0496100_0013579_1330_1500 56
55 3300048904 Ga0496101_0328408 Ga0496101_0328408_552_722 56
56 3300048905 Ga0496102_0037392 Ga0496102_0037392_1927_2097 56
57 3300048907 Ga0496104_1502371 Ga0496104_1502371_155_325 56
58 3300048908 Ga0496105_0101141 Ga0496105_0101141_713_883 56
59 3300048909 Ga0496106_0132381 Ga0496106_0132381_681_851 56
60 3300048910 Ga0496107_0112310 Ga0496107_0112310_1116_1286 56
61 3300048911 Ga0496108_0449741 Ga0496108_0449741_749_919 56
62 3300048912 Ga0496109_0471486 Ga0496109_0471486_159_329 56
63 3300048913 Ga0496110_0173863 Ga0496110_0173863_506_676 56
64 3300048915 Ga0496112_0109577 Ga0496112_0109577_249_419 56
65 3300048916 Ga0496113_1489394 Ga0496113_1489394_243_413 56
66 3300048917 Ga0496114_0108754 Ga0496114_0108754_137_307 56
67 3300048918 Ga0496115_0009019 Ga0496115_0009019_7173_7343 56
68 3300048925 Ga0496122_0011608 Ga0496122_0011608_1529_1699 56
69 3300048926 Ga0496123_0115403 Ga0496123_0115403_350_520 56
70 3300048929 Ga0496126_0003590 Ga0496126_0003590_7457_7627 56
71 3300053078 Ga0495612_0262925 Ga0495612_0262925_161_331 56
72 3300053085 Ga0495619_0494582 Ga0495619_0494582_68_238 56
73 3300003659 JGI25404J52841_10000254 JGI25404J52841_100002545 57
74 3300005937 Ga0081455_10208227 Ga0081455_102082272 57
75 3300005983 Ga0081540_1003838 Ga0081540_10038387 57
76 3300005983 Ga0081540_1005208 Ga0081540_10052086 57
77 3300013102 Ga0157371_10027801 Ga0157371_100278012 57
78 3300013105 Ga0157369_10000808 Ga0157369_1000080834 57
79 3300031730 Ga0307516_10999018 Ga0307516_109990181 57
80 3300035113 Ga0373936_0061770 Ga0373936_0061770_834_1013 57
81 3300037312 Ga0395899_0037652 Ga0395899_0037652_971_1144 57
82 3300037418 Ga0395900_0077073 Ga0395900_0077073_1798_1971 57
83 3300037466 Ga0395898_0012584 Ga0395898_0012584_5372_5545 57
84 3300037471 Ga0395905_0392592 Ga0395905_0392592_454_627 57
85 3300038443 Ga0395901_0007409 Ga0395901_0007409_2469_2642 57
86 3300003215 JGI25153J46596_10004677 JGI25153J46596_100046774 58
87 3300005327 Ga0070658_10075593 Ga0070658_100755933 58
88 3300005327 Ga0070658_10295883 Ga0070658_102958831 58
89 3300005327 Ga0070658_10944468 Ga0070658_109444682 58
90 3300005327 Ga0070658_11518580 Ga0070658_115185802 58
91 3300005328 Ga0070676_10492300 Ga0070676_104923002 58
92 3300005328 Ga0070676_10536251 Ga0070676_105362512 58
93 3300005329 Ga0070683_100086605 Ga0070683_1000866052 58
94 3300005330 Ga0070690_100352478 Ga0070690_1003524782 58
95 3300005330 Ga0070690_100704672 Ga0070690_1007046722 58
96 3300005331 Ga0070670_100109295 Ga0070670_1001092952 58
97 3300005331 Ga0070670_100433001 Ga0070670_1004330012 58
98 3300005333 Ga0070677_10647422 Ga0070677_106474222 58
99 3300005334 Ga0068869_100017200 Ga0068869_1000172005 58
100 3300005334 Ga0068869_100181849 Ga0068869_1001818492 58
101 3300005334 Ga0068869_100830396 Ga0068869_1008303962 58
102 3300005335 Ga0070666_10359545 Ga0070666_103595452 58
103 3300005335 Ga0070666_10449063 Ga0070666_104490631 58
104 3300005335 Ga0070666_10450053 Ga0070666_104500532 58
105 3300005336 Ga0070680_100043042 Ga0070680_1000430424 58
106 3300005337 Ga0070682_100042469 Ga0070682_1000424693 58
107 3300005337 Ga0070682_100157416 Ga0070682_1001574162 58
108 3300005338 Ga0068868_100006547 Ga0068868_1000065473 58
109 3300005338 Ga0068868_100069042 Ga0068868_1000690422 58
110 3300005338 Ga0068868_100203216 Ga0068868_1002032162 58
111 3300005340 Ga0070689_100230654 Ga0070689_1002306543 58
112 3300005340 Ga0070689_100543029 Ga0070689_1005430292 58
113 3300005340 Ga0070689_100574766 Ga0070689_1005747663 58
114 3300005341 Ga0070691_10111683 Ga0070691_101116831 58
115 3300005344 Ga0070661_100558505 Ga0070661_1005585052 58
116 3300005344 Ga0070661_100985189 Ga0070661_1009851892 58
117 3300005345 Ga0070692_10372284 Ga0070692_103722842 58
118 3300005347 Ga0070668_100045256 Ga0070668_1000452563 58
119 3300005347 Ga0070668_100104644 Ga0070668_1001046443 58
120 3300005347 Ga0070668_100182551 Ga0070668_1001825512 58
121 3300005347 Ga0070668_100320697 Ga0070668_1003206972 58
122 3300005347 Ga0070668_100409293 Ga0070668_1004092932 58
123 3300005347 Ga0070668_100673548 Ga0070668_1006735482 58
124 3300005347 Ga0070668_100871306 Ga0070668_1008713062 58
125 3300005353 Ga0070669_100971608 Ga0070669_1009716081 58
126 3300005353 Ga0070669_102052703 Ga0070669_1020527032 58
127 3300005354 Ga0070675_102234345 Ga0070675_1022343451 58
128 3300005355 Ga0070671_100267604 Ga0070671_1002676042 58
129 3300005355 Ga0070671_100880541 Ga0070671_1008805412 58
130 3300005355 Ga0070671_100907065 Ga0070671_1009070652 58
131 3300005356 Ga0070674_100021173 Ga0070674_1000211733 58
132 3300005356 Ga0070674_100142087 Ga0070674_1001420873 58
133 3300005356 Ga0070674_100406354 Ga0070674_1004063542 58
134 3300005356 Ga0070674_101206939 Ga0070674_1012069392 58
135 3300005364 Ga0070673_100059256 Ga0070673_1000592564 58
136 3300005364 Ga0070673_100150917 Ga0070673_1001509173 58
137 3300005364 Ga0070673_101663386 Ga0070673_1016633862 58
138 3300005365 Ga0070688_100239557 Ga0070688_1002395572 58
139 3300005365 Ga0070688_101601867 Ga0070688_1016018672 58
140 3300005366 Ga0070659_100302808 Ga0070659_1003028082 58
141 3300005366 Ga0070659_100483469 Ga0070659_1004834692 58
142 3300005367 Ga0070667_100244921 Ga0070667_1002449213 58
143 3300005367 Ga0070667_100748564 Ga0070667_1007485642 58
144 3300005367 Ga0070667_100830546 Ga0070667_1008305462 58
145 3300005367 Ga0070667_100885727 Ga0070667_1008857272 58
146 3300005367 Ga0070667_101507393 Ga0070667_1015073932 58
147 3300005434 Ga0070709_10554080 Ga0070709_105540802 58
148 3300005435 Ga0070714_101245849 Ga0070714_1012458492 58
149 3300005436 Ga0070713_101550238 Ga0070713_1015502382 58
150 3300005438 Ga0070701_10104741 Ga0070701_101047413 58
151 3300005438 Ga0070701_10150986 Ga0070701_101509862 58
152 3300005439 Ga0070711_100150626 Ga0070711_1001506262 58
153 3300005440 Ga0070705_100798108 Ga0070705_1007981082 58
154 3300005441 Ga0070700_100396324 Ga0070700_1003963242 58
155 3300005444 Ga0070694_100626303 Ga0070694_1006263031 58
156 3300005455 Ga0070663_100016240 Ga0070663_1000162402 58
157 3300005455 Ga0070663_100020052 Ga0070663_1000200523 58
158 3300005455 Ga0070663_100123056 Ga0070663_1001230563 58
159 3300005455 Ga0070663_100437512 Ga0070663_1004375122 58
160 3300005455 Ga0070663_100596433 Ga0070663_1005964332 58
161 3300005455 Ga0070663_101660418 Ga0070663_1016604182 58
162 3300005455 Ga0070663_101930476 Ga0070663_1019304762 58
163 3300005456 Ga0070678_100003659 Ga0070678_1000036593 58
164 3300005456 Ga0070678_100017610 Ga0070678_1000176105 58
165 3300005456 Ga0070678_100037277 Ga0070678_1000372774 58
166 3300005456 Ga0070678_100067668 Ga0070678_1000676682 58
167 3300005457 Ga0070662_100035529 Ga0070662_1000355292 58
168 3300005457 Ga0070662_100534799 Ga0070662_1005347992 58
169 3300005457 Ga0070662_101609019 Ga0070662_1016090192 58
170 3300005458 Ga0070681_10058589 Ga0070681_100585892 58
171 3300005458 Ga0070681_10706778 Ga0070681_107067782 58
172 3300005459 Ga0068867_100049914 Ga0068867_1000499143 58
173 3300005459 Ga0068867_100709248 Ga0068867_1007092482 58
174 3300005466 Ga0070685_10181990 Ga0070685_101819902 58
175 3300005467 Ga0070706_100366354 Ga0070706_1003663541 58
176 3300005518 Ga0070699_100857343 Ga0070699_1008573431 58
177 3300005518 Ga0070699_102180762 Ga0070699_1021807621 58
178 3300005530 Ga0070679_100021982 Ga0070679_1000219827 58
179 3300005530 Ga0070679_102074267 Ga0070679_1020742672 58
180 3300005535 Ga0070684_100132369 Ga0070684_1001323693 58
181 3300005535 Ga0070684_101966184 Ga0070684_1019661842 58
182 3300005536 Ga0070697_102008836 Ga0070697_1020088361 58
183 3300005539 Ga0068853_100014537 Ga0068853_1000145376 58
184 3300005539 Ga0068853_100391277 Ga0068853_1003912772 58
185 3300005539 Ga0068853_102007754 Ga0068853_1020077542 58
186 3300005543 Ga0070672_100215342 Ga0070672_1002153423 58
187 3300005543 Ga0070672_100670484 Ga0070672_1006704841 58
188 3300005543 Ga0070672_100882149 Ga0070672_1008821492 58
189 3300005543 Ga0070672_101204631 Ga0070672_1012046312 58
190 3300005544 Ga0070686_100177039 Ga0070686_1001770392 58
191 3300005544 Ga0070686_100573155 Ga0070686_1005731552 58
192 3300005544 Ga0070686_100643605 Ga0070686_1006436051 58
193 3300005546 Ga0070696_100348194 Ga0070696_1003481941 58
194 3300005547 Ga0070693_100091362 Ga0070693_1000913623 58
195 3300005548 Ga0070665_100069675 Ga0070665_1000696755 58
196 3300005548 Ga0070665_100203937 Ga0070665_1002039373 58
197 3300005548 Ga0070665_100358774 Ga0070665_1003587742 58
198 3300005549 Ga0070704_100137670 Ga0070704_1001376703 58
199 3300005563 Ga0068855_100014574 Ga0068855_1000145748 58
200 3300005563 Ga0068855_100066675 Ga0068855_1000666753 58
201 3300005563 Ga0068855_101197574 Ga0068855_1011975742 58
202 3300005564 Ga0070664_100021262 Ga0070664_1000212625 58
203 3300005577 Ga0068857_102144183 Ga0068857_1021441832 58
204 3300005578 Ga0068854_100587721 Ga0068854_1005877211 58
205 3300005614 Ga0068856_100489788 Ga0068856_1004897882 58
206 3300005614 Ga0068856_100832589 Ga0068856_1008325892 58
207 3300005614 Ga0068856_100907486 Ga0068856_1009074862 58
208 3300005615 Ga0070702_100061421 Ga0070702_1000614213 58
209 3300005615 Ga0070702_100630948 Ga0070702_1006309482 58
210 3300005616 Ga0068852_100022692 Ga0068852_1000226925 58
211 3300005616 Ga0068852_100223284 Ga0068852_1002232842 58
212 3300005616 Ga0068852_100772596 Ga0068852_1007725962 58
213 3300005616 Ga0068852_101379056 Ga0068852_1013790562 58
214 3300005617 Ga0068859_100237233 Ga0068859_1002372333 58
215 3300005617 Ga0068859_102459925 Ga0068859_1024599252 58
216 3300005618 Ga0068864_100073671 Ga0068864_1000736713 58
217 3300005718 Ga0068866_10195073 Ga0068866_101950732 58
218 3300005718 Ga0068866_10319886 Ga0068866_103198862 58
219 3300005718 Ga0068866_10857445 Ga0068866_108574452 58
220 3300005719 Ga0068861_100052716 Ga0068861_1000527163 58
221 3300005719 Ga0068861_100259325 Ga0068861_1002593253 58
222 3300005719 Ga0068861_101148943 Ga0068861_1011489431 58
223 3300005719 Ga0068861_101801330 Ga0068861_1018013302 58
224 3300005719 Ga0068861_102322041 Ga0068861_1023220412 58
225 3300005834 Ga0068851_10383285 Ga0068851_103832852 58
226 3300005834 Ga0068851_10499761 Ga0068851_104997611 58
227 3300005840 Ga0068870_10088952 Ga0068870_100889522 58
228 3300005841 Ga0068863_100133864 Ga0068863_1001338642 58
229 3300005841 Ga0068863_101629419 Ga0068863_1016294192 58
230 3300005842 Ga0068858_100023425 Ga0068858_1000234254 58
231 3300005842 Ga0068858_100060057 Ga0068858_1000600573 58
232 3300005842 Ga0068858_100514881 Ga0068858_1005148811 58
233 3300005842 Ga0068858_100938665 Ga0068858_1009386652 58
234 3300005842 Ga0068858_101650519 Ga0068858_1016505191 58
235 3300005843 Ga0068860_100292362 Ga0068860_1002923622 58
236 3300005843 Ga0068860_101077622 Ga0068860_1010776222 58
237 3300005843 Ga0068860_102009637 Ga0068860_1020096372 58
238 3300005844 Ga0068862_100145699 Ga0068862_1001456993 58
239 3300005844 Ga0068862_100502129 Ga0068862_1005021291 58
240 3300005844 Ga0068862_101100731 Ga0068862_1011007312 58
241 3300005844 Ga0068862_101222327 Ga0068862_1012223272 58
242 3300005937 Ga0081455_10000895 Ga0081455_1000089540 58
243 3300005983 Ga0081540_1002053 Ga0081540_100205317 58
244 3300005983 Ga0081540_1007807 Ga0081540_10078073 58
245 3300005983 Ga0081540_1011448 Ga0081540_10114485 58
246 3300005983 Ga0081540_1053737 Ga0081540_10537373 58
247 3300005983 Ga0081540_1315350 Ga0081540_13153502 58
248 3300006028 Ga0070717_10331799 Ga0070717_103317992 58
249 3300006028 Ga0070717_11674234 Ga0070717_116742342 58
250 3300006038 Ga0075365_10031510 Ga0075365_100315105 58
251 3300006038 Ga0075365_10114109 Ga0075365_101141092 58
252 3300006042 Ga0075368_10002535 Ga0075368_100025353 58
253 3300006048 Ga0075363_100084189 Ga0075363_1000841893 58
254 3300006051 Ga0075364_10040099 Ga0075364_100400994 58
255 3300006173 Ga0070716_100564558 Ga0070716_1005645582 58
256 3300006175 Ga0070712_100098016 Ga0070712_1000980162 58
257 3300006175 Ga0070712_100736895 Ga0070712_1007368952 58
258 3300006177 Ga0075362_10062304 Ga0075362_100623043 58
259 3300006177 Ga0075362_10191086 Ga0075362_101910863 58
260 3300006177 Ga0075362_10305662 Ga0075362_103056622 58
261 3300006178 Ga0075367_10032918 Ga0075367_100329181 58
262 3300006178 Ga0075367_10165209 Ga0075367_101652093 58
263 3300006178 Ga0075367_10546170 Ga0075367_105461702 58
264 3300006186 Ga0075369_10145910 Ga0075369_101459102 58
265 3300006195 Ga0075366_10155615 Ga0075366_101556152 58
266 3300006237 Ga0097621_100045438 Ga0097621_1000454384 58
267 3300006237 Ga0097621_100097225 Ga0097621_1000972252 58
268 3300006237 Ga0097621_102332976 Ga0097621_1023329762 58
269 3300006353 Ga0075370_10114646 Ga0075370_101146462 58
270 3300006358 Ga0068871_100031318 Ga0068871_1000313183 58
271 3300006358 Ga0068871_100563371 Ga0068871_1005633712 58
272 3300006871 Ga0075434_100207988 Ga0075434_1002079882 58
273 3300006881 Ga0068865_100039829 Ga0068865_1000398293 58
274 3300006881 Ga0068865_100442397 Ga0068865_1004423972 58
275 3300006881 Ga0068865_101867429 Ga0068865_1018674292 58
276 3300006931 Ga0097620_100237229 Ga0097620_1002372292 58
277 3300006931 Ga0097620_102459913 Ga0097620_1024599132 58
278 3300007076 Ga0075435_100040178 Ga0075435_1000401783 58
279 3300007788 Ga0099795_10001567 Ga0099795_100015673 58
280 3300007788 Ga0099795_10333478 Ga0099795_103334781 58
281 3300009011 Ga0105251_10099205 Ga0105251_100992052 58
282 3300009093 Ga0105240_10445166 Ga0105240_104451662 58
283 3300009093 Ga0105240_10696767 Ga0105240_106967672 58
284 3300009094 Ga0111539_11695168 Ga0111539_116951682 58
285 3300009098 Ga0105245_10027787 Ga0105245_100277873 58
286 3300009098 Ga0105245_10266547 Ga0105245_102665473 58
287 3300009101 Ga0105247_10121527 Ga0105247_101215272 58
288 3300009101 Ga0105247_10431196 Ga0105247_104311962 58
289 3300009101 Ga0105247_10981074 Ga0105247_109810742 58
290 3300009148 Ga0105243_10011026 Ga0105243_100110263 58
291 3300009148 Ga0105243_10104731 Ga0105243_101047312 58
292 3300009148 Ga0105243_11376315 Ga0105243_113763152 58
293 3300009148 Ga0105243_12011325 Ga0105243_120113252 58
294 3300009174 Ga0105241_11128652 Ga0105241_111286522 58
295 3300009176 Ga0105242_10483835 Ga0105242_104838352 58
296 3300009176 Ga0105242_10921034 Ga0105242_109210342 58
297 3300009176 Ga0105242_11784149 Ga0105242_117841492 58
298 3300009176 Ga0105242_11855893 Ga0105242_118558932 58
299 3300009176 Ga0105242_11930074 Ga0105242_119300742 58
300 3300009177 Ga0105248_10578130 Ga0105248_105781302 58
301 3300009177 Ga0105248_11000293 Ga0105248_110002932 58
302 3300009177 Ga0105248_12066583 Ga0105248_120665832 58
303 3300009545 Ga0105237_10167236 Ga0105237_101672363 58
304 3300009545 Ga0105237_10412156 Ga0105237_104121562 58
305 3300009545 Ga0105237_11690252 Ga0105237_116902522 58
306 3300009545 Ga0105237_12131593 Ga0105237_121315931 58
307 3300009551 Ga0105238_10380360 Ga0105238_103803602 58
308 3300009551 Ga0105238_10822089 Ga0105238_108220892 58
309 3300009551 Ga0105238_11643913 Ga0105238_116439131 58
310 3300009553 Ga0105249_10071994 Ga0105249_100719943 58
311 3300009553 Ga0105249_12135119 Ga0105249_121351192 58
312 3300010375 Ga0105239_10010954 Ga0105239_100109545 58
313 3300010375 Ga0105239_10120429 Ga0105239_101204293 58
314 3300010375 Ga0105239_10320168 Ga0105239_103201682 58
315 3300010375 Ga0105239_12453475 Ga0105239_124534751 58
316 3300010375 Ga0105239_12647613 Ga0105239_126476132 58
317 3300011119 Ga0105246_10037993 Ga0105246_100379932 58
318 3300013100 Ga0157373_10514487 Ga0157373_105144872 58
319 3300013104 Ga0157370_10034059 Ga0157370_100340595 58
320 3300013296 Ga0157374_10003326 Ga0157374_100033264 58
321 3300013296 Ga0157374_10266765 Ga0157374_102667652 58
322 3300013296 Ga0157374_10721465 Ga0157374_107214652 58
323 3300013297 Ga0157378_10260553 Ga0157378_102605532 58
324 3300013297 Ga0157378_10745098 Ga0157378_107450982 58
325 3300013297 Ga0157378_10793243 Ga0157378_107932432 58
326 3300013297 Ga0157378_10816321 Ga0157378_108163212 58
327 3300013306 Ga0163162_10015168 Ga0163162_100151682 58
328 3300013306 Ga0163162_10055092 Ga0163162_100550923 58
329 3300013306 Ga0163162_10116218 Ga0163162_101162183 58
330 3300013306 Ga0163162_11248021 Ga0163162_112480212 58
331 3300013306 Ga0163162_12015453 Ga0163162_120154532 58
332 3300013308 Ga0157375_10008539 Ga0157375_1000853911 58
333 3300013308 Ga0157375_10114306 Ga0157375_101143063 58
334 3300013308 Ga0157375_10309505 Ga0157375_103095053 58
335 3300013308 Ga0157375_11563643 Ga0157375_115636432 58
336 3300014325 Ga0163163_10007553 Ga0163163_100075534 58
337 3300014325 Ga0163163_10607263 Ga0163163_106072632 58
338 3300014325 Ga0163163_12792390 Ga0163163_127923902 58
339 3300014326 Ga0157380_12592928 Ga0157380_125929282 58
340 3300014745 Ga0157377_10369659 Ga0157377_103696592 58
341 3300014745 Ga0157377_10420363 Ga0157377_104203632 58
342 3300014745 Ga0157377_10426601 Ga0157377_104266012 58
343 3300014968 Ga0157379_10385425 Ga0157379_103854253 58
344 3300014968 Ga0157379_10463328 Ga0157379_104633282 58
345 3300014968 Ga0157379_11760015 Ga0157379_117600152 58
346 3300014969 Ga0157376_10017469 Ga0157376_100174693 58
347 3300014969 Ga0157376_10645767 Ga0157376_106457673 58
348 3300014969 Ga0157376_10768259 Ga0157376_107682592 58
349 3300014969 Ga0157376_10919498 Ga0157376_109194982 58
350 3300017792 Ga0163161_10123768 Ga0163161_101237682 58
351 3300017792 Ga0163161_10779376 Ga0163161_107793762 58
352 3300017792 Ga0163161_11426617 Ga0163161_114266172 58
353 3300025297 Ga0209758_1003142 Ga0209758_100314214 58
354 3300025315 Ga0207697_10062646 Ga0207697_100626462 58
355 3300025321 Ga0207656_10149549 Ga0207656_101495492 58
356 3300025885 Ga0207653_10195040 Ga0207653_101950402 58
357 3300025898 Ga0207692_10587239 Ga0207692_105872391 58
358 3300025899 Ga0207642_10057363 Ga0207642_100573632 58
359 3300025900 Ga0207710_10071000 Ga0207710_100710003 58
360 3300025900 Ga0207710_10292122 Ga0207710_102921222 58
361 3300025901 Ga0207688_10030058 Ga0207688_100300582 58
362 3300025901 Ga0207688_10104915 Ga0207688_101049152 58
363 3300025903 Ga0207680_10259017 Ga0207680_102590172 58
364 3300025903 Ga0207680_10421109 Ga0207680_104211092 58
365 3300025904 Ga0207647_10564080 Ga0207647_105640802 58
366 3300025905 Ga0207685_10078092 Ga0207685_100780922 58
367 3300025906 Ga0207699_10464097 Ga0207699_104640972 58
368 3300025907 Ga0207645_10401305 Ga0207645_104013051 58
369 3300025907 Ga0207645_10821891 Ga0207645_108218911 58
370 3300025908 Ga0207643_10033308 Ga0207643_100333083 58
371 3300025909 Ga0207705_10057990 Ga0207705_100579902 58
372 3300025909 Ga0207705_10113468 Ga0207705_101134682 58
373 3300025909 Ga0207705_10357462 Ga0207705_103574622 58
374 3300025909 Ga0207705_10642038 Ga0207705_106420382 58
375 3300025910 Ga0207684_10575771 Ga0207684_105757711 58
376 3300025911 Ga0207654_10372332 Ga0207654_103723322 58
377 3300025912 Ga0207707_10306841 Ga0207707_103068412 58
378 3300025912 Ga0207707_10798221 Ga0207707_107982211 58
379 3300025913 Ga0207695_10137206 Ga0207695_101372062 58
380 3300025914 Ga0207671_10370802 Ga0207671_103708022 58
381 3300025914 Ga0207671_10424414 Ga0207671_104244142 58
382 3300025915 Ga0207693_10050481 Ga0207693_100504812 58
383 3300025915 Ga0207693_10066564 Ga0207693_100665642 58
384 3300025916 Ga0207663_10867856 Ga0207663_108678562 58
385 3300025917 Ga0207660_10163892 Ga0207660_101638922 58
386 3300025917 Ga0207660_11317332 Ga0207660_113173322 58
387 3300025918 Ga0207662_10143963 Ga0207662_101439632 58
388 3300025919 Ga0207657_10527779 Ga0207657_105277792 58
389 3300025920 Ga0207649_10802599 Ga0207649_108025992 58
390 3300025920 Ga0207649_11052109 Ga0207649_110521092 58
391 3300025921 Ga0207652_10156528 Ga0207652_101565282 58
392 3300025922 Ga0207646_11119044 Ga0207646_111190442 58
393 3300025923 Ga0207681_10337974 Ga0207681_103379742 58
394 3300025923 Ga0207681_11028151 Ga0207681_110281512 58
395 3300025924 Ga0207694_10471411 Ga0207694_104714112 58
396 3300025925 Ga0207650_11098057 Ga0207650_110980572 58
397 3300025927 Ga0207687_10023036 Ga0207687_100230366 58
398 3300025927 Ga0207687_10075061 Ga0207687_100750613 58
399 3300025931 Ga0207644_10119591 Ga0207644_101195912 58
400 3300025932 Ga0207690_10299993 Ga0207690_102999932 58
401 3300025932 Ga0207690_10962236 Ga0207690_109622362 58
402 3300025932 Ga0207690_11162511 Ga0207690_111625112 58
403 3300025933 Ga0207706_10060448 Ga0207706_100604484 58
404 3300025933 Ga0207706_10250929 Ga0207706_102509293 58
405 3300025933 Ga0207706_11242256 Ga0207706_112422562 58
406 3300025933 Ga0207706_11443281 Ga0207706_114432811 58
407 3300025934 Ga0207686_10251825 Ga0207686_102518252 58
408 3300025934 Ga0207686_10760956 Ga0207686_107609562 58
409 3300025934 Ga0207686_10881960 Ga0207686_108819602 58
410 3300025934 Ga0207686_10890236 Ga0207686_108902362 58
411 3300025935 Ga0207709_10028413 Ga0207709_100284133 58
412 3300025935 Ga0207709_10067476 Ga0207709_100674763 58
413 3300025935 Ga0207709_11744745 Ga0207709_117447452 58
414 3300025936 Ga0207670_10048644 Ga0207670_100486443 58
415 3300025936 Ga0207670_10437426 Ga0207670_104374262 58
416 3300025937 Ga0207669_10012350 Ga0207669_100123503 58
417 3300025937 Ga0207669_10042118 Ga0207669_100421183 58
418 3300025937 Ga0207669_11136797 Ga0207669_111367972 58
419 3300025937 Ga0207669_11143130 Ga0207669_111431302 58
420 3300025938 Ga0207704_10042466 Ga0207704_100424662 58
421 3300025938 Ga0207704_10369105 Ga0207704_103691052 58
422 3300025938 Ga0207704_10708282 Ga0207704_107082822 58
423 3300025938 Ga0207704_11429730 Ga0207704_114297302 58
424 3300025939 Ga0207665_10569974 Ga0207665_105699742 58
425 3300025939 Ga0207665_11496642 Ga0207665_114966422 58
426 3300025940 Ga0207691_10059924 Ga0207691_100599243 58
427 3300025940 Ga0207691_10971201 Ga0207691_109712012 58
428 3300025940 Ga0207691_11150710 Ga0207691_111507102 58
429 3300025941 Ga0207711_10518245 Ga0207711_105182452 58
430 3300025941 Ga0207711_11003573 Ga0207711_110035732 58
431 3300025941 Ga0207711_11128492 Ga0207711_111284922 58
432 3300025942 Ga0207689_10075529 Ga0207689_100755292 58
433 3300025942 Ga0207689_10091812 Ga0207689_100918123 58
434 3300025942 Ga0207689_11200102 Ga0207689_112001022 58
435 3300025942 Ga0207689_11684504 Ga0207689_116845042 58
436 3300025944 Ga0207661_10615357 Ga0207661_106153573 58
437 3300025945 Ga0207679_10048953 Ga0207679_100489533 58
438 3300025949 Ga0207667_10010756 Ga0207667_100107564 58
439 3300025949 Ga0207667_10074694 Ga0207667_100746943 58
440 3300025949 Ga0207667_11037481 Ga0207667_110374812 58
441 3300025960 Ga0207651_10072156 Ga0207651_100721562 58
442 3300025960 Ga0207651_10091652 Ga0207651_100916523 58
443 3300025960 Ga0207651_11159675 Ga0207651_111596752 58
444 3300025961 Ga0207712_10057081 Ga0207712_100570813 58
445 3300025961 Ga0207712_10124192 Ga0207712_101241923 58
446 3300025961 Ga0207712_11806335 Ga0207712_118063352 58
447 3300025972 Ga0207668_10019967 Ga0207668_100199673 58
448 3300025972 Ga0207668_10036022 Ga0207668_100360223 58
449 3300025972 Ga0207668_10290683 Ga0207668_102906832 58
450 3300025972 Ga0207668_10767587 Ga0207668_107675872 58
451 3300025972 Ga0207668_11650731 Ga0207668_116507312 58
452 3300025972 Ga0207668_11651264 Ga0207668_116512642 58
453 3300025981 Ga0207640_10284821 Ga0207640_102848212 58
454 3300025986 Ga0207658_10317607 Ga0207658_103176072 58
455 3300025986 Ga0207658_10903315 Ga0207658_109033152 58
456 3300025986 Ga0207658_11080908 Ga0207658_110809082 58
457 3300025986 Ga0207658_12145365 Ga0207658_121453651 58
458 3300026023 Ga0207677_10011044 Ga0207677_100110443 58
459 3300026023 Ga0207677_10091669 Ga0207677_100916692 58
460 3300026023 Ga0207677_10424507 Ga0207677_104245072 58
461 3300026023 Ga0207677_11001803 Ga0207677_110018032 58
462 3300026035 Ga0207703_10075453 Ga0207703_100754534 58
463 3300026035 Ga0207703_10489198 Ga0207703_104891982 58
464 3300026035 Ga0207703_11888044 Ga0207703_118880442 58
465 3300026041 Ga0207639_10127272 Ga0207639_101272722 58
466 3300026041 Ga0207639_10408168 Ga0207639_104081682 58
467 3300026041 Ga0207639_11840782 Ga0207639_118407822 58
468 3300026067 Ga0207678_10010552 Ga0207678_100105523 58
469 3300026067 Ga0207678_10022770 Ga0207678_100227706 58
470 3300026067 Ga0207678_10203891 Ga0207678_102038913 58
471 3300026067 Ga0207678_10585696 Ga0207678_105856962 58
472 3300026067 Ga0207678_10737917 Ga0207678_107379172 58
473 3300026075 Ga0207708_10184300 Ga0207708_101843002 58
474 3300026078 Ga0207702_10628896 Ga0207702_106288962 58
475 3300026078 Ga0207702_11008951 Ga0207702_110089512 58
476 3300026078 Ga0207702_11251691 Ga0207702_112516912 58
477 3300026088 Ga0207641_10062468 Ga0207641_100624683 58
478 3300026088 Ga0207641_11298147 Ga0207641_112981472 58
479 3300026089 Ga0207648_10197558 Ga0207648_101975583 58
480 3300026089 Ga0207648_10307061 Ga0207648_103070612 58
481 3300026095 Ga0207676_12208683 Ga0207676_122086832 58
482 3300026116 Ga0207674_10111119 Ga0207674_101111192 58
483 3300026118 Ga0207675_100101117 Ga0207675_1001011173 58
484 3300026118 Ga0207675_100111822 Ga0207675_1001118223 58
485 3300026118 Ga0207675_100199723 Ga0207675_1001997233 58
486 3300026118 Ga0207675_100437879 Ga0207675_1004378792 58
487 3300026121 Ga0207683_10014660 Ga0207683_100146605 58
488 3300026121 Ga0207683_10044880 Ga0207683_100448803 58
489 3300026121 Ga0207683_11014122 Ga0207683_110141222 58
490 3300026121 Ga0207683_12039011 Ga0207683_120390111 58
491 3300026142 Ga0207698_10102309 Ga0207698_101023092 58
492 3300026142 Ga0207698_10282368 Ga0207698_102823682 58
493 3300026142 Ga0207698_10716743 Ga0207698_107167432 58
494 3300027866 Ga0209813_10356145 Ga0209813_103561452 58
495 3300028379 Ga0268266_10019219 Ga0268266_100192195 58
496 3300028379 Ga0268266_10073912 Ga0268266_100739124 58
497 3300028380 Ga0268265_10791409 Ga0268265_107914092 58
498 3300028380 Ga0268265_10927281 Ga0268265_109272812 58
499 3300028380 Ga0268265_11356582 Ga0268265_113565822 58
500 3300028381 Ga0268264_10257991 Ga0268264_102579912 58
501 3300028381 Ga0268264_11786333 Ga0268264_117863332 58
502 3300028786 Ga0307517_10308361 Ga0307517_103083612 58
503 3300028794 Ga0307515_10393531 Ga0307515_103935312 58
504 3300030521 Ga0307511_10210668 Ga0307511_102106682 58
505 3300031456 Ga0307513_10193775 Ga0307513_101937753 58
506 3300031507 Ga0307509_10272187 Ga0307509_102721872 58
507 3300031616 Ga0307508_10565863 Ga0307508_105658632 58
508 3300031711 Ga0265314_10548549 Ga0265314_105485492 58
509 3300031730 Ga0307516_10213055 Ga0307516_102130553 58
510 3300032126 Ga0307415_100020263 Ga0307415_1000202633 58
511 3300033179 Ga0307507_10596065 Ga0307507_105960652 58
512 3300033180 Ga0307510_10009746 Ga0307510_100097469 58
513 3300034820 Ga0373959_0017186 Ga0373959_0017186_14_190 58
514 3300035111 Ga0373923_0000827 Ga0373923_0000827_1621_1803 58
515 3300035113 Ga0373936_0041112 Ga0373936_0041112_162_338 58
516 3300035117 Ga0373953_0002753 Ga0373953_0002753_328_510 58
517 3300035118 Ga0373954_0000634 Ga0373954_0000634_122_304 58
518 3300035118 Ga0373954_0036508 Ga0373954_0036508_1864_2046 58
519 3300035119 Ga0373956_0001884 Ga0373956_0001884_8103_8285 58
520 3300035120 Ga0373957_0000200 Ga0373957_0000200_3139_3321 58
521 3300035172 Ga0373955_0005004 Ga0373955_0005004_5411_5593 58
522 3300035410 Ga0373924_0052392 Ga0373924_0052392_406_588 58
523 3300035724 Ga0373933_0002159 Ga0373933_0002159_148_330 58
524 3300035724 Ga0373933_0831574 Ga0373933_0831574_190_366 58
525 3300036401 Ga0373937_0014785 Ga0373937_0014785_1147_1329 58
526 3300037068 Ga0373925_1009403 Ga0373925_1009403_455_631 58
527 3300041441 Ga0451787_030782 Ga0451787_030782_390_566 58
528 3300041441 Ga0451787_437186 Ga0451787_437186_294_470 58
529 3300041443 Ga0451789_0439858 Ga0451789_0439858_257_433 58
530 3300041451 Ga0451791_1349316 Ga0451791_1349316_312_488 58
531 3300041452 Ga0451793_0751178 Ga0451793_0751178_45_221 58
532 3300041453 Ga0451797_0172161 Ga0451797_0172161_395_571 58
533 3300041456 Ga0451795_1524981 Ga0451795_1524981_103_279 58
534 3300041458 Ga0451798_1057041 Ga0451798_1057041_293_469 58
535 3300041459 Ga0451800_1604853 Ga0451800_1604853_85_261 58
536 3300041460 Ga0451802_0019777 Ga0451802_0019777_14_190 58
537 3300041460 Ga0451802_0304564 Ga0451802_0304564_259_435 58
538 3300041486 Ga0451807_1607086 Ga0451807_1607086_138_314 58
539 3300041491 Ga0451833_1216072 Ga0451833_1216072_372_548 58
540 3300041501 Ga0451845_0985256 Ga0451845_0985256_357_533 58
541 3300041507 Ga0451851_1322556 Ga0451851_1322556_136_312 58
542 3300041509 Ga0451843_0728618 Ga0451843_0728618_187_363 58
543 3300041512 Ga0451853_1746509 Ga0451853_1746509_521_697 58
544 3300041512 Ga0451853_1810983 Ga0451853_1810983_102_278 58
545 3300041512 Ga0451853_4067572 Ga0451853_4067572_318_494 58
546 3300046452 Ga0495617_019330 Ga0495617_019330_782_958 58
547 3300046453 Ga0495627_098214 Ga0495627_098214_25_201 58
548 3300046454 Ga0495592_0002897 Ga0495592_0002897_7946_8128 58
549 3300046455 Ga0495603_0017151 Ga0495603_0017151_947_1123 58
550 3300046455 Ga0495603_0031419 Ga0495603_0031419_260_436 58
551 3300046455 Ga0495603_0238001 Ga0495603_0238001_602_778 58
552 3300046455 Ga0495603_0399053 Ga0495603_0399053_562_738 58
553 3300046457 Ga0495590_0035683 Ga0495590_0035683_131_307 58
554 3300046458 Ga0495591_057252 Ga0495591_057252_830_1006 58
555 3300046459 Ga0495629_0002158 Ga0495629_0002158_2078_2260 58
556 3300046459 Ga0495629_0682498 Ga0495629_0682498_68_244 58
557 3300046459 Ga0495629_0755711 Ga0495629_0755711_95_271 58
558 3300046460 Ga0495638_0131924 Ga0495638_0131924_696_872 58
559 3300046460 Ga0495638_0343294 Ga0495638_0343294_199_375 58
560 3300046461 Ga0495641_0295354 Ga0495641_0295354_157_333 58
561 3300046462 Ga0495651_0101857 Ga0495651_0101857_1622_1804 58
562 3300046463 Ga0495653_0017446 Ga0495653_0017446_778_960 58
563 3300046471 Ga0495650_0146812 Ga0495650_0146812_370_546 58
564 3300046473 Ga0495582_0201669 Ga0495582_0201669_40_216 58
565 3300046473 Ga0495582_0535426 Ga0495582_0535426_228_404 58
566 3300046474 Ga0495605_0191943 Ga0495605_0191943_538_714 58
567 3300046475 Ga0495639_0189724 Ga0495639_0189724_55_231 58
568 3300046476 Ga0495662_0050496 Ga0495662_0050496_1441_1617 58
569 3300046477 Ga0495664_0136401 Ga0495664_0136401_1009_1185 58
570 3300046477 Ga0495664_0870317 Ga0495664_0870317_39_215 58
571 3300046491 Ga0495584_0368802 Ga0495584_0368802_224_400 58
572 3300046492 Ga0495585_0019025 Ga0495585_0019025_1228_1404 58
573 3300046499 Ga0495594_0499582 Ga0495594_0499582_401_577 58
574 3300046500 Ga0495596_0152289 Ga0495596_0152289_188_364 58
575 3300046501 Ga0495607_0072805 Ga0495607_0072805_391_567 58
576 3300046506 Ga0495583_0087005 Ga0495583_0087005_196_372 58
577 3300046507 Ga0495606_0104556 Ga0495606_0104556_1283_1459 58
578 3300046507 Ga0495606_0151584 Ga0495606_0151584_546_722 58
579 3300046507 Ga0495606_0189315 Ga0495606_0189315_208_384 58
580 3300046511 Ga0495608_0002218 Ga0495608_0002218_13370_13552 58
581 3300046512 Ga0495610_0121293 Ga0495610_0121293_607_783 58
582 3300046513 Ga0495616_0370522 Ga0495616_0370522_40_216 58
583 3300046515 Ga0495620_0070690 Ga0495620_0070690_440_616 58
584 3300046516 Ga0495628_0038487 Ga0495628_0038487_3306_3488 58
585 3300046518 Ga0495631_0229711 Ga0495631_0229711_351_527 58
586 3300046522 Ga0495643_0287355 Ga0495643_0287355_430_606 58
587 3300046522 Ga0495643_0481943 Ga0495643_0481943_252_428 58
588 3300046523 Ga0495644_0097550 Ga0495644_0097550_272_448 58
589 3300046524 Ga0495648_0095285 Ga0495648_0095285_306_482 58
590 3300046525 Ga0495663_0153991 Ga0495663_0153991_578_754 58
591 3300046528 Ga0495642_0175473 Ga0495642_0175473_572_748 58
592 3300046529 Ga0495652_0038809 Ga0495652_0038809_3291_3473 58
593 3300046530 Ga0495654_0065774 Ga0495654_0065774_313_489 58
594 3300046531 Ga0495665_0604613 Ga0495665_0604613_282_458 58
595 3300046533 Ga0495640_0005616 Ga0495640_0005616_3343_3525 58
596 3300046536 Ga0495587_0025519 Ga0495587_0025519_638_820 58
597 3300046536 Ga0495587_0824488 Ga0495587_0824488_100_276 58
598 3300046537 Ga0495598_0145952 Ga0495598_0145952_80_256 58
599 3300046537 Ga0495598_0169757 Ga0495598_0169757_240_416 58
600 3300046538 Ga0495609_0029965 Ga0495609_0029965_47_223 58
601 3300046542 Ga0495597_0066671 Ga0495597_0066671_777_953 58
602 3300046543 Ga0495645_0213847 Ga0495645_0213847_508_690 58
603 3300046543 Ga0495645_0784040 Ga0495645_0784040_85_261 58
604 3300046557 Ga0495622_0005946 Ga0495622_0005946_988_1164 58
605 3300046558 Ga0495633_0217864 Ga0495633_0217864_501_677 58
606 3300046559 Ga0495667_0009980 Ga0495667_0009980_3500_3682 58
607 3300046615 Ga0495656_0068283 Ga0495656_0068283_918_1094 58
608 3300046615 Ga0495656_0125502 Ga0495656_0125502_37_213 58
609 3300046615 Ga0495656_0151554 Ga0495656_0151554_550_726 58
610 3300046616 Ga0495668_0070449 Ga0495668_0070449_1166_1342 58
611 3300046616 Ga0495668_0260170 Ga0495668_0260170_304_480 58
612 3300046642 Ga0495634_0034579 Ga0495634_0034579_2791_2973 58
613 3300046642 Ga0495634_0874064 Ga0495634_0874064_88_264 58
614 3300046648 Ga0495611_0229269 Ga0495611_0229269_590_766 58
615 3300046663 Ga0495635_0001058 Ga0495635_0001058_4742_4924 58
616 3300046663 Ga0495635_0653495 Ga0495635_0653495_313_489 58
617 3300046674 Ga0495588_0289516 Ga0495588_0289516_74_250 58
618 3300046674 Ga0495588_0630690 Ga0495588_0630690_374_550 58
619 3300046675 Ga0495657_0011523 Ga0495657_0011523_4743_4925 58
620 3300046678 Ga0495599_0003523 Ga0495599_0003523_1413_1595 58
621 3300046679 Ga0495623_0006259 Ga0495623_0006259_650_832 58
622 3300046680 Ga0495646_0000934 Ga0495646_0000934_2708_2890 58
623 3300046684 Ga0495669_0003832 Ga0495669_0003832_1616_1792 58
624 3300046684 Ga0495669_0584821 Ga0495669_0584821_155_331 58
625 3300046690 Ga0495624_0612487 Ga0495624_0612487_320_496 58
626 3300046694 Ga0495649_0257830 Ga0495649_0257830_500_676 58
627 3300046794 Ga0495589_0384953 Ga0495589_0384953_201_377 58
628 3300046794 Ga0495589_0405868 Ga0495589_0405868_430_606 58
629 3300046809 Ga0495600_0001795 Ga0495600_0001795_11038_11220 58
630 3300046809 Ga0495600_0586700 Ga0495600_0586700_299_475 58
631 3300047315 Ga0495581_0523461 Ga0495581_0523461_253_429 58
632 3300047315 Ga0495581_0637219 Ga0495581_0637219_222_398 58
633 3300047315 Ga0495581_0670891 Ga0495581_0670891_397_573 58
634 3300047315 Ga0495581_0858503 Ga0495581_0858503_54_230 58
635 3300047317 Ga0495604_0091763 Ga0495604_0091763_657_839 58
636 3300047317 Ga0495604_0864322 Ga0495604_0864322_321_497 58
637 3300047319 Ga0495674_0007182 Ga0495674_0007182_10262_10444 58
638 3300047320 Ga0495672_0046495 Ga0495672_0046495_1087_1263 58
639 3300047320 Ga0495672_0420365 Ga0495672_0420365_395_571 58
640 3300047321 Ga0495676_0304106 Ga0495676_0304106_719_895 58
641 3300047321 Ga0495676_0325429 Ga0495676_0325429_296_472 58
642 3300047321 Ga0495676_1101575 Ga0495676_1101575_251_427 58
643 3300047322 Ga0495680_0233868 Ga0495680_0233868_469_651 58
644 3300047323 Ga0495683_0104787 Ga0495683_0104787_696_872 58
645 3300047444 Ga0495675_0002644 Ga0495675_0002644_111_293 58
646 3300047444 Ga0495675_0004307 Ga0495675_0004307_8185_8367 58
647 3300047445 Ga0495677_0124151 Ga0495677_0124151_386_562 58
648 3300047445 Ga0495677_0156220 Ga0495677_0156220_509_685 58
649 3300047446 Ga0495679_099085 Ga0495679_099085_68_244 58
650 3300047447 Ga0495685_090611 Ga0495685_090611_288_464 58
651 3300047447 Ga0495685_130572 Ga0495685_130572_609_785 58
652 3300047469 Ga0495673_0160260 Ga0495673_0160260_548_724 58
653 3300047471 Ga0495684_0016173 Ga0495684_0016173_5400_5582 58
654 3300047472 Ga0495686_0065615 Ga0495686_0065615_1156_1332 58
655 3300047472 Ga0495686_0269147 Ga0495686_0269147_570_746 58
656 3300047472 Ga0495686_0400024 Ga0495686_0400024_441_617 58
657 3300047673 Ga0495593_0007370 Ga0495593_0007370_1902_2084 58
658 3300047673 Ga0495593_0329846 Ga0495593_0329846_66_242 58
659 3300048088 Ga0495602_0048110 Ga0495602_0048110_778_960 58
660 3300048090 Ga0495615_0018636 Ga0495615_0018636_756_932 58
661 3300048091 Ga0495626_0179278 Ga0495626_0179278_246_422 58
662 3300048903 Ga0496100_0009207 Ga0496100_0009207_5142_5318 58
663 3300048903 Ga0496100_0035542 Ga0496100_0035542_2225_2401 58
664 3300048903 Ga0496100_0193147 Ga0496100_0193147_846_1022 58
665 3300048903 Ga0496100_0347828 Ga0496100_0347828_50_226 58
666 3300048903 Ga0496100_0863678 Ga0496100_0863678_315_491 58
667 3300048904 Ga0496101_0000875 Ga0496101_0000875_4364_4540 58
668 3300048904 Ga0496101_0176638 Ga0496101_0176638_144_320 58
669 3300048904 Ga0496101_0227712 Ga0496101_0227712_148_324 58
670 3300048905 Ga0496102_0009695 Ga0496102_0009695_5010_5186 58
671 3300048905 Ga0496102_0248458 Ga0496102_0248458_728_904 58
672 3300048905 Ga0496102_0564003 Ga0496102_0564003_476_652 58
673 3300048906 Ga0496103_0006163 Ga0496103_0006163_3546_3722 58
674 3300048906 Ga0496103_0364652 Ga0496103_0364652_240_416 58
675 3300048906 Ga0496103_0759658 Ga0496103_0759658_74_250 58
676 3300048907 Ga0496104_0036083 Ga0496104_0036083_2279_2455 58
677 3300048907 Ga0496104_0879326 Ga0496104_0879326_46_222 58
678 3300048907 Ga0496104_0894838 Ga0496104_0894838_339_515 58
679 3300048908 Ga0496105_0017743 Ga0496105_0017743_3256_3432 58
680 3300048908 Ga0496105_0668324 Ga0496105_0668324_354_530 58
681 3300048909 Ga0496106_0016638 Ga0496106_0016638_3992_4168 58
682 3300048909 Ga0496106_0320307 Ga0496106_0320307_11_187 58
683 3300048909 Ga0496106_0375713 Ga0496106_0375713_717_893 58
684 3300048909 Ga0496106_0516371 Ga0496106_0516371_303_479 58
685 3300048909 Ga0496106_0533776 Ga0496106_0533776_244_420 58
686 3300048909 Ga0496106_0787576 Ga0496106_0787576_188_364 58
687 3300048910 Ga0496107_0015387 Ga0496107_0015387_997_1173 58
688 3300048910 Ga0496107_0255773 Ga0496107_0255773_729_905 58
689 3300048910 Ga0496107_0406021 Ga0496107_0406021_821_997 58
690 3300048910 Ga0496107_0686432 Ga0496107_0686432_264_440 58
691 3300048910 Ga0496107_0978125 Ga0496107_0978125_224_400 58
692 3300048911 Ga0496108_0002192 Ga0496108_0002192_5984_6160 58
693 3300048911 Ga0496108_0330641 Ga0496108_0330641_724_900 58
694 3300048911 Ga0496108_1590037 Ga0496108_1590037_149_325 58
695 3300048912 Ga0496109_0010462 Ga0496109_0010462_4634_4810 58
696 3300048912 Ga0496109_0079860 Ga0496109_0079860_1185_1361 58
697 3300048912 Ga0496109_0189821 Ga0496109_0189821_701_877 58
698 3300048912 Ga0496109_0316599 Ga0496109_0316599_345_521 58
699 3300048913 Ga0496110_0026863 Ga0496110_0026863_1196_1372 58
700 3300048913 Ga0496110_0599451 Ga0496110_0599451_370_546 58
701 3300048914 Ga0496111_0018238 Ga0496111_0018238_3565_3765 58
702 3300048914 Ga0496111_0037599 Ga0496111_0037599_2026_2202 58
703 3300048914 Ga0496111_0211959 Ga0496111_0211959_1007_1183 58
704 3300048915 Ga0496112_0016391 Ga0496112_0016391_1054_1230 58
705 3300048915 Ga0496112_0018840 Ga0496112_0018840_364_540 58
706 3300048915 Ga0496112_1690878 Ga0496112_1690878_98_298 58
707 3300048916 Ga0496113_0001312 Ga0496113_0001312_10437_10613 58
708 3300048916 Ga0496113_0082648 Ga0496113_0082648_1330_1530 58
709 3300048916 Ga0496113_0405020 Ga0496113_0405020_556_732 58
710 3300048916 Ga0496113_0610121 Ga0496113_0610121_508_684 58
711 3300048917 Ga0496114_0004461 Ga0496114_0004461_6786_6962 58
712 3300048917 Ga0496114_0227293 Ga0496114_0227293_1125_1301 58
713 3300048917 Ga0496114_0263839 Ga0496114_0263839_355_531 58
714 3300048917 Ga0496114_0544542 Ga0496114_0544542_477_653 58
715 3300048918 Ga0496115_0009478 Ga0496115_0009478_1727_1903 58
716 3300048918 Ga0496115_0039849 Ga0496115_0039849_2313_2489 58
717 3300048918 Ga0496115_0792938 Ga0496115_0792938_337_513 58
718 3300048918 Ga0496115_0948707 Ga0496115_0948707_127_303 58
719 3300048918 Ga0496115_1450641 Ga0496115_1450641_218_394 58
720 3300048919 Ga0496116_0108802 Ga0496116_0108802_256_432 58
721 3300048920 Ga0496117_0290918 Ga0496117_0290918_598_774 58
722 3300048920 Ga0496117_0329210 Ga0496117_0329210_444_620 58
723 3300048921 Ga0496118_0562123 Ga0496118_0562123_164_340 58
724 3300048922 Ga0496119_0308491 Ga0496119_0308491_592_768 58
725 3300048922 Ga0496119_0541226 Ga0496119_0541226_145_321 58
726 3300048923 Ga0496120_0492318 Ga0496120_0492318_129_305 58
727 3300048924 Ga0496121_0000330 Ga0496121_0000330_45718_45894 58
728 3300048924 Ga0496121_0117819 Ga0496121_0117819_1578_1754 58
729 3300048924 Ga0496121_0228466 Ga0496121_0228466_1053_1229 58
730 3300048924 Ga0496121_0361152 Ga0496121_0361152_217_393 58
731 3300048924 Ga0496121_0394458 Ga0496121_0394458_397_573 58
732 3300048924 Ga0496121_0455971 Ga0496121_0455971_165_341 58
733 3300048924 Ga0496121_0487080 Ga0496121_0487080_95_271 58
734 3300048927 Ga0496124_0221282 Ga0496124_0221282_1069_1245 58
735 3300048927 Ga0496124_0624549 Ga0496124_0624549_59_235 58
736 3300048927 Ga0496124_0670127 Ga0496124_0670127_275_451 58
737 3300048928 Ga0496125_0200197 Ga0496125_0200197_87_263 58
738 3300048928 Ga0496125_0326519 Ga0496125_0326519_588_764 58
739 3300048928 Ga0496125_0503762 Ga0496125_0503762_342_518 58
740 3300048928 Ga0496125_0637333 Ga0496125_0637333_40_216 58
741 3300048929 Ga0496126_0004961 Ga0496126_0004961_7013_7189 58
742 3300048929 Ga0496126_0141728 Ga0496126_0141728_1239_1415 58
743 3300048929 Ga0496126_0508953 Ga0496126_0508953_576_752 58
744 3300048929 Ga0496126_0803743 Ga0496126_0803743_170_346 58
745 3300048929 Ga0496126_0911493 Ga0496126_0911493_385_561 58
746 3300048929 Ga0496126_1379753 Ga0496126_1379753_244_420 58
747 3300049460 Ga0495682_0163941 Ga0495682_0163941_307_483 58
748 3300049571 Ga0501034_0317047 Ga0501034_0317047_1232_1408 58
749 3300050489 nmdc:mga03683_130945_c1 nmdc:mga03683_130945_c1_823_999 58
750 3300050490 nmdc:mga03n38_576503_c1 nmdc:mga03n38_576503_c1_444_620 58
751 3300050490 nmdc:mga03n38_641608_c1 nmdc:mga03n38_641608_c1_419_595 58
752 3300050491 nmdc:mga00v17_355964_c1 nmdc:mga00v17_355964_c1_688_864 58
753 3300050492 nmdc:mga0yw44_1187532_c1 nmdc:mga0yw44_1187532_c1_205_381 58
754 3300050492 nmdc:mga0yw44_162553_c1 nmdc:mga0yw44_162553_c1_756_932 58
755 3300050492 nmdc:mga0yw44_259422_c1 nmdc:mga0yw44_259422_c1_773_949 58
756 3300050492 nmdc:mga0yw44_945852_c1 nmdc:mga0yw44_945852_c1_87_263 58
757 3300050493 nmdc:mga0k408_133036_c1 nmdc:mga0k408_133036_c1_515_691 58
758 3300050494 nmdc:mga06z11_160840_c1 nmdc:mga06z11_160840_c1_373_549 58
759 3300050494 nmdc:mga06z11_779412_c1 nmdc:mga06z11_779412_c1_343_519 58
760 3300050494 nmdc:mga06z11_832089_c1 nmdc:mga06z11_832089_c1_183_359 58
761 3300050496 nmdc:mga07m45_506050_c1 nmdc:mga07m45_506050_c1_63_239 58
762 3300050511 nmdc:mga08y16_1965971_c1 nmdc:mga08y16_1965971_c1_116_292 58
763 3300050516 nmdc:mga0sz30_179116_c1 nmdc:mga0sz30_179116_c1_159_335 58
764 3300053077 Ga0495601_0016288 Ga0495601_0016288_3569_3751 58
765 3300053080 Ga0500635_0418585 Ga0500635_0418585_289_465 58
766 3300053080 Ga0500635_0425954 Ga0500635_0425954_219_395 58
767 3300053083 Ga0495655_0004786 Ga0495655_0004786_1174_1350 58
768 3300053084 Ga0495595_0000335 Ga0495595_0000335_13108_13290 58
769 3300053085 Ga0495619_0001292 Ga0495619_0001292_4184_4366 58
770 3300053088 Ga0500644_0516922 Ga0500644_0516922_80_256 58
771 3300053092 Ga0500583_0068458 Ga0500583_0068458_998_1174 58
772 3300053093 Ga0500651_0323447 Ga0500651_0323447_196_372 58
773 3300053094 Ga0500566_0011427 Ga0500566_0011427_2211_2387 58
774 3300053094 Ga0500566_0493869 Ga0500566_0493869_157_333 58
775 3300053095 Ga0500640_215211 Ga0500640_215211_350_526 58
776 3300053096 Ga0500641_0032365 Ga0500641_0032365_1333_1509 58
777 3300053096 Ga0500641_0223095 Ga0500641_0223095_425_601 58
778 3300053102 Ga0500554_018197 Ga0500554_018197_951_1127 58
779 3300053103 Ga0500555_139554 Ga0500555_139554_160_336 58
780 3300053104 Ga0500556_0047237 Ga0500556_0047237_1046_1222 58
781 3300053108 Ga0500562_063611 Ga0500562_063611_781_957 58
782 3300053109 Ga0500569_326036 Ga0500569_326036_15_191 58
783 3300053116 Ga0500592_089901 Ga0500592_089901_164_340 58
784 3300053118 Ga0500594_0196453 Ga0500594_0196453_230_406 58
785 3300053118 Ga0500594_0230160 Ga0500594_0230160_176_352 58
786 3300053119 Ga0500595_000468 Ga0500595_000468_10870_11046 58
787 3300053119 Ga0500595_013495 Ga0500595_013495_1673_1849 58
788 3300053119 Ga0500595_025974 Ga0500595_025974_754_930 58
789 3300053124 Ga0500617_208270 Ga0500617_208270_15_191 58
790 3300053130 Ga0500642_0112653 Ga0500642_0112653_694_870 58
791 3300053133 Ga0500655_058888 Ga0500655_058888_239_415 58
792 3300053134 Ga0500658_0130238 Ga0500658_0130238_145_321 58
793 3300053136 Ga0500559_0145617 Ga0500559_0145617_156_332 58
794 3300053137 Ga0500561_0204129 Ga0500561_0204129_407_583 58
795 3300053139 Ga0500568_0003017 Ga0500568_0003017_4329_4505 58
796 3300053139 Ga0500568_0300981 Ga0500568_0300981_39_215 58
797 3300053146 Ga0500588_0303387 Ga0500588_0303387_262_438 58
798 3300053147 Ga0500589_111338 Ga0500589_111338_297_473 58
799 3300053147 Ga0500589_307102 Ga0500589_307102_86_262 58
800 3300053148 Ga0500590_210120 Ga0500590_210120_16_192 58
801 3300053150 Ga0500603_161253 Ga0500603_161253_355_531 58
802 3300053151 Ga0500604_0317164 Ga0500604_0317164_163_339 58
803 3300053156 Ga0500622_0125384 Ga0500622_0125384_27_203 58
804 3300053156 Ga0500622_0217827 Ga0500622_0217827_618_794 58
805 3300053158 Ga0500627_0131079 Ga0500627_0131079_765_941 58
806 3300053161 Ga0500634_0306566 Ga0500634_0306566_145_321 58
807 3300053162 Ga0500638_002107 Ga0500638_002107_3034_3210 58
808 3300053162 Ga0500638_068294 Ga0500638_068294_236_412 58
809 3300053177 Ga0500636_0164781 Ga0500636_0164781_79_255 58
810 3300053178 Ga0500637_0000546 Ga0500637_0000546_14169_14345 58
811 3300053178 Ga0500637_0064084 Ga0500637_0064084_347_526 58
812 3300053178 Ga0500637_0171751 Ga0500637_0171751_732_908 58
813 3300053727 Ga0500611_141671 Ga0500611_141671_398_574 58
814 3300053731 Ga0500609_028950 Ga0500609_028950_380_556 58
815 3300053732 Ga0500656_003876 Ga0500656_003876_485_661 58
816 3300053735 Ga0500596_070711 Ga0500596_070711_146_322 58
817 3300054114 Ga0501084_0203487 Ga0501084_0203487_809_985 58
818 3300055283 Ga0500661_000782 Ga0500661_000782_2000_2176 58
819 3300060353 Ga0501082_0013785 Ga0501082_0013785_4973_5149 58
820 3300005337 Ga0070682_101350930 Ga0070682_1013509302 59
821 3300005437 Ga0070710_10080672 Ga0070710_100806722 59
822 3300005439 Ga0070711_100111738 Ga0070711_1001117383 59
823 3300005983 Ga0081540_1002582 Ga0081540_100258210 59
824 3300006028 Ga0070717_10651567 Ga0070717_106515672 59
825 3300006173 Ga0070716_101130306 Ga0070716_1011303062 59
826 3300006175 Ga0070712_100452239 Ga0070712_1004522392 59
827 3300013104 Ga0157370_11088082 Ga0157370_110880822 59
828 3300025898 Ga0207692_10090497 Ga0207692_100904972 59
829 3300025906 Ga0207699_10011455 Ga0207699_100114554 59
830 3300025915 Ga0207693_10031699 Ga0207693_100316992 59
831 3300025916 Ga0207663_10021008 Ga0207663_100210085 59
832 3300025928 Ga0207700_10043969 Ga0207700_100439693 59
833 3300025939 Ga0207665_10376901 Ga0207665_103769012 59
834 3300030763 Ga0265763_1028070 Ga0265763_10280702 59
835 3300031090 Ga0265760_10293071 Ga0265760_102930712 59
836 3300031238 Ga0265332_10369523 Ga0265332_103695232 59
837 3300031250 Ga0265331_10030702 Ga0265331_100307023 59
838 3300031711 Ga0265314_10059242 Ga0265314_100592423 59
839 3300031712 Ga0265342_10010007 Ga0265342_100100073 59
840 3300046462 Ga0495651_0057664 Ga0495651_0057664_398_577 59
841 3300046477 Ga0495664_0304389 Ga0495664_0304389_481_660 59
842 3300046511 Ga0495608_0882922 Ga0495608_0882922_308_487 59
843 3300046529 Ga0495652_0309464 Ga0495652_0309464_212_391 59
844 3300046543 Ga0495645_0251676 Ga0495645_0251676_15_194 59
845 3300046642 Ga0495634_0762418 Ga0495634_0762418_345_524 59
846 3300046678 Ga0495599_0163130 Ga0495599_0163130_19_198 59
847 3300046679 Ga0495623_0023756 Ga0495623_0023756_400_579 59
848 3300046680 Ga0495646_0125268 Ga0495646_0125268_979_1158 59
849 3300046689 Ga0495613_0306306 Ga0495613_0306306_500_679 59
850 3300046809 Ga0495600_0319738 Ga0495600_0319738_438_617 59
851 3300047317 Ga0495604_0014661 Ga0495604_0014661_2418_2597 59
852 3300047319 Ga0495674_0943608 Ga0495674_0943608_183_362 59
853 3300048088 Ga0495602_0027742 Ga0495602_0027742_2372_2551 59
854 3300001904 JGI24736J21556_1069384 JGI24736J21556_10693841 60
855 3300001989 JGI24739J22299_10113909 JGI24739J22299_101139092 60
856 3300002067 JGI24735J21928_10002229 JGI24735J21928_100022294 60
857 3300005327 Ga0070658_10002866 Ga0070658_100028663 60
858 3300005327 Ga0070658_10116973 Ga0070658_101169733 60
859 3300005339 Ga0070660_100064724 Ga0070660_1000647244 60
860 3300005344 Ga0070661_100202483 Ga0070661_1002024832 60
861 3300005344 Ga0070661_101196721 Ga0070661_1011967212 60
862 3300005366 Ga0070659_100032739 Ga0070659_1000327394 60
863 3300005458 Ga0070681_11890369 Ga0070681_118903692 60
864 3300005539 Ga0068853_100206278 Ga0068853_1002062783 60
865 3300005563 Ga0068855_100036502 Ga0068855_1000365024 60
866 3300005563 Ga0068855_100037055 Ga0068855_1000370555 60
867 3300005563 Ga0068855_100778579 Ga0068855_1007785792 60
868 3300005614 Ga0068856_100662677 Ga0068856_1006626772 60
869 3300005617 Ga0068859_100986570 Ga0068859_1009865702 60
870 3300006931 Ga0097620_100986525 Ga0097620_1009865252 60
871 3300009093 Ga0105240_10381267 Ga0105240_103812672 60
872 3300009093 Ga0105240_12057348 Ga0105240_120573482 60
873 3300009174 Ga0105241_10302898 Ga0105241_103028982 60
874 3300009545 Ga0105237_10099940 Ga0105237_100999403 60
875 3300009545 Ga0105237_11103806 Ga0105237_111038062 60
876 3300009551 Ga0105238_10189353 Ga0105238_101893532 60
877 3300010375 Ga0105239_13516621 Ga0105239_135166211 60
878 3300013104 Ga0157370_10016923 Ga0157370_100169235 60
879 3300013104 Ga0157370_10038959 Ga0157370_100389593 60
880 3300013105 Ga0157369_10000362 Ga0157369_100003627 60
881 3300013307 Ga0157372_10234078 Ga0157372_102340783 60
882 3300013307 Ga0157372_11808161 Ga0157372_118081612 60
883 3300020069 Ga0197907_10425857 Ga0197907_104258572 60
884 3300020070 Ga0206356_11624406 Ga0206356_116244062 60
885 3300020080 Ga0206350_10387633 Ga0206350_103876331 60
886 3300020081 Ga0206354_10084247 Ga0206354_100842471 60
887 3300020082 Ga0206353_10739046 Ga0206353_107390462 60
888 3300022467 Ga0224712_10000787 Ga0224712_100007873 60
889 3300025228 Ga0209672_100948 Ga0209672_1009488 60
890 3300025256 Ga0209759_1001867 Ga0209759_10018673 60
891 3300025904 Ga0207647_10000340 Ga0207647_100003406 60
892 3300025909 Ga0207705_10000352 Ga0207705_1000035227 60
893 3300025909 Ga0207705_10102825 Ga0207705_101028252 60
894 3300025912 Ga0207707_11494105 Ga0207707_114941052 60
895 3300025913 Ga0207695_10047671 Ga0207695_100476714 60
896 3300025913 Ga0207695_10349841 Ga0207695_103498412 60
897 3300025914 Ga0207671_10327034 Ga0207671_103270343 60
898 3300025914 Ga0207671_10385238 Ga0207671_103852382 60
899 3300025919 Ga0207657_10202353 Ga0207657_102023532 60
900 3300025924 Ga0207694_10575780 Ga0207694_105757802 60
901 3300025924 Ga0207694_11126951 Ga0207694_111269512 60
902 3300025932 Ga0207690_10006937 Ga0207690_100069373 60
903 3300025949 Ga0207667_10002243 Ga0207667_100022433 60
904 3300025949 Ga0207667_10011404 Ga0207667_100114044 60
905 3300025981 Ga0207640_11985875 Ga0207640_119858751 60
906 3300026041 Ga0207639_10131727 Ga0207639_101317272 60
907 3300026078 Ga0207702_10462376 Ga0207702_104623762 60
908 3300037312 Ga0395899_0000007 Ga0395899_0000007_299820_300002 60
909 3300037312 Ga0395899_0021494 Ga0395899_0021494_3089_3271 60
910 3300037312 Ga0395899_0070803 Ga0395899_0070803_679_861 60
911 3300037418 Ga0395900_0003760 Ga0395900_0003760_8856_9038 60
912 3300037418 Ga0395900_0006222 Ga0395900_0006222_9290_9472 60
913 3300037418 Ga0395900_0019019 Ga0395900_0019019_1478_1660 60
914 3300037418 Ga0395900_0363491 Ga0395900_0363491_654_836 60
915 3300037418 Ga0395900_0671412 Ga0395900_0671412_225_407 60
916 3300037466 Ga0395898_0000276 Ga0395898_0000276_114353_114535 60
917 3300037466 Ga0395898_0148480 Ga0395898_0148480_1267_1449 60
918 3300037471 Ga0395905_1286533 Ga0395905_1286533_26_208 60
919 3300038443 Ga0395901_0000017 Ga0395901_0000017_133940_134122 60
920 3300038443 Ga0395901_0000410 Ga0395901_0000410_44869_45051 60
921 3300038443 Ga0395901_0002433 Ga0395901_0002433_3922_4104 60
922 3300042005 Ga0439448_0000098 Ga0439448_0000098_884_1066 60
923 3300042012 Ga0439455_0179302 Ga0439455_0179302_215_397 60
924 3300044656 Ga0466969_0000523 Ga0466969_0000523_2396_2587 60
925 3300044658 Ga0466972_0007257 Ga0466972_0007257_50_241 60
926 3300044659 Ga0466973_0019878 Ga0466973_0019878_3097_3288 60
927 3300044660 Ga0466974_0175636 Ga0466974_0175636_419_601 60
928 3300044683 Ga0466965_0076266 Ga0466965_0076266_507_698 60
929 3300044684 Ga0466966_0223709 Ga0466966_0223709_800_982 60
930 3300044693 Ga0466961_0175977 Ga0466961_0175977_494_685 60
931 3300044694 Ga0466963_0031580 Ga0466963_0031580_1152_1343 60
932 3300044706 Ga0466964_0187202 Ga0466964_0187202_323_514 60
933 3300044719 Ga0466971_0188451 Ga0466971_0188451_483_665 60
934 3300044719 Ga0466971_0241865 Ga0466971_0241865_155_346 60
935 3300044765 Ga0466970_0000982 Ga0466970_0000982_4337_4528 60
936 3300044842 Ga0466957_0007915 Ga0466957_0007915_5531_5722 60
937 3300045049 Ga0466959_0074060 Ga0466959_0074060_1597_1788 60
938 3300045049 Ga0466959_0152395 Ga0466959_0152395_779_961 60
939 3300045049 Ga0466959_0415505 Ga0466959_0415505_120_302 60
940 3300045836 Ga0466958_0005985 Ga0466958_0005985_1593_1775 60
941 3300045836 Ga0466958_0007577 Ga0466958_0007577_5535_5726 60
942 3300061719 Ga0466962_0018323 Ga0466962_0018323_2949_3140 60

Feature Viewer

pLDDT pTM Quality
72.91 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map