F486354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 446 | 942 | 58 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100986570|Ga0068859_1009865702 |
| Length | 69 |
| Sequence | MINSTPPQAPTLGSDEERVDAIVRSGPSGAIAVAGIATAVVIALWFAFYLFVFLPRSVEHDDRGGSRHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 260 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 261 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 262 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 269 | 3300044660 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 | Metagenome | Unclassified |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 383 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 404 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 409 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 410 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 414 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 418 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 421 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 422 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 423 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 424 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 429 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 430 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 434 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 436 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 437 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 439 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 440 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 442 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 443 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 445 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.81 |
| Nodule | 0 |
| Rhizoplane | 8.92 |
| Rhizosphere | 76.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1069384 | 3300001904 | Bacteria | 549 |
| 2 | JGI24739J22299_10113909 | 3300001989 | Bacteria | 811 |
| 3 | JGI24735J21928_10002229 | 3300002067 | Bacteria | 6796 |
| 4 | JGI25153J46596_10004677 | 3300003215 | Bacteria | 7315 |
| 5 | JGI25404J52841_10000254 | 3300003659 | Bacteria | 6695 |
| 6 | Ga0065715_10748971 | 3300005293 | Bacteria | 595 |
| 7 | Ga0070658_10002866 | 3300005327 | Bacteria | 14324 |
| 8 | Ga0070658_10075593 | 3300005327 | Bacteria | 2763 |
| 9 | Ga0070658_10116973 | 3300005327 | Bacteria | 2213 |
| 10 | Ga0070658_10295883 | 3300005327 | Bacteria | 1380 |
| 11 | Ga0070658_10944468 | 3300005327 | Bacteria | 750 |
| 12 | Ga0070658_11518580 | 3300005327 | Bacteria | 581 |
| 13 | Ga0070676_10492300 | 3300005328 | Bacteria | 869 |
| 14 | Ga0070676_10536251 | 3300005328 | Bacteria | 836 |
| 15 | Ga0070683_100086605 | 3300005329 | Bacteria | 2937 |
| 16 | Ga0070683_101093560 | 3300005329 | Bacteria | 766 |
| 17 | Ga0070690_100352478 | 3300005330 | Bacteria | 1068 |
| 18 | Ga0070690_100704672 | 3300005330 | Bacteria | 776 |
| 19 | Ga0070670_100109295 | 3300005331 | Bacteria | 2382 |
| 20 | Ga0070670_100433001 | 3300005331 | Bacteria | 1164 |
| 21 | Ga0070677_10647422 | 3300005333 | Bacteria | 590 |
| 22 | Ga0068869_100017200 | 3300005334 | Bacteria | 4895 |
| 23 | Ga0068869_100181849 | 3300005334 | Bacteria | 1648 |
| 24 | Ga0068869_100830396 | 3300005334 | Bacteria | 796 |
| 25 | Ga0070666_10359545 | 3300005335 | Bacteria | 1043 |
| 26 | Ga0070666_10449063 | 3300005335 | Bacteria | 931 |
| 27 | Ga0070666_10450053 | 3300005335 | Bacteria | 930 |
| 28 | Ga0070680_100043042 | 3300005336 | Bacteria | 3667 |
| 29 | Ga0070682_100042469 | 3300005337 | Bacteria | 2807 |
| 30 | Ga0070682_100157416 | 3300005337 | Bacteria | 1565 |
| 31 | Ga0070682_101350930 | 3300005337 | Bacteria | 607 |
| 32 | Ga0068868_100006547 | 3300005338 | Bacteria | 8248 |
| 33 | Ga0068868_100069042 | 3300005338 | Bacteria | 2815 |
| 34 | Ga0068868_100203216 | 3300005338 | Bacteria | 1652 |
| 35 | Ga0070660_100064724 | 3300005339 | Bacteria | 2845 |
| 36 | Ga0070689_100230654 | 3300005340 | Bacteria | 1522 |
| 37 | Ga0070689_100543029 | 3300005340 | Bacteria | 1001 |
| 38 | Ga0070689_100574766 | 3300005340 | Bacteria | 973 |
| 39 | Ga0070691_10111683 | 3300005341 | Bacteria | 1368 |
| 40 | Ga0070661_100202483 | 3300005344 | Bacteria | 1517 |
| 41 | Ga0070661_100558505 | 3300005344 | Bacteria | 922 |
| 42 | Ga0070661_100985189 | 3300005344 | Bacteria | 699 |
| 43 | Ga0070661_101196721 | 3300005344 | Bacteria | 635 |
| 44 | Ga0070692_10372284 | 3300005345 | Bacteria | 894 |
| 45 | Ga0070668_100045256 | 3300005347 | Bacteria | 3377 |
| 46 | Ga0070668_100104644 | 3300005347 | Bacteria | 2246 |
| 47 | Ga0070668_100182551 | 3300005347 | Bacteria | 1715 |
| 48 | Ga0070668_100320697 | 3300005347 | Bacteria | 1304 |
| 49 | Ga0070668_100409293 | 3300005347 | Bacteria | 1159 |
| 50 | Ga0070668_100673548 | 3300005347 | Bacteria | 910 |
| 51 | Ga0070668_100871306 | 3300005347 | Bacteria | 803 |
| 52 | Ga0070669_100971608 | 3300005353 | Bacteria | 728 |
| 53 | Ga0070669_102052703 | 3300005353 | Bacteria | 500 |
| 54 | Ga0070675_102234345 | 3300005354 | Bacteria | 504 |
| 55 | Ga0070671_100267604 | 3300005355 | Bacteria | 1453 |
| 56 | Ga0070671_100880541 | 3300005355 | Bacteria | 782 |
| 57 | Ga0070671_100907065 | 3300005355 | Bacteria | 770 |
| 58 | Ga0070674_100021173 | 3300005356 | Bacteria | 4169 |
| 59 | Ga0070674_100142087 | 3300005356 | Bacteria | 1802 |
| 60 | Ga0070674_100406354 | 3300005356 | Bacteria | 1114 |
| 61 | Ga0070674_101206939 | 3300005356 | Bacteria | 672 |
| 62 | Ga0070673_100059256 | 3300005364 | Bacteria | 3030 |
| 63 | Ga0070673_100150917 | 3300005364 | Bacteria | 1968 |
| 64 | Ga0070673_101663386 | 3300005364 | Bacteria | 604 |
| 65 | Ga0070688_100239557 | 3300005365 | Bacteria | 1287 |
| 66 | Ga0070688_100332589 | 3300005365 | Bacteria | 1107 |
| 67 | Ga0070688_101601867 | 3300005365 | Bacteria | 532 |
| 68 | Ga0070659_100032739 | 3300005366 | Bacteria | 4034 |
| 69 | Ga0070659_100302808 | 3300005366 | Bacteria | 1333 |
| 70 | Ga0070659_100483469 | 3300005366 | Bacteria | 1054 |
| 71 | Ga0070667_100244921 | 3300005367 | Bacteria | 1602 |
| 72 | Ga0070667_100748564 | 3300005367 | Bacteria | 906 |
| 73 | Ga0070667_100830546 | 3300005367 | Bacteria | 859 |
| 74 | Ga0070667_100885727 | 3300005367 | Bacteria | 830 |
| 75 | Ga0070667_101507393 | 3300005367 | Bacteria | 631 |
| 76 | Ga0070709_10554080 | 3300005434 | Bacteria | 880 |
| 77 | Ga0070714_101245849 | 3300005435 | Bacteria | 726 |
| 78 | Ga0070713_101550238 | 3300005436 | Bacteria | 643 |
| 79 | Ga0070710_10080672 | 3300005437 | Bacteria | 1898 |
| 80 | Ga0070701_10104741 | 3300005438 | Bacteria | 1572 |
| 81 | Ga0070701_10150986 | 3300005438 | Bacteria | 1338 |
| 82 | Ga0070711_100111738 | 3300005439 | Bacteria | 2006 |
| 83 | Ga0070711_100150626 | 3300005439 | Bacteria | 1754 |
| 84 | Ga0070705_100798108 | 3300005440 | Bacteria | 751 |
| 85 | Ga0070700_100396324 | 3300005441 | Bacteria | 1037 |
| 86 | Ga0070694_100626303 | 3300005444 | Bacteria | 869 |
| 87 | Ga0070663_100016240 | 3300005455 | Bacteria | 4829 |
| 88 | Ga0070663_100020052 | 3300005455 | Bacteria | 4419 |
| 89 | Ga0070663_100123056 | 3300005455 | Bacteria | 1961 |
| 90 | Ga0070663_100437512 | 3300005455 | Bacteria | 1075 |
| 91 | Ga0070663_100596433 | 3300005455 | Bacteria | 928 |
| 92 | Ga0070663_101660418 | 3300005455 | Bacteria | 571 |
| 93 | Ga0070663_101930476 | 3300005455 | Bacteria | 530 |
| 94 | Ga0070678_100003659 | 3300005456 | Bacteria | 8584 |
| 95 | Ga0070678_100017610 | 3300005456 | Bacteria | 4607 |
| 96 | Ga0070678_100037277 | 3300005456 | Bacteria | 3412 |
| 97 | Ga0070678_100067668 | 3300005456 | Bacteria | 2659 |
| 98 | Ga0070662_100035529 | 3300005457 | Bacteria | 3520 |
| 99 | Ga0070662_100534799 | 3300005457 | Bacteria | 981 |
| 100 | Ga0070662_101609019 | 3300005457 | Bacteria | 561 |
| 101 | Ga0070681_10058589 | 3300005458 | Bacteria | 3831 |
| 102 | Ga0070681_10706778 | 3300005458 | Bacteria | 924 |
| 103 | Ga0070681_11890369 | 3300005458 | Unclassified | 524 |
| 104 | Ga0068867_100049914 | 3300005459 | Bacteria | 3081 |
| 105 | Ga0068867_100709248 | 3300005459 | Bacteria | 889 |
| 106 | Ga0070685_10181990 | 3300005466 | Bacteria | 1354 |
| 107 | Ga0070706_100366354 | 3300005467 | Bacteria | 1343 |
| 108 | Ga0070699_100857343 | 3300005518 | Bacteria | 832 |
| 109 | Ga0070699_102180762 | 3300005518 | Bacteria | 506 |
| 110 | Ga0070679_100021982 | 3300005530 | Bacteria | 6232 |
| 111 | Ga0070679_102074267 | 3300005530 | Bacteria | 518 |
| 112 | Ga0070684_100132369 | 3300005535 | Bacteria | 2250 |
| 113 | Ga0070684_101966184 | 3300005535 | Bacteria | 552 |
| 114 | Ga0070697_102008836 | 3300005536 | Bacteria | 518 |
| 115 | Ga0068853_100014537 | 3300005539 | Bacteria | 6451 |
| 116 | Ga0068853_100205235 | 3300005539 | Bacteria | 1795 |
| 117 | Ga0068853_100206278 | 3300005539 | Bacteria | 1790 |
| 118 | Ga0068853_100391277 | 3300005539 | Bacteria | 1300 |
| 119 | Ga0068853_102007754 | 3300005539 | Bacteria | 561 |
| 120 | Ga0070672_100215342 | 3300005543 | Bacteria | 1610 |
| 121 | Ga0070672_100670484 | 3300005543 | Bacteria | 907 |
| 122 | Ga0070672_100882149 | 3300005543 | Bacteria | 790 |
| 123 | Ga0070672_101204631 | 3300005543 | Bacteria | 675 |
| 124 | Ga0070686_100177039 | 3300005544 | Bacteria | 1513 |
| 125 | Ga0070686_100573155 | 3300005544 | Bacteria | 886 |
| 126 | Ga0070686_100643605 | 3300005544 | Bacteria | 840 |
| 127 | Ga0070686_101235180 | 3300005544 | Bacteria | 622 |
| 128 | Ga0070696_100348194 | 3300005546 | Bacteria | 1147 |
| 129 | Ga0070693_100091362 | 3300005547 | Bacteria | 1836 |
| 130 | Ga0070665_100069675 | 3300005548 | Bacteria | 3525 |
| 131 | Ga0070665_100203937 | 3300005548 | Bacteria | 1978 |
| 132 | Ga0070665_100358774 | 3300005548 | Bacteria | 1463 |
| 133 | Ga0070704_100137670 | 3300005549 | Bacteria | 1902 |
| 134 | Ga0068855_100014574 | 3300005563 | Bacteria | 9470 |
| 135 | Ga0068855_100036502 | 3300005563 | Bacteria | 5849 |
| 136 | Ga0068855_100037055 | 3300005563 | Bacteria | 5802 |
| 137 | Ga0068855_100066675 | 3300005563 | Bacteria | 4196 |
| 138 | Ga0068855_100778579 | 3300005563 | Bacteria | 1018 |
| 139 | Ga0068855_100985620 | 3300005563 | Bacteria | 886 |
| 140 | Ga0068855_101197574 | 3300005563 | Bacteria | 790 |
| 141 | Ga0070664_100021262 | 3300005564 | Bacteria | 5346 |
| 142 | Ga0068857_102144183 | 3300005577 | Bacteria | 548 |
| 143 | Ga0068854_100587721 | 3300005578 | Bacteria | 949 |
| 144 | Ga0068854_100778395 | 3300005578 | Bacteria | 832 |
| 145 | Ga0068856_100489788 | 3300005614 | Bacteria | 1250 |
| 146 | Ga0068856_100662677 | 3300005614 | Bacteria | 1064 |
| 147 | Ga0068856_100832589 | 3300005614 | Bacteria | 942 |
| 148 | Ga0068856_100907486 | 3300005614 | Bacteria | 900 |
| 149 | Ga0070702_100061421 | 3300005615 | Bacteria | 2188 |
| 150 | Ga0070702_100630948 | 3300005615 | Bacteria | 808 |
| 151 | Ga0070702_100832092 | 3300005615 | Bacteria | 717 |
| 152 | Ga0068852_100022692 | 3300005616 | Bacteria | 5039 |
| 153 | Ga0068852_100223284 | 3300005616 | Bacteria | 1793 |
| 154 | Ga0068852_100772596 | 3300005616 | Bacteria | 974 |
| 155 | Ga0068852_101379056 | 3300005616 | Bacteria | 727 |
| 156 | Ga0068859_100237233 | 3300005617 | Bacteria | 1912 |
| 157 | Ga0068859_100986570 | 3300005617 | Bacteria | 925 |
| 158 | Ga0068859_102459925 | 3300005617 | Bacteria | 573 |
| 159 | Ga0068864_100073671 | 3300005618 | Bacteria | 2977 |
| 160 | Ga0068864_101985841 | 3300005618 | Bacteria | 588 |
| 161 | Ga0068866_10149422 | 3300005718 | Bacteria | 1351 |
| 162 | Ga0068866_10195073 | 3300005718 | Bacteria | 1206 |
| 163 | Ga0068866_10319886 | 3300005718 | Bacteria | 976 |
| 164 | Ga0068866_10857445 | 3300005718 | Bacteria | 636 |
| 165 | Ga0068861_100052716 | 3300005719 | Bacteria | 3093 |
| 166 | Ga0068861_100259325 | 3300005719 | Bacteria | 1487 |
| 167 | Ga0068861_101148943 | 3300005719 | Bacteria | 748 |
| 168 | Ga0068861_101801330 | 3300005719 | Bacteria | 607 |
| 169 | Ga0068861_102322041 | 3300005719 | Bacteria | 538 |
| 170 | Ga0068851_10383285 | 3300005834 | Bacteria | 824 |
| 171 | Ga0068851_10499761 | 3300005834 | Bacteria | 729 |
| 172 | Ga0068870_10088952 | 3300005840 | Bacteria | 1723 |
| 173 | Ga0068863_100133864 | 3300005841 | Bacteria | 2367 |
| 174 | Ga0068863_101629419 | 3300005841 | Bacteria | 655 |
| 175 | Ga0068858_100023425 | 3300005842 | Bacteria | 5752 |
| 176 | Ga0068858_100060057 | 3300005842 | Bacteria | 3514 |
| 177 | Ga0068858_100514881 | 3300005842 | Bacteria | 1157 |
| 178 | Ga0068858_100938665 | 3300005842 | Bacteria | 847 |
| 179 | Ga0068858_101559705 | 3300005842 | Bacteria | 652 |
| 180 | Ga0068858_101650519 | 3300005842 | Bacteria | 633 |
| 181 | Ga0068860_100292362 | 3300005843 | Bacteria | 1594 |
| 182 | Ga0068860_101077622 | 3300005843 | Bacteria | 822 |
| 183 | Ga0068860_102009637 | 3300005843 | Bacteria | 599 |
| 184 | Ga0068862_100145699 | 3300005844 | Bacteria | 2104 |
| 185 | Ga0068862_100502129 | 3300005844 | Bacteria | 1151 |
| 186 | Ga0068862_101100731 | 3300005844 | Bacteria | 789 |
| 187 | Ga0068862_101222327 | 3300005844 | Bacteria | 750 |
| 188 | Ga0081455_10000895 | 3300005937 | Bacteria | 38448 |
| 189 | Ga0081455_10208227 | 3300005937 | Bacteria | 1459 |
| 190 | Ga0081540_1002053 | 3300005983 | Bacteria | 16798 |
| 191 | Ga0081540_1002582 | 3300005983 | Bacteria | 14701 |
| 192 | Ga0081540_1003838 | 3300005983 | Bacteria | 11758 |
| 193 | Ga0081540_1005208 | 3300005983 | Bacteria | 9729 |
| 194 | Ga0081540_1007807 | 3300005983 | Bacteria | 7570 |
| 195 | Ga0081540_1011448 | 3300005983 | Bacteria | 5926 |
| 196 | Ga0081540_1053737 | 3300005983 | Bacteria | 1973 |
| 197 | Ga0081540_1315350 | 3300005983 | Bacteria | 537 |
| 198 | Ga0070717_10331799 | 3300006028 | Bacteria | 1357 |
| 199 | Ga0070717_10651567 | 3300006028 | Bacteria | 956 |
| 200 | Ga0070717_11674234 | 3300006028 | Bacteria | 576 |
| 201 | Ga0075365_10031510 | 3300006038 | Bacteria | 3401 |
| 202 | Ga0075365_10114109 | 3300006038 | Bacteria | 1859 |
| 203 | Ga0075368_10002535 | 3300006042 | Bacteria | 5974 |
| 204 | Ga0075363_100084189 | 3300006048 | Bacteria | 1743 |
| 205 | Ga0075363_100831096 | 3300006048 | Bacteria | 563 |
| 206 | Ga0075364_10040099 | 3300006051 | Bacteria | 3037 |
| 207 | Ga0070716_100564558 | 3300006173 | Bacteria | 851 |
| 208 | Ga0070716_101130306 | 3300006173 | Bacteria | 626 |
| 209 | Ga0070712_100098016 | 3300006175 | Bacteria | 2162 |
| 210 | Ga0070712_100452239 | 3300006175 | Bacteria | 1070 |
| 211 | Ga0070712_100736895 | 3300006175 | Bacteria | 843 |
| 212 | Ga0075362_10062304 | 3300006177 | Bacteria | 1689 |
| 213 | Ga0075362_10191086 | 3300006177 | Bacteria | 994 |
| 214 | Ga0075362_10305662 | 3300006177 | Bacteria | 790 |
| 215 | Ga0075367_10032918 | 3300006178 | Bacteria | 2985 |
| 216 | Ga0075367_10165209 | 3300006178 | Bacteria | 1377 |
| 217 | Ga0075367_10546170 | 3300006178 | Bacteria | 736 |
| 218 | Ga0075369_10145910 | 3300006186 | Bacteria | 1080 |
| 219 | Ga0075366_10155615 | 3300006195 | Bacteria | 1384 |
| 220 | Ga0097621_100045438 | 3300006237 | Bacteria | 3548 |
| 221 | Ga0097621_100097225 | 3300006237 | Bacteria | 2472 |
| 222 | Ga0097621_101183157 | 3300006237 | Bacteria | 720 |
| 223 | Ga0097621_102332976 | 3300006237 | Bacteria | 512 |
| 224 | Ga0075370_10114646 | 3300006353 | Bacteria | 1566 |
| 225 | Ga0068871_100031318 | 3300006358 | Bacteria | 4194 |
| 226 | Ga0068871_100563371 | 3300006358 | Bacteria | 1033 |
| 227 | Ga0075434_100207988 | 3300006871 | Bacteria | 1978 |
| 228 | Ga0068865_100039829 | 3300006881 | Bacteria | 3189 |
| 229 | Ga0068865_100442397 | 3300006881 | Bacteria | 1073 |
| 230 | Ga0068865_101867429 | 3300006881 | Bacteria | 544 |
| 231 | Ga0097620_100237229 | 3300006931 | Bacteria | 1912 |
| 232 | Ga0097620_100986525 | 3300006931 | Bacteria | 925 |
| 233 | Ga0097620_102459913 | 3300006931 | Bacteria | 573 |
| 234 | Ga0075435_100040178 | 3300007076 | Bacteria | 3735 |
| 235 | Ga0099795_10001567 | 3300007788 | Bacteria | 5035 |
| 236 | Ga0099795_10333478 | 3300007788 | Bacteria | 675 |
| 237 | Ga0105251_10099205 | 3300009011 | Bacteria | 1332 |
| 238 | Ga0105240_10381267 | 3300009093 | Bacteria | 1592 |
| 239 | Ga0105240_10445166 | 3300009093 | Bacteria | 1451 |
| 240 | Ga0105240_10696767 | 3300009093 | Bacteria | 1109 |
| 241 | Ga0105240_12057348 | 3300009093 | Bacteria | 593 |
| 242 | Ga0111539_11695168 | 3300009094 | Bacteria | 733 |
| 243 | Ga0105245_10027787 | 3300009098 | Bacteria | 4985 |
| 244 | Ga0105245_10266547 | 3300009098 | Bacteria | 1669 |
| 245 | Ga0105247_10121527 | 3300009101 | Bacteria | 1692 |
| 246 | Ga0105247_10431196 | 3300009101 | Bacteria | 946 |
| 247 | Ga0105247_10981074 | 3300009101 | Bacteria | 658 |
| 248 | Ga0105243_10011026 | 3300009148 | Bacteria | 6835 |
| 249 | Ga0105243_10104731 | 3300009148 | Bacteria | 2355 |
| 250 | Ga0105243_11376315 | 3300009148 | Bacteria | 725 |
| 251 | Ga0105243_12011325 | 3300009148 | Bacteria | 612 |
| 252 | Ga0105241_10302898 | 3300009174 | Bacteria | 1372 |
| 253 | Ga0105241_11128652 | 3300009174 | Bacteria | 739 |
| 254 | Ga0105242_10483835 | 3300009176 | Bacteria | 1174 |
| 255 | Ga0105242_10921034 | 3300009176 | Bacteria | 876 |
| 256 | Ga0105242_11784149 | 3300009176 | Bacteria | 653 |
| 257 | Ga0105242_11855893 | 3300009176 | Bacteria | 642 |
| 258 | Ga0105242_11930074 | 3300009176 | Bacteria | 631 |
| 259 | Ga0105248_10034971 | 3300009177 | Bacteria | 5622 |
| 260 | Ga0105248_10578130 | 3300009177 | Bacteria | 1267 |
| 261 | Ga0105248_11000293 | 3300009177 | Bacteria | 944 |
| 262 | Ga0105248_12066583 | 3300009177 | Bacteria | 648 |
| 263 | Ga0105237_10043449 | 3300009545 | Bacteria | 4526 |
| 264 | Ga0105237_10099940 | 3300009545 | Bacteria | 2892 |
| 265 | Ga0105237_10167236 | 3300009545 | Bacteria | 2198 |
| 266 | Ga0105237_10412156 | 3300009545 | Bacteria | 1356 |
| 267 | Ga0105237_11103806 | 3300009545 | Bacteria | 800 |
| 268 | Ga0105237_11690252 | 3300009545 | Bacteria | 640 |
| 269 | Ga0105237_12131593 | 3300009545 | Unclassified | 570 |
| 270 | Ga0105238_10189353 | 3300009551 | Bacteria | 2034 |
| 271 | Ga0105238_10380360 | 3300009551 | Bacteria | 1403 |
| 272 | Ga0105238_10822089 | 3300009551 | Bacteria | 945 |
| 273 | Ga0105238_11570745 | 3300009551 | Bacteria | 688 |
| 274 | Ga0105238_11643913 | 3300009551 | Bacteria | 673 |
| 275 | Ga0105249_10071994 | 3300009553 | Bacteria | 3195 |
| 276 | Ga0105249_12135119 | 3300009553 | Bacteria | 633 |
| 277 | Ga0105239_10010954 | 3300010375 | Bacteria | 10129 |
| 278 | Ga0105239_10120429 | 3300010375 | Bacteria | 2914 |
| 279 | Ga0105239_10223977 | 3300010375 | Bacteria | 2109 |
| 280 | Ga0105239_10320168 | 3300010375 | Bacteria | 1749 |
| 281 | Ga0105239_12453475 | 3300010375 | Bacteria | 607 |
| 282 | Ga0105239_12647613 | 3300010375 | Bacteria | 585 |
| 283 | Ga0105239_13516621 | 3300010375 | Bacteria | 509 |
| 284 | Ga0105246_10037993 | 3300011119 | Bacteria | 3234 |
| 285 | Ga0105246_10834135 | 3300011119 | Bacteria | 821 |
| 286 | Ga0157373_10514487 | 3300013100 | Bacteria | 866 |
| 287 | Ga0157371_10027801 | 3300013102 | Bacteria | 4099 |
| 288 | Ga0157370_10016923 | 3300013104 | Bacteria | 7371 |
| 289 | Ga0157370_10034059 | 3300013104 | Bacteria | 4963 |
| 290 | Ga0157370_10038959 | 3300013104 | Bacteria | 4597 |
| 291 | Ga0157370_11088082 | 3300013104 | Bacteria | 722 |
| 292 | Ga0157369_10000362 | 3300013105 | Bacteria | 60506 |
| 293 | Ga0157369_10000808 | 3300013105 | Bacteria | 39992 |
| 294 | Ga0157374_10003326 | 3300013296 | Bacteria | 13512 |
| 295 | Ga0157374_10266765 | 3300013296 | Bacteria | 1688 |
| 296 | Ga0157374_10721465 | 3300013296 | Bacteria | 1011 |
| 297 | Ga0157378_10260553 | 3300013297 | Bacteria | 1663 |
| 298 | Ga0157378_10745098 | 3300013297 | Bacteria | 1002 |
| 299 | Ga0157378_10793243 | 3300013297 | Bacteria | 972 |
| 300 | Ga0157378_10816321 | 3300013297 | Bacteria | 959 |
| 301 | Ga0163162_10015168 | 3300013306 | Bacteria | 7526 |
| 302 | Ga0163162_10055092 | 3300013306 | Bacteria | 4002 |
| 303 | Ga0163162_10116218 | 3300013306 | Bacteria | 2776 |
| 304 | Ga0163162_11248021 | 3300013306 | Bacteria | 844 |
| 305 | Ga0163162_12015453 | 3300013306 | Bacteria | 661 |
| 306 | Ga0163162_12767914 | 3300013306 | Bacteria | 565 |
| 307 | Ga0157372_10234078 | 3300013307 | Bacteria | 2130 |
| 308 | Ga0157372_11808161 | 3300013307 | Bacteria | 703 |
| 309 | Ga0157375_10008539 | 3300013308 | Bacteria | 8967 |
| 310 | Ga0157375_10114306 | 3300013308 | Bacteria | 2801 |
| 311 | Ga0157375_10309505 | 3300013308 | Bacteria | 1744 |
| 312 | Ga0157375_11563643 | 3300013308 | Bacteria | 779 |
| 313 | Ga0163163_10007553 | 3300014325 | Bacteria | 9597 |
| 314 | Ga0163163_10341033 | 3300014325 | Bacteria | 1554 |
| 315 | Ga0163163_10607263 | 3300014325 | Bacteria | 1157 |
| 316 | Ga0163163_12792390 | 3300014325 | Bacteria | 545 |
| 317 | Ga0157380_12592928 | 3300014326 | Bacteria | 573 |
| 318 | Ga0157377_10369659 | 3300014745 | Bacteria | 968 |
| 319 | Ga0157377_10420363 | 3300014745 | Bacteria | 915 |
| 320 | Ga0157377_10426601 | 3300014745 | Bacteria | 909 |
| 321 | Ga0157379_10385425 | 3300014968 | Bacteria | 1286 |
| 322 | Ga0157379_10463328 | 3300014968 | Bacteria | 1171 |
| 323 | Ga0157379_11760015 | 3300014968 | Bacteria | 608 |
| 324 | Ga0157376_10017469 | 3300014969 | Bacteria | 5473 |
| 325 | Ga0157376_10645767 | 3300014969 | Bacteria | 1058 |
| 326 | Ga0157376_10768259 | 3300014969 | Bacteria | 974 |
| 327 | Ga0157376_10919498 | 3300014969 | Bacteria | 894 |
| 328 | Ga0163161_10123768 | 3300017792 | Bacteria | 1945 |
| 329 | Ga0163161_10779376 | 3300017792 | Bacteria | 802 |
| 330 | Ga0163161_10923186 | 3300017792 | Bacteria | 741 |
| 331 | Ga0163161_11426617 | 3300017792 | Bacteria | 605 |
| 332 | Ga0163161_11988853 | 3300017792 | Bacteria | 517 |
| 333 | Ga0197907_10425857 | 3300020069 | Bacteria | 525 |
| 334 | Ga0206356_11624406 | 3300020070 | Bacteria | 1641 |
| 335 | Ga0206350_10387633 | 3300020080 | Bacteria | 659 |
| 336 | Ga0206354_10084247 | 3300020081 | Bacteria | 921 |
| 337 | Ga0206353_10739046 | 3300020082 | Bacteria | 1863 |
| 338 | Ga0224712_10000787 | 3300022467 | Bacteria | 6666 |
| 339 | Ga0209672_100948 | 3300025228 | Bacteria | 12951 |
| 340 | Ga0209759_1001867 | 3300025256 | Bacteria | 10461 |
| 341 | Ga0209758_1003142 | 3300025297 | Bacteria | 15539 |
| 342 | Ga0207697_10062646 | 3300025315 | Bacteria | 1549 |
| 343 | Ga0207697_10335915 | 3300025315 | Bacteria | 671 |
| 344 | Ga0207656_10149549 | 3300025321 | Bacteria | 1105 |
| 345 | Ga0207653_10195040 | 3300025885 | Bacteria | 762 |
| 346 | Ga0207692_10090497 | 3300025898 | Bacteria | 1658 |
| 347 | Ga0207692_10587239 | 3300025898 | Bacteria | 715 |
| 348 | Ga0207642_10057363 | 3300025899 | Bacteria | 1791 |
| 349 | Ga0207710_10071000 | 3300025900 | Bacteria | 1597 |
| 350 | Ga0207710_10292122 | 3300025900 | Bacteria | 822 |
| 351 | Ga0207688_10030058 | 3300025901 | Bacteria | 2994 |
| 352 | Ga0207688_10104915 | 3300025901 | Bacteria | 1635 |
| 353 | Ga0207680_10259017 | 3300025903 | Bacteria | 1203 |
| 354 | Ga0207680_10421109 | 3300025903 | Bacteria | 946 |
| 355 | Ga0207647_10000340 | 3300025904 | Bacteria | 38070 |
| 356 | Ga0207647_10564080 | 3300025904 | Bacteria | 631 |
| 357 | Ga0207647_10726151 | 3300025904 | Bacteria | 539 |
| 358 | Ga0207685_10078092 | 3300025905 | Bacteria | 1362 |
| 359 | Ga0207699_10011455 | 3300025906 | Bacteria | 4480 |
| 360 | Ga0207699_10464097 | 3300025906 | Bacteria | 910 |
| 361 | Ga0207645_10401305 | 3300025907 | Bacteria | 922 |
| 362 | Ga0207645_10821891 | 3300025907 | Bacteria | 632 |
| 363 | Ga0207643_10033308 | 3300025908 | Bacteria | 2882 |
| 364 | Ga0207705_10000352 | 3300025909 | Bacteria | 41499 |
| 365 | Ga0207705_10057990 | 3300025909 | Bacteria | 2794 |
| 366 | Ga0207705_10102825 | 3300025909 | Bacteria | 2104 |
| 367 | Ga0207705_10113468 | 3300025909 | Bacteria | 2004 |
| 368 | Ga0207705_10357462 | 3300025909 | Bacteria | 1126 |
| 369 | Ga0207705_10642038 | 3300025909 | Bacteria | 825 |
| 370 | Ga0207684_10575771 | 3300025910 | Bacteria | 962 |
| 371 | Ga0207654_10372332 | 3300025911 | Bacteria | 988 |
| 372 | Ga0207707_10306841 | 3300025912 | Bacteria | 1372 |
| 373 | Ga0207707_10798221 | 3300025912 | Bacteria | 786 |
| 374 | Ga0207707_11494105 | 3300025912 | Unclassified | 536 |
| 375 | Ga0207695_10047671 | 3300025913 | Bacteria | 4531 |
| 376 | Ga0207695_10137206 | 3300025913 | Bacteria | 2398 |
| 377 | Ga0207695_10349841 | 3300025913 | Bacteria | 1365 |
| 378 | Ga0207671_10327034 | 3300025914 | Bacteria | 1214 |
| 379 | Ga0207671_10370802 | 3300025914 | Bacteria | 1137 |
| 380 | Ga0207671_10385238 | 3300025914 | Bacteria | 1114 |
| 381 | Ga0207671_10424414 | 3300025914 | Bacteria | 1058 |
| 382 | Ga0207693_10031699 | 3300025915 | Bacteria | 4176 |
| 383 | Ga0207693_10050481 | 3300025915 | Bacteria | 3267 |
| 384 | Ga0207693_10066564 | 3300025915 | Bacteria | 2821 |
| 385 | Ga0207663_10021008 | 3300025916 | Bacteria | 3708 |
| 386 | Ga0207663_10867856 | 3300025916 | Bacteria | 721 |
| 387 | Ga0207660_10163892 | 3300025917 | Bacteria | 1717 |
| 388 | Ga0207660_11317332 | 3300025917 | Bacteria | 586 |
| 389 | Ga0207662_10143963 | 3300025918 | Bacteria | 1511 |
| 390 | Ga0207657_10202353 | 3300025919 | Bacteria | 1597 |
| 391 | Ga0207657_10527779 | 3300025919 | Bacteria | 924 |
| 392 | Ga0207649_10802599 | 3300025920 | Bacteria | 735 |
| 393 | Ga0207649_11052109 | 3300025920 | Bacteria | 641 |
| 394 | Ga0207652_10156528 | 3300025921 | Bacteria | 2042 |
| 395 | Ga0207646_11119044 | 3300025922 | Bacteria | 693 |
| 396 | Ga0207681_10337974 | 3300025923 | Bacteria | 1202 |
| 397 | Ga0207681_11028151 | 3300025923 | Bacteria | 691 |
| 398 | Ga0207694_10471411 | 3300025924 | Bacteria | 1049 |
| 399 | Ga0207694_10575780 | 3300025924 | Bacteria | 946 |
| 400 | Ga0207694_10579713 | 3300025924 | Bacteria | 943 |
| 401 | Ga0207694_11126951 | 3300025924 | Bacteria | 664 |
| 402 | Ga0207650_11098057 | 3300025925 | Bacteria | 677 |
| 403 | Ga0207687_10023036 | 3300025927 | Bacteria | 4148 |
| 404 | Ga0207687_10075061 | 3300025927 | Bacteria | 2425 |
| 405 | Ga0207700_10043969 | 3300025928 | Bacteria | 3285 |
| 406 | Ga0207644_10119591 | 3300025931 | Bacteria | 2004 |
| 407 | Ga0207644_11004590 | 3300025931 | Bacteria | 700 |
| 408 | Ga0207690_10006937 | 3300025932 | Bacteria | 6715 |
| 409 | Ga0207690_10299993 | 3300025932 | Bacteria | 1257 |
| 410 | Ga0207690_10962236 | 3300025932 | Bacteria | 709 |
| 411 | Ga0207690_11162511 | 3300025932 | Bacteria | 644 |
| 412 | Ga0207706_10060448 | 3300025933 | Bacteria | 3337 |
| 413 | Ga0207706_10250929 | 3300025933 | Bacteria | 1545 |
| 414 | Ga0207706_11242256 | 3300025933 | Bacteria | 618 |
| 415 | Ga0207706_11443281 | 3300025933 | Bacteria | 563 |
| 416 | Ga0207686_10251825 | 3300025934 | Bacteria | 1291 |
| 417 | Ga0207686_10760956 | 3300025934 | Bacteria | 774 |
| 418 | Ga0207686_10881960 | 3300025934 | Bacteria | 721 |
| 419 | Ga0207686_10890236 | 3300025934 | Bacteria | 718 |
| 420 | Ga0207709_10028413 | 3300025935 | Bacteria | 3233 |
| 421 | Ga0207709_10067476 | 3300025935 | Bacteria | 2257 |
| 422 | Ga0207709_11744745 | 3300025935 | Bacteria | 518 |
| 423 | Ga0207670_10048644 | 3300025936 | Bacteria | 2831 |
| 424 | Ga0207670_10437426 | 3300025936 | Bacteria | 1052 |
| 425 | Ga0207669_10012350 | 3300025937 | Bacteria | 4196 |
| 426 | Ga0207669_10042118 | 3300025937 | Bacteria | 2663 |
| 427 | Ga0207669_10702625 | 3300025937 | Bacteria | 831 |
| 428 | Ga0207669_11136797 | 3300025937 | Bacteria | 660 |
| 429 | Ga0207669_11143130 | 3300025937 | Bacteria | 658 |
| 430 | Ga0207704_10042466 | 3300025938 | Bacteria | 2677 |
| 431 | Ga0207704_10369105 | 3300025938 | Bacteria | 1123 |
| 432 | Ga0207704_10708282 | 3300025938 | Bacteria | 834 |
| 433 | Ga0207704_10931018 | 3300025938 | Bacteria | 732 |
| 434 | Ga0207704_11429730 | 3300025938 | Bacteria | 593 |
| 435 | Ga0207665_10376901 | 3300025939 | Bacteria | 1076 |
| 436 | Ga0207665_10569974 | 3300025939 | Bacteria | 881 |
| 437 | Ga0207665_11496642 | 3300025939 | Bacteria | 536 |
| 438 | Ga0207691_10059924 | 3300025940 | Bacteria | 3460 |
| 439 | Ga0207691_10971201 | 3300025940 | Bacteria | 709 |
| 440 | Ga0207691_11150710 | 3300025940 | Bacteria | 644 |
| 441 | Ga0207711_10518245 | 3300025941 | Bacteria | 1112 |
| 442 | Ga0207711_10566025 | 3300025941 | Bacteria | 1060 |
| 443 | Ga0207711_11003573 | 3300025941 | Bacteria | 774 |
| 444 | Ga0207711_11128492 | 3300025941 | Bacteria | 725 |
| 445 | Ga0207689_10075529 | 3300025942 | Bacteria | 2770 |
| 446 | Ga0207689_10091812 | 3300025942 | Bacteria | 2494 |
| 447 | Ga0207689_11200102 | 3300025942 | Bacteria | 639 |
| 448 | Ga0207689_11684504 | 3300025942 | Bacteria | 526 |
| 449 | Ga0207661_10615357 | 3300025944 | Bacteria | 997 |
| 450 | Ga0207679_10048953 | 3300025945 | Bacteria | 3080 |
| 451 | Ga0207667_10002243 | 3300025949 | Bacteria | 24288 |
| 452 | Ga0207667_10010756 | 3300025949 | Bacteria | 10672 |
| 453 | Ga0207667_10011404 | 3300025949 | Bacteria | 10330 |
| 454 | Ga0207667_10074694 | 3300025949 | Bacteria | 3521 |
| 455 | Ga0207667_11037481 | 3300025949 | Bacteria | 806 |
| 456 | Ga0207667_11921973 | 3300025949 | Bacteria | 553 |
| 457 | Ga0207651_10072156 | 3300025960 | Bacteria | 2450 |
| 458 | Ga0207651_10091652 | 3300025960 | Bacteria | 2226 |
| 459 | Ga0207651_11159675 | 3300025960 | Bacteria | 693 |
| 460 | Ga0207712_10057081 | 3300025961 | Bacteria | 2753 |
| 461 | Ga0207712_10124192 | 3300025961 | Bacteria | 1957 |
| 462 | Ga0207712_11806335 | 3300025961 | Bacteria | 548 |
| 463 | Ga0207668_10019967 | 3300025972 | Bacteria | 4248 |
| 464 | Ga0207668_10036022 | 3300025972 | Bacteria | 3300 |
| 465 | Ga0207668_10290683 | 3300025972 | Bacteria | 1344 |
| 466 | Ga0207668_10767587 | 3300025972 | Bacteria | 851 |
| 467 | Ga0207668_11650731 | 3300025972 | Bacteria | 579 |
| 468 | Ga0207668_11651264 | 3300025972 | Bacteria | 578 |
| 469 | Ga0207640_10041183 | 3300025981 | Bacteria | 2936 |
| 470 | Ga0207640_10284821 | 3300025981 | Bacteria | 1300 |
| 471 | Ga0207640_11985875 | 3300025981 | Bacteria | 527 |
| 472 | Ga0207658_10317607 | 3300025986 | Bacteria | 1347 |
| 473 | Ga0207658_10903315 | 3300025986 | Bacteria | 804 |
| 474 | Ga0207658_11080908 | 3300025986 | Bacteria | 733 |
| 475 | Ga0207658_12145365 | 3300025986 | Bacteria | 507 |
| 476 | Ga0207677_10011044 | 3300026023 | Bacteria | 5132 |
| 477 | Ga0207677_10091669 | 3300026023 | Bacteria | 2211 |
| 478 | Ga0207677_10424507 | 3300026023 | Bacteria | 1133 |
| 479 | Ga0207677_11001803 | 3300026023 | Bacteria | 758 |
| 480 | Ga0207703_10075453 | 3300026035 | Bacteria | 2794 |
| 481 | Ga0207703_10489198 | 3300026035 | Bacteria | 1154 |
| 482 | Ga0207703_11888044 | 3300026035 | Bacteria | 573 |
| 483 | Ga0207703_12076511 | 3300026035 | Bacteria | 544 |
| 484 | Ga0207639_10127272 | 3300026041 | Bacteria | 2103 |
| 485 | Ga0207639_10131727 | 3300026041 | Bacteria | 2071 |
| 486 | Ga0207639_10203783 | 3300026041 | Bacteria | 1698 |
| 487 | Ga0207639_10408168 | 3300026041 | Bacteria | 1225 |
| 488 | Ga0207639_11840782 | 3300026041 | Bacteria | 566 |
| 489 | Ga0207678_10010552 | 3300026067 | Bacteria | 8114 |
| 490 | Ga0207678_10022770 | 3300026067 | Bacteria | 5486 |
| 491 | Ga0207678_10203891 | 3300026067 | Bacteria | 1691 |
| 492 | Ga0207678_10585696 | 3300026067 | Bacteria | 977 |
| 493 | Ga0207678_10737917 | 3300026067 | Bacteria | 868 |
| 494 | Ga0207708_10184300 | 3300026075 | Bacteria | 1658 |
| 495 | Ga0207702_10462376 | 3300026078 | Bacteria | 1233 |
| 496 | Ga0207702_10628896 | 3300026078 | Bacteria | 1055 |
| 497 | Ga0207702_11008951 | 3300026078 | Bacteria | 826 |
| 498 | Ga0207702_11251691 | 3300026078 | Bacteria | 736 |
| 499 | Ga0207641_10062468 | 3300026088 | Bacteria | 3179 |
| 500 | Ga0207641_11298147 | 3300026088 | Bacteria | 728 |
| 501 | Ga0207648_10197558 | 3300026089 | Bacteria | 1784 |
| 502 | Ga0207648_10307061 | 3300026089 | Bacteria | 1424 |
| 503 | Ga0207648_10550576 | 3300026089 | Bacteria | 1060 |
| 504 | Ga0207676_12208683 | 3300026095 | Bacteria | 548 |
| 505 | Ga0207674_10111119 | 3300026116 | Bacteria | 2715 |
| 506 | Ga0207675_100101117 | 3300026118 | Bacteria | 2716 |
| 507 | Ga0207675_100111822 | 3300026118 | Bacteria | 2577 |
| 508 | Ga0207675_100199723 | 3300026118 | Bacteria | 1920 |
| 509 | Ga0207675_100437879 | 3300026118 | Bacteria | 1293 |
| 510 | Ga0207683_10014660 | 3300026121 | Bacteria | 6675 |
| 511 | Ga0207683_10044880 | 3300026121 | Bacteria | 3864 |
| 512 | Ga0207683_11014122 | 3300026121 | Bacteria | 770 |
| 513 | Ga0207683_12039011 | 3300026121 | Bacteria | 522 |
| 514 | Ga0207698_10102309 | 3300026142 | Bacteria | 2378 |
| 515 | Ga0207698_10282368 | 3300026142 | Bacteria | 1536 |
| 516 | Ga0207698_10716743 | 3300026142 | Bacteria | 997 |
| 517 | Ga0209813_10356145 | 3300027866 | Bacteria | 581 |
| 518 | Ga0268266_10019219 | 3300028379 | Bacteria | 5818 |
| 519 | Ga0268266_10073912 | 3300028379 | Bacteria | 2959 |
| 520 | Ga0268265_10791409 | 3300028380 | Bacteria | 923 |
| 521 | Ga0268265_10927281 | 3300028380 | Bacteria | 856 |
| 522 | Ga0268265_11356582 | 3300028380 | Bacteria | 712 |
| 523 | Ga0268264_10257991 | 3300028381 | Bacteria | 1622 |
| 524 | Ga0268264_11786333 | 3300028381 | Bacteria | 625 |
| 525 | Ga0268264_12142705 | 3300028381 | Bacteria | 567 |
| 526 | Ga0307517_10308361 | 3300028786 | Bacteria | 883 |
| 527 | Ga0307515_10393531 | 3300028794 | Bacteria | 1014 |
| 528 | Ga0307511_10210668 | 3300030521 | Bacteria | 993 |
| 529 | Ga0265763_1028070 | 3300030763 | Bacteria | 626 |
| 530 | Ga0265760_10293071 | 3300031090 | Bacteria | 575 |
| 531 | Ga0265332_10369523 | 3300031238 | Bacteria | 592 |
| 532 | Ga0265331_10030702 | 3300031250 | Bacteria | 2674 |
| 533 | Ga0307513_10193775 | 3300031456 | Bacteria | 1881 |
| 534 | Ga0307509_10272187 | 3300031507 | Bacteria | 1460 |
| 535 | Ga0307508_10565863 | 3300031616 | Bacteria | 736 |
| 536 | Ga0265314_10059242 | 3300031711 | Bacteria | 2620 |
| 537 | Ga0265314_10548549 | 3300031711 | Bacteria | 602 |
| 538 | Ga0265342_10010007 | 3300031712 | Bacteria | 6621 |
| 539 | Ga0265342_10079738 | 3300031712 | Bacteria | 1893 |
| 540 | Ga0307516_10213055 | 3300031730 | Bacteria | 1645 |
| 541 | Ga0307516_10999018 | 3300031730 | Bacteria | 509 |
| 542 | Ga0307415_100020263 | 3300032126 | Bacteria | 4058 |
| 543 | Ga0307507_10596065 | 3300033179 | Bacteria | 572 |
| 544 | Ga0307510_10009746 | 3300033180 | Bacteria | 11432 |
| 545 | Ga0373930_0043898 | 3300034816 | Bacteria | 960 |
| 546 | Ga0373959_0017186 | 3300034820 | Bacteria | 1349 |
| 547 | Ga0373938_0080798 | 3300034957 | Bacteria | 791 |
| 548 | Ga0373929_0064173 | 3300035085 | Bacteria | 866 |
| 549 | Ga0373944_0117981 | 3300035089 | Bacteria | 912 |
| 550 | Ga0373923_0000827 | 3300035111 | Bacteria | 8121 |
| 551 | Ga0373936_0041112 | 3300035113 | Bacteria | 1854 |
| 552 | Ga0373936_0061770 | 3300035113 | Bacteria | 1531 |
| 553 | Ga0373953_0002753 | 3300035117 | Bacteria | 5341 |
| 554 | Ga0373954_0000634 | 3300035118 | Bacteria | 13429 |
| 555 | Ga0373954_0036508 | 3300035118 | Bacteria | 2281 |
| 556 | Ga0373956_0001884 | 3300035119 | Bacteria | 8647 |
| 557 | Ga0373957_0000200 | 3300035120 | Bacteria | 15408 |
| 558 | Ga0373946_0078970 | 3300035171 | Bacteria | 1437 |
| 559 | Ga0373955_0005004 | 3300035172 | Bacteria | 5921 |
| 560 | Ga0373942_0040611 | 3300035207 | Bacteria | 1269 |
| 561 | Ga0373961_0122618 | 3300035241 | Bacteria | 863 |
| 562 | Ga0373924_0052392 | 3300035410 | Bacteria | 1694 |
| 563 | Ga0373931_0050522 | 3300035691 | Bacteria | 2212 |
| 564 | Ga0373935_0103925 | 3300035692 | Bacteria | 1877 |
| 565 | Ga0373927_0054881 | 3300035695 | Bacteria | 2577 |
| 566 | Ga0373933_0002159 | 3300035724 | Bacteria | 11266 |
| 567 | Ga0373933_0831574 | 3300035724 | Bacteria | 608 |
| 568 | Ga0373947_0706203 | 3300035725 | Bacteria | 688 |
| 569 | Ga0373937_0014785 | 3300036401 | Bacteria | 6891 |
| 570 | Ga0372808_001672 | 3300036459 | Bacteria | 2374 |
| 571 | Ga0373925_1009403 | 3300037068 | Bacteria | 685 |
| 572 | Ga0395899_0000007 | 3300037312 | Bacteria | 629129 |
| 573 | Ga0395899_0021494 | 3300037312 | Bacteria | 4895 |
| 574 | Ga0395899_0037652 | 3300037312 | Bacteria | 3626 |
| 575 | Ga0395899_0070803 | 3300037312 | Bacteria | 2552 |
| 576 | Ga0395900_0003760 | 3300037418 | Bacteria | 16301 |
| 577 | Ga0395900_0006222 | 3300037418 | Bacteria | 12463 |
| 578 | Ga0395900_0019019 | 3300037418 | Bacteria | 7005 |
| 579 | Ga0395900_0077073 | 3300037418 | Bacteria | 3425 |
| 580 | Ga0395900_0363491 | 3300037418 | Bacteria | 1418 |
| 581 | Ga0395900_0671412 | 3300037418 | Bacteria | 971 |
| 582 | Ga0395898_0000276 | 3300037466 | Bacteria | 124774 |
| 583 | Ga0395898_0012584 | 3300037466 | Bacteria | 8748 |
| 584 | Ga0395898_0148480 | 3300037466 | Bacteria | 2243 |
| 585 | Ga0395905_0392592 | 3300037471 | Bacteria | 1282 |
| 586 | Ga0395905_1286533 | 3300037471 | Bacteria | 635 |
| 587 | Ga0395901_0000017 | 3300038443 | Bacteria | 345003 |
| 588 | Ga0395901_0000410 | 3300038443 | Bacteria | 50670 |
| 589 | Ga0395901_0002433 | 3300038443 | Bacteria | 18893 |
| 590 | Ga0395901_0007409 | 3300038443 | Bacteria | 11070 |
| 591 | Ga0451787_030782 | 3300041441 | Bacteria | 634 |
| 592 | Ga0451787_437186 | 3300041441 | Bacteria | 656 |
| 593 | Ga0451789_0439858 | 3300041443 | Bacteria | 927 |
| 594 | Ga0451791_1349316 | 3300041451 | Bacteria | 1067 |
| 595 | Ga0451793_0751178 | 3300041452 | Bacteria | 500 |
| 596 | Ga0451797_0172161 | 3300041453 | Bacteria | 958 |
| 597 | Ga0451795_1524981 | 3300041456 | Bacteria | 542 |
| 598 | Ga0451798_1057041 | 3300041458 | Bacteria | 766 |
| 599 | Ga0451800_1604853 | 3300041459 | Bacteria | 581 |
| 600 | Ga0451802_0019777 | 3300041460 | Bacteria | 653 |
| 601 | Ga0451802_0304564 | 3300041460 | Bacteria | 573 |
| 602 | Ga0451807_1607086 | 3300041486 | Bacteria | 514 |
| 603 | Ga0451833_1216072 | 3300041491 | Bacteria | 661 |
| 604 | Ga0451845_0985256 | 3300041501 | Bacteria | 598 |
| 605 | Ga0451851_1322556 | 3300041507 | Bacteria | 572 |
| 606 | Ga0451843_0728618 | 3300041509 | Bacteria | 846 |
| 607 | Ga0451853_1746509 | 3300041512 | Bacteria | 1980 |
| 608 | Ga0451853_1810983 | 3300041512 | Bacteria | 776 |
| 609 | Ga0451853_4067572 | 3300041512 | Bacteria | 604 |
| 610 | Ga0439448_0000098 | 3300042005 | Bacteria | 15629 |
| 611 | Ga0439455_0179302 | 3300042012 | Bacteria | 610 |
| 612 | Ga0466969_0000523 | 3300044656 | Bacteria | 21109 |
| 613 | Ga0466972_0007257 | 3300044658 | Bacteria | 5566 |
| 614 | Ga0466973_0019878 | 3300044659 | Bacteria | 6407 |
| 615 | Ga0466974_0175636 | 3300044660 | Bacteria | 1365 |
| 616 | Ga0466965_0076266 | 3300044683 | Bacteria | 1691 |
| 617 | Ga0466966_0223709 | 3300044684 | Bacteria | 1136 |
| 618 | Ga0466961_0175977 | 3300044693 | Bacteria | 1329 |
| 619 | Ga0466963_0031580 | 3300044694 | Bacteria | 3424 |
| 620 | Ga0466964_0187202 | 3300044706 | Bacteria | 985 |
| 621 | Ga0466971_0188451 | 3300044719 | Bacteria | 971 |
| 622 | Ga0466971_0241865 | 3300044719 | Bacteria | 858 |
| 623 | Ga0466970_0000982 | 3300044765 | Bacteria | 13717 |
| 624 | Ga0466957_0007915 | 3300044842 | Bacteria | 6027 |
| 625 | Ga0466959_0074060 | 3300045049 | Bacteria | 2462 |
| 626 | Ga0466959_0152395 | 3300045049 | Bacteria | 1629 |
| 627 | Ga0466959_0415505 | 3300045049 | Bacteria | 913 |
| 628 | Ga0466958_0005985 | 3300045836 | Bacteria | 6584 |
| 629 | Ga0466958_0007577 | 3300045836 | Bacteria | 5977 |
| 630 | Ga0495617_019330 | 3300046452 | Bacteria | 2303 |
| 631 | Ga0495627_098214 | 3300046453 | Bacteria | 838 |
| 632 | Ga0495592_0002897 | 3300046454 | Bacteria | 12205 |
| 633 | Ga0495603_0017151 | 3300046455 | Bacteria | 4384 |
| 634 | Ga0495603_0031419 | 3300046455 | Bacteria | 3196 |
| 635 | Ga0495603_0238001 | 3300046455 | Bacteria | 1049 |
| 636 | Ga0495603_0399053 | 3300046455 | Bacteria | 788 |
| 637 | Ga0495590_0035683 | 3300046457 | Bacteria | 1735 |
| 638 | Ga0495591_057252 | 3300046458 | Bacteria | 1046 |
| 639 | Ga0495629_0002158 | 3300046459 | Bacteria | 15190 |
| 640 | Ga0495629_0682498 | 3300046459 | Bacteria | 683 |
| 641 | Ga0495629_0755711 | 3300046459 | Bacteria | 643 |
| 642 | Ga0495638_0131924 | 3300046460 | Bacteria | 1466 |
| 643 | Ga0495638_0343294 | 3300046460 | Bacteria | 791 |
| 644 | Ga0495641_0295354 | 3300046461 | Bacteria | 730 |
| 645 | Ga0495651_0057664 | 3300046462 | Bacteria | 2981 |
| 646 | Ga0495651_0101857 | 3300046462 | Bacteria | 2136 |
| 647 | Ga0495653_0017446 | 3300046463 | Bacteria | 5838 |
| 648 | Ga0495650_0146812 | 3300046471 | Bacteria | 850 |
| 649 | Ga0495582_0201669 | 3300046473 | Bacteria | 1136 |
| 650 | Ga0495582_0535426 | 3300046473 | Bacteria | 677 |
| 651 | Ga0495605_0191943 | 3300046474 | Bacteria | 893 |
| 652 | Ga0495639_0189724 | 3300046475 | Bacteria | 1003 |
| 653 | Ga0495662_0050496 | 3300046476 | Bacteria | 2008 |
| 654 | Ga0495664_0136401 | 3300046477 | Bacteria | 1487 |
| 655 | Ga0495664_0304389 | 3300046477 | Bacteria | 962 |
| 656 | Ga0495664_0870317 | 3300046477 | Bacteria | 528 |
| 657 | Ga0495584_0368802 | 3300046491 | Bacteria | 729 |
| 658 | Ga0495585_0019025 | 3300046492 | Bacteria | 3963 |
| 659 | Ga0495594_0499582 | 3300046499 | Bacteria | 691 |
| 660 | Ga0495596_0152289 | 3300046500 | Bacteria | 898 |
| 661 | Ga0495607_0072805 | 3300046501 | Bacteria | 1912 |
| 662 | Ga0495583_0087005 | 3300046506 | Bacteria | 1351 |
| 663 | Ga0495606_0104556 | 3300046507 | Bacteria | 1718 |
| 664 | Ga0495606_0151584 | 3300046507 | Bacteria | 1360 |
| 665 | Ga0495606_0189315 | 3300046507 | Bacteria | 1180 |
| 666 | Ga0495608_0002218 | 3300046511 | Bacteria | 14020 |
| 667 | Ga0495608_0882922 | 3300046511 | Bacteria | 524 |
| 668 | Ga0495610_0121293 | 3300046512 | Bacteria | 1145 |
| 669 | Ga0495616_0370522 | 3300046513 | Bacteria | 593 |
| 670 | Ga0495620_0070690 | 3300046515 | Bacteria | 1429 |
| 671 | Ga0495620_0415190 | 3300046515 | Bacteria | 509 |
| 672 | Ga0495628_0038487 | 3300046516 | Bacteria | 3828 |
| 673 | Ga0495631_0229711 | 3300046518 | Bacteria | 791 |
| 674 | Ga0495643_0287355 | 3300046522 | Bacteria | 754 |
| 675 | Ga0495643_0481943 | 3300046522 | Bacteria | 536 |
| 676 | Ga0495644_0097550 | 3300046523 | Bacteria | 1111 |
| 677 | Ga0495648_0095285 | 3300046524 | Bacteria | 1656 |
| 678 | Ga0495663_0153991 | 3300046525 | Bacteria | 786 |
| 679 | Ga0495642_0175473 | 3300046528 | Bacteria | 932 |
| 680 | Ga0495652_0038809 | 3300046529 | Bacteria | 4122 |
| 681 | Ga0495652_0309464 | 3300046529 | Bacteria | 1145 |
| 682 | Ga0495654_0065774 | 3300046530 | Bacteria | 1730 |
| 683 | Ga0495665_0604613 | 3300046531 | Bacteria | 548 |
| 684 | Ga0495640_0005616 | 3300046533 | Bacteria | 9978 |
| 685 | Ga0495587_0025519 | 3300046536 | Bacteria | 3611 |
| 686 | Ga0495587_0824488 | 3300046536 | Bacteria | 506 |
| 687 | Ga0495598_0145952 | 3300046537 | Bacteria | 822 |
| 688 | Ga0495598_0169757 | 3300046537 | Bacteria | 772 |
| 689 | Ga0495609_0029965 | 3300046538 | Bacteria | 2476 |
| 690 | Ga0495597_0066671 | 3300046542 | Bacteria | 1559 |
| 691 | Ga0495645_0213847 | 3300046543 | Bacteria | 1300 |
| 692 | Ga0495645_0251676 | 3300046543 | Bacteria | 1174 |
| 693 | Ga0495645_0784040 | 3300046543 | Bacteria | 573 |
| 694 | Ga0495622_0005946 | 3300046557 | Bacteria | 5670 |
| 695 | Ga0495633_0217864 | 3300046558 | Bacteria | 874 |
| 696 | Ga0495667_0009980 | 3300046559 | Bacteria | 6430 |
| 697 | Ga0495656_0068283 | 3300046615 | Bacteria | 1571 |
| 698 | Ga0495656_0125502 | 3300046615 | Bacteria | 1216 |
| 699 | Ga0495656_0151554 | 3300046615 | Bacteria | 1120 |
| 700 | Ga0495668_0070449 | 3300046616 | Bacteria | 1922 |
| 701 | Ga0495668_0260170 | 3300046616 | Bacteria | 950 |
| 702 | Ga0495634_0034579 | 3300046642 | Bacteria | 3467 |
| 703 | Ga0495634_0762418 | 3300046642 | Bacteria | 553 |
| 704 | Ga0495634_0874064 | 3300046642 | Bacteria | 510 |
| 705 | Ga0495611_0229269 | 3300046648 | Bacteria | 863 |
| 706 | Ga0495625_0427815 | 3300046660 | Bacteria | 822 |
| 707 | Ga0495635_0001058 | 3300046663 | Bacteria | 18230 |
| 708 | Ga0495635_0534498 | 3300046663 | Bacteria | 770 |
| 709 | Ga0495635_0653495 | 3300046663 | Bacteria | 684 |
| 710 | Ga0495588_0289516 | 3300046674 | Bacteria | 863 |
| 711 | Ga0495588_0630690 | 3300046674 | Bacteria | 561 |
| 712 | Ga0495657_0011523 | 3300046675 | Bacteria | 6606 |
| 713 | Ga0495599_0003523 | 3300046678 | Bacteria | 9167 |
| 714 | Ga0495599_0163130 | 3300046678 | Bacteria | 1377 |
| 715 | Ga0495623_0006259 | 3300046679 | Bacteria | 7742 |
| 716 | Ga0495623_0023756 | 3300046679 | Bacteria | 3955 |
| 717 | Ga0495646_0000934 | 3300046680 | Bacteria | 16609 |
| 718 | Ga0495646_0125268 | 3300046680 | Bacteria | 1450 |
| 719 | Ga0495669_0003832 | 3300046684 | Bacteria | 6181 |
| 720 | Ga0495669_0584821 | 3300046684 | Bacteria | 543 |
| 721 | Ga0495613_0306306 | 3300046689 | Bacteria | 1099 |
| 722 | Ga0495624_0612487 | 3300046690 | Bacteria | 649 |
| 723 | Ga0495649_0257830 | 3300046694 | Bacteria | 894 |
| 724 | Ga0495589_0384953 | 3300046794 | Bacteria | 644 |
| 725 | Ga0495589_0405868 | 3300046794 | Bacteria | 625 |
| 726 | Ga0495600_0001795 | 3300046809 | Bacteria | 11997 |
| 727 | Ga0495600_0319738 | 3300046809 | Bacteria | 976 |
| 728 | Ga0495600_0586700 | 3300046809 | Bacteria | 678 |
| 729 | Ga0495581_0523461 | 3300047315 | Bacteria | 689 |
| 730 | Ga0495581_0637219 | 3300047315 | Bacteria | 616 |
| 731 | Ga0495581_0670891 | 3300047315 | Bacteria | 599 |
| 732 | Ga0495581_0858503 | 3300047315 | Bacteria | 519 |
| 733 | Ga0495604_0014661 | 3300047317 | Bacteria | 6247 |
| 734 | Ga0495604_0091763 | 3300047317 | Bacteria | 2251 |
| 735 | Ga0495604_0864322 | 3300047317 | Bacteria | 567 |
| 736 | Ga0495674_0007182 | 3300047319 | Bacteria | 10654 |
| 737 | Ga0495674_0269727 | 3300047319 | Bacteria | 1397 |
| 738 | Ga0495674_0943608 | 3300047319 | Bacteria | 664 |
| 739 | Ga0495672_0046495 | 3300047320 | Bacteria | 2588 |
| 740 | Ga0495672_0420365 | 3300047320 | Bacteria | 608 |
| 741 | Ga0495676_0304106 | 3300047321 | Bacteria | 1075 |
| 742 | Ga0495676_0325429 | 3300047321 | Bacteria | 1032 |
| 743 | Ga0495676_1101575 | 3300047321 | Bacteria | 505 |
| 744 | Ga0495680_0233868 | 3300047322 | Bacteria | 1307 |
| 745 | Ga0495683_0104787 | 3300047323 | Bacteria | 1356 |
| 746 | Ga0495675_0002644 | 3300047444 | Bacteria | 10732 |
| 747 | Ga0495675_0004307 | 3300047444 | Bacteria | 8610 |
| 748 | Ga0495677_0124151 | 3300047445 | Bacteria | 986 |
| 749 | Ga0495677_0156220 | 3300047445 | Bacteria | 879 |
| 750 | Ga0495679_099085 | 3300047446 | Bacteria | 811 |
| 751 | Ga0495685_090611 | 3300047447 | Bacteria | 1014 |
| 752 | Ga0495685_130572 | 3300047447 | Bacteria | 821 |
| 753 | Ga0495673_0160260 | 3300047469 | Bacteria | 864 |
| 754 | Ga0495684_0016173 | 3300047471 | Bacteria | 5745 |
| 755 | Ga0495686_0065615 | 3300047472 | Bacteria | 2244 |
| 756 | Ga0495686_0269147 | 3300047472 | Bacteria | 951 |
| 757 | Ga0495686_0400024 | 3300047472 | Bacteria | 737 |
| 758 | Ga0495593_0007370 | 3300047673 | Bacteria | 6445 |
| 759 | Ga0495593_0329846 | 3300047673 | Bacteria | 763 |
| 760 | Ga0495602_0027742 | 3300048088 | Bacteria | 5436 |
| 761 | Ga0495602_0048110 | 3300048088 | Bacteria | 3836 |
| 762 | Ga0495615_0018636 | 3300048090 | Bacteria | 1531 |
| 763 | Ga0495626_0179278 | 3300048091 | Bacteria | 879 |
| 764 | Ga0496100_0009207 | 3300048903 | Bacteria | 5541 |
| 765 | Ga0496100_0013579 | 3300048903 | Bacteria | 4703 |
| 766 | Ga0496100_0035542 | 3300048903 | Bacteria | 3135 |
| 767 | Ga0496100_0193147 | 3300048903 | Bacteria | 1479 |
| 768 | Ga0496100_0347828 | 3300048903 | Bacteria | 1119 |
| 769 | Ga0496100_0863678 | 3300048903 | Bacteria | 710 |
| 770 | Ga0496101_0000875 | 3300048904 | Bacteria | 17763 |
| 771 | Ga0496101_0176638 | 3300048904 | Bacteria | 1643 |
| 772 | Ga0496101_0227712 | 3300048904 | Bacteria | 1448 |
| 773 | Ga0496101_0328408 | 3300048904 | Bacteria | 1200 |
| 774 | Ga0496102_0009695 | 3300048905 | Bacteria | 8280 |
| 775 | Ga0496102_0037392 | 3300048905 | Bacteria | 4379 |
| 776 | Ga0496102_0248458 | 3300048905 | Bacteria | 1677 |
| 777 | Ga0496102_0564003 | 3300048905 | Bacteria | 1061 |
| 778 | Ga0496103_0006163 | 3300048906 | Bacteria | 7164 |
| 779 | Ga0496103_0364652 | 3300048906 | Bacteria | 929 |
| 780 | Ga0496103_0759658 | 3300048906 | Bacteria | 613 |
| 781 | Ga0496104_0036083 | 3300048907 | Bacteria | 4618 |
| 782 | Ga0496104_0879326 | 3300048907 | Bacteria | 801 |
| 783 | Ga0496104_0894838 | 3300048907 | Bacteria | 793 |
| 784 | Ga0496104_1502371 | 3300048907 | Bacteria | 576 |
| 785 | Ga0496105_0017743 | 3300048908 | Bacteria | 5710 |
| 786 | Ga0496105_0101141 | 3300048908 | Bacteria | 2380 |
| 787 | Ga0496105_0668324 | 3300048908 | Bacteria | 800 |
| 788 | Ga0496106_0016638 | 3300048909 | Bacteria | 5441 |
| 789 | Ga0496106_0132381 | 3300048909 | Bacteria | 1956 |
| 790 | Ga0496106_0320307 | 3300048909 | Bacteria | 1244 |
| 791 | Ga0496106_0375713 | 3300048909 | Bacteria | 1142 |
| 792 | Ga0496106_0516371 | 3300048909 | Bacteria | 959 |
| 793 | Ga0496106_0533776 | 3300048909 | Bacteria | 942 |
| 794 | Ga0496106_0787576 | 3300048909 | Bacteria | 755 |
| 795 | Ga0496107_0015387 | 3300048910 | Bacteria | 5360 |
| 796 | Ga0496107_0112310 | 3300048910 | Bacteria | 2003 |
| 797 | Ga0496107_0255773 | 3300048910 | Bacteria | 1303 |
| 798 | Ga0496107_0406021 | 3300048910 | Bacteria | 1013 |
| 799 | Ga0496107_0686432 | 3300048910 | Bacteria | 754 |
| 800 | Ga0496107_0978125 | 3300048910 | Bacteria | 615 |
| 801 | Ga0496108_0002192 | 3300048911 | Bacteria | 15654 |
| 802 | Ga0496108_0330641 | 3300048911 | Bacteria | 1329 |
| 803 | Ga0496108_0449741 | 3300048911 | Bacteria | 1125 |
| 804 | Ga0496108_1590037 | 3300048911 | Bacteria | 541 |
| 805 | Ga0496109_0010462 | 3300048912 | Bacteria | 7926 |
| 806 | Ga0496109_0079860 | 3300048912 | Bacteria | 3014 |
| 807 | Ga0496109_0189821 | 3300048912 | Bacteria | 1931 |
| 808 | Ga0496109_0316599 | 3300048912 | Bacteria | 1472 |
| 809 | Ga0496109_0471486 | 3300048912 | Bacteria | 1185 |
| 810 | Ga0496110_0026863 | 3300048913 | Bacteria | 4929 |
| 811 | Ga0496110_0173863 | 3300048913 | Bacteria | 1954 |
| 812 | Ga0496110_0599451 | 3300048913 | Bacteria | 999 |
| 813 | Ga0496111_0018238 | 3300048914 | Bacteria | 4860 |
| 814 | Ga0496111_0037599 | 3300048914 | Bacteria | 3464 |
| 815 | Ga0496111_0211959 | 3300048914 | Bacteria | 1439 |
| 816 | Ga0496112_0016391 | 3300048915 | Bacteria | 6941 |
| 817 | Ga0496112_0018840 | 3300048915 | Bacteria | 6503 |
| 818 | Ga0496112_0109577 | 3300048915 | Bacteria | 2731 |
| 819 | Ga0496112_1690878 | 3300048915 | Bacteria | 545 |
| 820 | Ga0496113_0001312 | 3300048916 | Bacteria | 13745 |
| 821 | Ga0496113_0082648 | 3300048916 | Bacteria | 2463 |
| 822 | Ga0496113_0405020 | 3300048916 | Bacteria | 1095 |
| 823 | Ga0496113_0610121 | 3300048916 | Bacteria | 874 |
| 824 | Ga0496113_1489394 | 3300048916 | Bacteria | 522 |
| 825 | Ga0496114_0004461 | 3300048917 | Bacteria | 10865 |
| 826 | Ga0496114_0108754 | 3300048917 | Bacteria | 2373 |
| 827 | Ga0496114_0227293 | 3300048917 | Bacteria | 1639 |
| 828 | Ga0496114_0263839 | 3300048917 | Bacteria | 1517 |
| 829 | Ga0496114_0544542 | 3300048917 | Bacteria | 1026 |
| 830 | Ga0496115_0009019 | 3300048918 | Bacteria | 7400 |
| 831 | Ga0496115_0009478 | 3300048918 | Bacteria | 7232 |
| 832 | Ga0496115_0039849 | 3300048918 | Bacteria | 3733 |
| 833 | Ga0496115_0792938 | 3300048918 | Bacteria | 738 |
| 834 | Ga0496115_0948707 | 3300048918 | Bacteria | 661 |
| 835 | Ga0496115_1450641 | 3300048918 | Bacteria | 505 |
| 836 | Ga0496116_0108802 | 3300048919 | Bacteria | 1636 |
| 837 | Ga0496117_0290918 | 3300048920 | Bacteria | 870 |
| 838 | Ga0496117_0329210 | 3300048920 | Bacteria | 797 |
| 839 | Ga0496118_0562123 | 3300048921 | Bacteria | 554 |
| 840 | Ga0496119_0308491 | 3300048922 | Bacteria | 778 |
| 841 | Ga0496119_0541226 | 3300048922 | Bacteria | 537 |
| 842 | Ga0496120_0492318 | 3300048923 | Bacteria | 528 |
| 843 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 844 | Ga0496121_0117819 | 3300048924 | Bacteria | 2011 |
| 845 | Ga0496121_0228466 | 3300048924 | Bacteria | 1305 |
| 846 | Ga0496121_0361152 | 3300048924 | Bacteria | 964 |
| 847 | Ga0496121_0394458 | 3300048924 | Bacteria | 908 |
| 848 | Ga0496121_0455971 | 3300048924 | Bacteria | 823 |
| 849 | Ga0496121_0487080 | 3300048924 | Bacteria | 786 |
| 850 | Ga0496122_0011608 | 3300048925 | Bacteria | 8893 |
| 851 | Ga0496123_0115403 | 3300048926 | Bacteria | 1524 |
| 852 | Ga0496124_0221282 | 3300048927 | Bacteria | 1423 |
| 853 | Ga0496124_0624549 | 3300048927 | Bacteria | 696 |
| 854 | Ga0496124_0670127 | 3300048927 | Bacteria | 662 |
| 855 | Ga0496125_0200197 | 3300048928 | Bacteria | 1308 |
| 856 | Ga0496125_0326519 | 3300048928 | Bacteria | 927 |
| 857 | Ga0496125_0503762 | 3300048928 | Bacteria | 681 |
| 858 | Ga0496125_0637333 | 3300048928 | Bacteria | 576 |
| 859 | Ga0496126_0003590 | 3300048929 | Bacteria | 19439 |
| 860 | Ga0496126_0004961 | 3300048929 | Bacteria | 15521 |
| 861 | Ga0496126_0141728 | 3300048929 | Bacteria | 2068 |
| 862 | Ga0496126_0508953 | 3300048929 | Bacteria | 961 |
| 863 | Ga0496126_0803743 | 3300048929 | Bacteria | 721 |
| 864 | Ga0496126_0911493 | 3300048929 | Bacteria | 666 |
| 865 | Ga0496126_1379753 | 3300048929 | Unclassified | 510 |
| 866 | Ga0495682_0163941 | 3300049460 | Bacteria | 791 |
| 867 | Ga0501034_0317047 | 3300049571 | Bacteria | 1492 |
| 868 | Ga0501044_0260348 | 3300049823 | Bacteria | 1673 |
| 869 | nmdc:mga03683_130945_c1 | 3300050489 | Bacteria | 1122 |
| 870 | nmdc:mga03n38_576503_c1 | 3300050490 | Bacteria | 639 |
| 871 | nmdc:mga03n38_641608_c1 | 3300050490 | Bacteria | 608 |
| 872 | nmdc:mga00v17_355964_c1 | 3300050491 | Bacteria | 952 |
| 873 | nmdc:mga0yw44_1187532_c1 | 3300050492 | Bacteria | 515 |
| 874 | nmdc:mga0yw44_162553_c1 | 3300050492 | Bacteria | 1462 |
| 875 | nmdc:mga0yw44_259422_c1 | 3300050492 | Bacteria | 1158 |
| 876 | nmdc:mga0yw44_945852_c1 | 3300050492 | Bacteria | 584 |
| 877 | nmdc:mga0k408_133036_c1 | 3300050493 | Bacteria | 1477 |
| 878 | nmdc:mga06z11_160840_c1 | 3300050494 | Bacteria | 1283 |
| 879 | nmdc:mga06z11_779412_c1 | 3300050494 | Bacteria | 583 |
| 880 | nmdc:mga06z11_832089_c1 | 3300050494 | Bacteria | 562 |
| 881 | nmdc:mga07m45_506050_c1 | 3300050496 | Bacteria | 699 |
| 882 | nmdc:mga08y16_1965971_c1 | 3300050511 | Bacteria | 534 |
| 883 | nmdc:mga0sz30_179116_c1 | 3300050516 | Bacteria | 940 |
| 884 | Ga0495601_0016288 | 3300053077 | Bacteria | 4504 |
| 885 | Ga0495612_0262925 | 3300053078 | Bacteria | 769 |
| 886 | Ga0500635_0418585 | 3300053080 | Bacteria | 531 |
| 887 | Ga0500635_0425954 | 3300053080 | Bacteria | 526 |
| 888 | Ga0495655_0004786 | 3300053083 | Bacteria | 2344 |
| 889 | Ga0495595_0000335 | 3300053084 | Bacteria | 18133 |
| 890 | Ga0495619_0001292 | 3300053085 | Bacteria | 16456 |
| 891 | Ga0495619_0494582 | 3300053085 | Bacteria | 841 |
| 892 | Ga0500644_0516922 | 3300053088 | Bacteria | 526 |
| 893 | Ga0500583_0068458 | 3300053092 | Bacteria | 1693 |
| 894 | Ga0500651_0323447 | 3300053093 | Bacteria | 880 |
| 895 | Ga0500566_0011427 | 3300053094 | Bacteria | 5229 |
| 896 | Ga0500566_0493869 | 3300053094 | Bacteria | 528 |
| 897 | Ga0500640_215211 | 3300053095 | Bacteria | 655 |
| 898 | Ga0500641_0032365 | 3300053096 | Bacteria | 2068 |
| 899 | Ga0500641_0223095 | 3300053096 | Bacteria | 799 |
| 900 | Ga0500554_018197 | 3300053102 | Bacteria | 1892 |
| 901 | Ga0500555_139554 | 3300053103 | Bacteria | 598 |
| 902 | Ga0500556_0047237 | 3300053104 | Bacteria | 1544 |
| 903 | Ga0500562_063611 | 3300053108 | Bacteria | 992 |
| 904 | Ga0500569_326036 | 3300053109 | Bacteria | 513 |
| 905 | Ga0500592_089901 | 3300053116 | Bacteria | 515 |
| 906 | Ga0500594_0196453 | 3300053118 | Bacteria | 662 |
| 907 | Ga0500594_0230160 | 3300053118 | Bacteria | 614 |
| 908 | Ga0500595_000468 | 3300053119 | Bacteria | 24982 |
| 909 | Ga0500595_013495 | 3300053119 | Bacteria | 3128 |
| 910 | Ga0500595_025974 | 3300053119 | Bacteria | 2023 |
| 911 | Ga0500617_208270 | 3300053124 | Bacteria | 709 |
| 912 | Ga0500642_0112653 | 3300053130 | Bacteria | 1271 |
| 913 | Ga0500655_058888 | 3300053133 | Bacteria | 772 |
| 914 | Ga0500658_0130238 | 3300053134 | Bacteria | 1121 |
| 915 | Ga0500559_0145617 | 3300053136 | Bacteria | 1111 |
| 916 | Ga0500561_0204129 | 3300053137 | Bacteria | 625 |
| 917 | Ga0500568_0003017 | 3300053139 | Bacteria | 9628 |
| 918 | Ga0500568_0300981 | 3300053139 | Bacteria | 582 |
| 919 | Ga0500588_0303387 | 3300053146 | Bacteria | 604 |
| 920 | Ga0500589_111338 | 3300053147 | Bacteria | 1173 |
| 921 | Ga0500589_307102 | 3300053147 | Bacteria | 559 |
| 922 | Ga0500590_210120 | 3300053148 | Bacteria | 814 |
| 923 | Ga0500603_161253 | 3300053150 | Bacteria | 699 |
| 924 | Ga0500604_0317164 | 3300053151 | Bacteria | 541 |
| 925 | Ga0500622_0125384 | 3300053156 | Bacteria | 1241 |
| 926 | Ga0500622_0217827 | 3300053156 | Bacteria | 858 |
| 927 | Ga0500627_0131079 | 3300053158 | Bacteria | 1132 |
| 928 | Ga0500634_0306566 | 3300053161 | Bacteria | 627 |
| 929 | Ga0500638_002107 | 3300053162 | Bacteria | 6750 |
| 930 | Ga0500638_068294 | 3300053162 | Bacteria | 1702 |
| 931 | Ga0500636_0164781 | 3300053177 | Bacteria | 1205 |
| 932 | Ga0500637_0000546 | 3300053178 | Bacteria | 14728 |
| 933 | Ga0500637_0064084 | 3300053178 | Bacteria | 2108 |
| 934 | Ga0500637_0171751 | 3300053178 | Bacteria | 1246 |
| 935 | Ga0500611_141671 | 3300053727 | Bacteria | 655 |
| 936 | Ga0500609_028950 | 3300053731 | Bacteria | 760 |
| 937 | Ga0500656_003876 | 3300053732 | Bacteria | 1420 |
| 938 | Ga0500596_070711 | 3300053735 | Bacteria | 596 |
| 939 | Ga0501084_0203487 | 3300054114 | Bacteria | 1671 |
| 940 | Ga0500661_000782 | 3300055283 | Bacteria | 5933 |
| 941 | Ga0501082_0013785 | 3300060353 | Bacteria | 6950 |
| 942 | Ga0466962_0018323 | 3300061719 | Bacteria | 3367 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0260348 | Ga0501044_0260348_1508_1654 | 48 |
| 2 | 3300005563 | Ga0068855_100985620 | Ga0068855_1009856202 | 55 |
| 3 | 3300005578 | Ga0068854_100778395 | Ga0068854_1007783952 | 55 |
| 4 | 3300025949 | Ga0207667_11921973 | Ga0207667_119219732 | 55 |
| 5 | 3300025981 | Ga0207640_10041183 | Ga0207640_100411833 | 55 |
| 6 | 3300031712 | Ga0265342_10079738 | Ga0265342_100797382 | 55 |
| 7 | 3300005293 | Ga0065715_10748971 | Ga0065715_107489712 | 56 |
| 8 | 3300005329 | Ga0070683_101093560 | Ga0070683_1010935602 | 56 |
| 9 | 3300005365 | Ga0070688_100332589 | Ga0070688_1003325892 | 56 |
| 10 | 3300005539 | Ga0068853_100205235 | Ga0068853_1002052353 | 56 |
| 11 | 3300005544 | Ga0070686_101235180 | Ga0070686_1012351802 | 56 |
| 12 | 3300005615 | Ga0070702_100832092 | Ga0070702_1008320922 | 56 |
| 13 | 3300005618 | Ga0068864_101985841 | Ga0068864_1019858412 | 56 |
| 14 | 3300005718 | Ga0068866_10149422 | Ga0068866_101494222 | 56 |
| 15 | 3300005842 | Ga0068858_101559705 | Ga0068858_1015597052 | 56 |
| 16 | 3300006048 | Ga0075363_100831096 | Ga0075363_1008310962 | 56 |
| 17 | 3300006237 | Ga0097621_101183157 | Ga0097621_1011831572 | 56 |
| 18 | 3300009177 | Ga0105248_10034971 | Ga0105248_100349715 | 56 |
| 19 | 3300009545 | Ga0105237_10043449 | Ga0105237_100434494 | 56 |
| 20 | 3300009551 | Ga0105238_11570745 | Ga0105238_115707452 | 56 |
| 21 | 3300010375 | Ga0105239_10223977 | Ga0105239_102239773 | 56 |
| 22 | 3300011119 | Ga0105246_10834135 | Ga0105246_108341352 | 56 |
| 23 | 3300013306 | Ga0163162_12767914 | Ga0163162_127679142 | 56 |
| 24 | 3300014325 | Ga0163163_10341033 | Ga0163163_103410332 | 56 |
| 25 | 3300017792 | Ga0163161_10923186 | Ga0163161_109231861 | 56 |
| 26 | 3300017792 | Ga0163161_11988853 | Ga0163161_119888532 | 56 |
| 27 | 3300025315 | Ga0207697_10335915 | Ga0207697_103359152 | 56 |
| 28 | 3300025904 | Ga0207647_10726151 | Ga0207647_107261511 | 56 |
| 29 | 3300025924 | Ga0207694_10579713 | Ga0207694_105797132 | 56 |
| 30 | 3300025931 | Ga0207644_11004590 | Ga0207644_110045902 | 56 |
| 31 | 3300025937 | Ga0207669_10702625 | Ga0207669_107026252 | 56 |
| 32 | 3300025938 | Ga0207704_10931018 | Ga0207704_109310181 | 56 |
| 33 | 3300025941 | Ga0207711_10566025 | Ga0207711_105660252 | 56 |
| 34 | 3300026035 | Ga0207703_12076511 | Ga0207703_120765112 | 56 |
| 35 | 3300026041 | Ga0207639_10203783 | Ga0207639_102037832 | 56 |
| 36 | 3300026089 | Ga0207648_10550576 | Ga0207648_105505762 | 56 |
| 37 | 3300028381 | Ga0268264_12142705 | Ga0268264_121427052 | 56 |
| 38 | 3300034816 | Ga0373930_0043898 | Ga0373930_0043898_327_497 | 56 |
| 39 | 3300034957 | Ga0373938_0080798 | Ga0373938_0080798_334_504 | 56 |
| 40 | 3300035085 | Ga0373929_0064173 | Ga0373929_0064173_639_809 | 56 |
| 41 | 3300035089 | Ga0373944_0117981 | Ga0373944_0117981_135_305 | 56 |
| 42 | 3300035171 | Ga0373946_0078970 | Ga0373946_0078970_866_1036 | 56 |
| 43 | 3300035207 | Ga0373942_0040611 | Ga0373942_0040611_1031_1201 | 56 |
| 44 | 3300035241 | Ga0373961_0122618 | Ga0373961_0122618_94_264 | 56 |
| 45 | 3300035691 | Ga0373931_0050522 | Ga0373931_0050522_1591_1761 | 56 |
| 46 | 3300035692 | Ga0373935_0103925 | Ga0373935_0103925_598_768 | 56 |
| 47 | 3300035695 | Ga0373927_0054881 | Ga0373927_0054881_1031_1201 | 56 |
| 48 | 3300035725 | Ga0373947_0706203 | Ga0373947_0706203_488_658 | 56 |
| 49 | 3300036459 | Ga0372808_001672 | Ga0372808_001672_551_721 | 56 |
| 50 | 3300046515 | Ga0495620_0415190 | Ga0495620_0415190_114_284 | 56 |
| 51 | 3300046660 | Ga0495625_0427815 | Ga0495625_0427815_136_306 | 56 |
| 52 | 3300046663 | Ga0495635_0534498 | Ga0495635_0534498_41_220 | 56 |
| 53 | 3300047319 | Ga0495674_0269727 | Ga0495674_0269727_255_425 | 56 |
| 54 | 3300048903 | Ga0496100_0013579 | Ga0496100_0013579_1330_1500 | 56 |
| 55 | 3300048904 | Ga0496101_0328408 | Ga0496101_0328408_552_722 | 56 |
| 56 | 3300048905 | Ga0496102_0037392 | Ga0496102_0037392_1927_2097 | 56 |
| 57 | 3300048907 | Ga0496104_1502371 | Ga0496104_1502371_155_325 | 56 |
| 58 | 3300048908 | Ga0496105_0101141 | Ga0496105_0101141_713_883 | 56 |
| 59 | 3300048909 | Ga0496106_0132381 | Ga0496106_0132381_681_851 | 56 |
| 60 | 3300048910 | Ga0496107_0112310 | Ga0496107_0112310_1116_1286 | 56 |
| 61 | 3300048911 | Ga0496108_0449741 | Ga0496108_0449741_749_919 | 56 |
| 62 | 3300048912 | Ga0496109_0471486 | Ga0496109_0471486_159_329 | 56 |
| 63 | 3300048913 | Ga0496110_0173863 | Ga0496110_0173863_506_676 | 56 |
| 64 | 3300048915 | Ga0496112_0109577 | Ga0496112_0109577_249_419 | 56 |
| 65 | 3300048916 | Ga0496113_1489394 | Ga0496113_1489394_243_413 | 56 |
| 66 | 3300048917 | Ga0496114_0108754 | Ga0496114_0108754_137_307 | 56 |
| 67 | 3300048918 | Ga0496115_0009019 | Ga0496115_0009019_7173_7343 | 56 |
| 68 | 3300048925 | Ga0496122_0011608 | Ga0496122_0011608_1529_1699 | 56 |
| 69 | 3300048926 | Ga0496123_0115403 | Ga0496123_0115403_350_520 | 56 |
| 70 | 3300048929 | Ga0496126_0003590 | Ga0496126_0003590_7457_7627 | 56 |
| 71 | 3300053078 | Ga0495612_0262925 | Ga0495612_0262925_161_331 | 56 |
| 72 | 3300053085 | Ga0495619_0494582 | Ga0495619_0494582_68_238 | 56 |
| 73 | 3300003659 | JGI25404J52841_10000254 | JGI25404J52841_100002545 | 57 |
| 74 | 3300005937 | Ga0081455_10208227 | Ga0081455_102082272 | 57 |
| 75 | 3300005983 | Ga0081540_1003838 | Ga0081540_10038387 | 57 |
| 76 | 3300005983 | Ga0081540_1005208 | Ga0081540_10052086 | 57 |
| 77 | 3300013102 | Ga0157371_10027801 | Ga0157371_100278012 | 57 |
| 78 | 3300013105 | Ga0157369_10000808 | Ga0157369_1000080834 | 57 |
| 79 | 3300031730 | Ga0307516_10999018 | Ga0307516_109990181 | 57 |
| 80 | 3300035113 | Ga0373936_0061770 | Ga0373936_0061770_834_1013 | 57 |
| 81 | 3300037312 | Ga0395899_0037652 | Ga0395899_0037652_971_1144 | 57 |
| 82 | 3300037418 | Ga0395900_0077073 | Ga0395900_0077073_1798_1971 | 57 |
| 83 | 3300037466 | Ga0395898_0012584 | Ga0395898_0012584_5372_5545 | 57 |
| 84 | 3300037471 | Ga0395905_0392592 | Ga0395905_0392592_454_627 | 57 |
| 85 | 3300038443 | Ga0395901_0007409 | Ga0395901_0007409_2469_2642 | 57 |
| 86 | 3300003215 | JGI25153J46596_10004677 | JGI25153J46596_100046774 | 58 |
| 87 | 3300005327 | Ga0070658_10075593 | Ga0070658_100755933 | 58 |
| 88 | 3300005327 | Ga0070658_10295883 | Ga0070658_102958831 | 58 |
| 89 | 3300005327 | Ga0070658_10944468 | Ga0070658_109444682 | 58 |
| 90 | 3300005327 | Ga0070658_11518580 | Ga0070658_115185802 | 58 |
| 91 | 3300005328 | Ga0070676_10492300 | Ga0070676_104923002 | 58 |
| 92 | 3300005328 | Ga0070676_10536251 | Ga0070676_105362512 | 58 |
| 93 | 3300005329 | Ga0070683_100086605 | Ga0070683_1000866052 | 58 |
| 94 | 3300005330 | Ga0070690_100352478 | Ga0070690_1003524782 | 58 |
| 95 | 3300005330 | Ga0070690_100704672 | Ga0070690_1007046722 | 58 |
| 96 | 3300005331 | Ga0070670_100109295 | Ga0070670_1001092952 | 58 |
| 97 | 3300005331 | Ga0070670_100433001 | Ga0070670_1004330012 | 58 |
| 98 | 3300005333 | Ga0070677_10647422 | Ga0070677_106474222 | 58 |
| 99 | 3300005334 | Ga0068869_100017200 | Ga0068869_1000172005 | 58 |
| 100 | 3300005334 | Ga0068869_100181849 | Ga0068869_1001818492 | 58 |
| 101 | 3300005334 | Ga0068869_100830396 | Ga0068869_1008303962 | 58 |
| 102 | 3300005335 | Ga0070666_10359545 | Ga0070666_103595452 | 58 |
| 103 | 3300005335 | Ga0070666_10449063 | Ga0070666_104490631 | 58 |
| 104 | 3300005335 | Ga0070666_10450053 | Ga0070666_104500532 | 58 |
| 105 | 3300005336 | Ga0070680_100043042 | Ga0070680_1000430424 | 58 |
| 106 | 3300005337 | Ga0070682_100042469 | Ga0070682_1000424693 | 58 |
| 107 | 3300005337 | Ga0070682_100157416 | Ga0070682_1001574162 | 58 |
| 108 | 3300005338 | Ga0068868_100006547 | Ga0068868_1000065473 | 58 |
| 109 | 3300005338 | Ga0068868_100069042 | Ga0068868_1000690422 | 58 |
| 110 | 3300005338 | Ga0068868_100203216 | Ga0068868_1002032162 | 58 |
| 111 | 3300005340 | Ga0070689_100230654 | Ga0070689_1002306543 | 58 |
| 112 | 3300005340 | Ga0070689_100543029 | Ga0070689_1005430292 | 58 |
| 113 | 3300005340 | Ga0070689_100574766 | Ga0070689_1005747663 | 58 |
| 114 | 3300005341 | Ga0070691_10111683 | Ga0070691_101116831 | 58 |
| 115 | 3300005344 | Ga0070661_100558505 | Ga0070661_1005585052 | 58 |
| 116 | 3300005344 | Ga0070661_100985189 | Ga0070661_1009851892 | 58 |
| 117 | 3300005345 | Ga0070692_10372284 | Ga0070692_103722842 | 58 |
| 118 | 3300005347 | Ga0070668_100045256 | Ga0070668_1000452563 | 58 |
| 119 | 3300005347 | Ga0070668_100104644 | Ga0070668_1001046443 | 58 |
| 120 | 3300005347 | Ga0070668_100182551 | Ga0070668_1001825512 | 58 |
| 121 | 3300005347 | Ga0070668_100320697 | Ga0070668_1003206972 | 58 |
| 122 | 3300005347 | Ga0070668_100409293 | Ga0070668_1004092932 | 58 |
| 123 | 3300005347 | Ga0070668_100673548 | Ga0070668_1006735482 | 58 |
| 124 | 3300005347 | Ga0070668_100871306 | Ga0070668_1008713062 | 58 |
| 125 | 3300005353 | Ga0070669_100971608 | Ga0070669_1009716081 | 58 |
| 126 | 3300005353 | Ga0070669_102052703 | Ga0070669_1020527032 | 58 |
| 127 | 3300005354 | Ga0070675_102234345 | Ga0070675_1022343451 | 58 |
| 128 | 3300005355 | Ga0070671_100267604 | Ga0070671_1002676042 | 58 |
| 129 | 3300005355 | Ga0070671_100880541 | Ga0070671_1008805412 | 58 |
| 130 | 3300005355 | Ga0070671_100907065 | Ga0070671_1009070652 | 58 |
| 131 | 3300005356 | Ga0070674_100021173 | Ga0070674_1000211733 | 58 |
| 132 | 3300005356 | Ga0070674_100142087 | Ga0070674_1001420873 | 58 |
| 133 | 3300005356 | Ga0070674_100406354 | Ga0070674_1004063542 | 58 |
| 134 | 3300005356 | Ga0070674_101206939 | Ga0070674_1012069392 | 58 |
| 135 | 3300005364 | Ga0070673_100059256 | Ga0070673_1000592564 | 58 |
| 136 | 3300005364 | Ga0070673_100150917 | Ga0070673_1001509173 | 58 |
| 137 | 3300005364 | Ga0070673_101663386 | Ga0070673_1016633862 | 58 |
| 138 | 3300005365 | Ga0070688_100239557 | Ga0070688_1002395572 | 58 |
| 139 | 3300005365 | Ga0070688_101601867 | Ga0070688_1016018672 | 58 |
| 140 | 3300005366 | Ga0070659_100302808 | Ga0070659_1003028082 | 58 |
| 141 | 3300005366 | Ga0070659_100483469 | Ga0070659_1004834692 | 58 |
| 142 | 3300005367 | Ga0070667_100244921 | Ga0070667_1002449213 | 58 |
| 143 | 3300005367 | Ga0070667_100748564 | Ga0070667_1007485642 | 58 |
| 144 | 3300005367 | Ga0070667_100830546 | Ga0070667_1008305462 | 58 |
| 145 | 3300005367 | Ga0070667_100885727 | Ga0070667_1008857272 | 58 |
| 146 | 3300005367 | Ga0070667_101507393 | Ga0070667_1015073932 | 58 |
| 147 | 3300005434 | Ga0070709_10554080 | Ga0070709_105540802 | 58 |
| 148 | 3300005435 | Ga0070714_101245849 | Ga0070714_1012458492 | 58 |
| 149 | 3300005436 | Ga0070713_101550238 | Ga0070713_1015502382 | 58 |
| 150 | 3300005438 | Ga0070701_10104741 | Ga0070701_101047413 | 58 |
| 151 | 3300005438 | Ga0070701_10150986 | Ga0070701_101509862 | 58 |
| 152 | 3300005439 | Ga0070711_100150626 | Ga0070711_1001506262 | 58 |
| 153 | 3300005440 | Ga0070705_100798108 | Ga0070705_1007981082 | 58 |
| 154 | 3300005441 | Ga0070700_100396324 | Ga0070700_1003963242 | 58 |
| 155 | 3300005444 | Ga0070694_100626303 | Ga0070694_1006263031 | 58 |
| 156 | 3300005455 | Ga0070663_100016240 | Ga0070663_1000162402 | 58 |
| 157 | 3300005455 | Ga0070663_100020052 | Ga0070663_1000200523 | 58 |
| 158 | 3300005455 | Ga0070663_100123056 | Ga0070663_1001230563 | 58 |
| 159 | 3300005455 | Ga0070663_100437512 | Ga0070663_1004375122 | 58 |
| 160 | 3300005455 | Ga0070663_100596433 | Ga0070663_1005964332 | 58 |
| 161 | 3300005455 | Ga0070663_101660418 | Ga0070663_1016604182 | 58 |
| 162 | 3300005455 | Ga0070663_101930476 | Ga0070663_1019304762 | 58 |
| 163 | 3300005456 | Ga0070678_100003659 | Ga0070678_1000036593 | 58 |
| 164 | 3300005456 | Ga0070678_100017610 | Ga0070678_1000176105 | 58 |
| 165 | 3300005456 | Ga0070678_100037277 | Ga0070678_1000372774 | 58 |
| 166 | 3300005456 | Ga0070678_100067668 | Ga0070678_1000676682 | 58 |
| 167 | 3300005457 | Ga0070662_100035529 | Ga0070662_1000355292 | 58 |
| 168 | 3300005457 | Ga0070662_100534799 | Ga0070662_1005347992 | 58 |
| 169 | 3300005457 | Ga0070662_101609019 | Ga0070662_1016090192 | 58 |
| 170 | 3300005458 | Ga0070681_10058589 | Ga0070681_100585892 | 58 |
| 171 | 3300005458 | Ga0070681_10706778 | Ga0070681_107067782 | 58 |
| 172 | 3300005459 | Ga0068867_100049914 | Ga0068867_1000499143 | 58 |
| 173 | 3300005459 | Ga0068867_100709248 | Ga0068867_1007092482 | 58 |
| 174 | 3300005466 | Ga0070685_10181990 | Ga0070685_101819902 | 58 |
| 175 | 3300005467 | Ga0070706_100366354 | Ga0070706_1003663541 | 58 |
| 176 | 3300005518 | Ga0070699_100857343 | Ga0070699_1008573431 | 58 |
| 177 | 3300005518 | Ga0070699_102180762 | Ga0070699_1021807621 | 58 |
| 178 | 3300005530 | Ga0070679_100021982 | Ga0070679_1000219827 | 58 |
| 179 | 3300005530 | Ga0070679_102074267 | Ga0070679_1020742672 | 58 |
| 180 | 3300005535 | Ga0070684_100132369 | Ga0070684_1001323693 | 58 |
| 181 | 3300005535 | Ga0070684_101966184 | Ga0070684_1019661842 | 58 |
| 182 | 3300005536 | Ga0070697_102008836 | Ga0070697_1020088361 | 58 |
| 183 | 3300005539 | Ga0068853_100014537 | Ga0068853_1000145376 | 58 |
| 184 | 3300005539 | Ga0068853_100391277 | Ga0068853_1003912772 | 58 |
| 185 | 3300005539 | Ga0068853_102007754 | Ga0068853_1020077542 | 58 |
| 186 | 3300005543 | Ga0070672_100215342 | Ga0070672_1002153423 | 58 |
| 187 | 3300005543 | Ga0070672_100670484 | Ga0070672_1006704841 | 58 |
| 188 | 3300005543 | Ga0070672_100882149 | Ga0070672_1008821492 | 58 |
| 189 | 3300005543 | Ga0070672_101204631 | Ga0070672_1012046312 | 58 |
| 190 | 3300005544 | Ga0070686_100177039 | Ga0070686_1001770392 | 58 |
| 191 | 3300005544 | Ga0070686_100573155 | Ga0070686_1005731552 | 58 |
| 192 | 3300005544 | Ga0070686_100643605 | Ga0070686_1006436051 | 58 |
| 193 | 3300005546 | Ga0070696_100348194 | Ga0070696_1003481941 | 58 |
| 194 | 3300005547 | Ga0070693_100091362 | Ga0070693_1000913623 | 58 |
| 195 | 3300005548 | Ga0070665_100069675 | Ga0070665_1000696755 | 58 |
| 196 | 3300005548 | Ga0070665_100203937 | Ga0070665_1002039373 | 58 |
| 197 | 3300005548 | Ga0070665_100358774 | Ga0070665_1003587742 | 58 |
| 198 | 3300005549 | Ga0070704_100137670 | Ga0070704_1001376703 | 58 |
| 199 | 3300005563 | Ga0068855_100014574 | Ga0068855_1000145748 | 58 |
| 200 | 3300005563 | Ga0068855_100066675 | Ga0068855_1000666753 | 58 |
| 201 | 3300005563 | Ga0068855_101197574 | Ga0068855_1011975742 | 58 |
| 202 | 3300005564 | Ga0070664_100021262 | Ga0070664_1000212625 | 58 |
| 203 | 3300005577 | Ga0068857_102144183 | Ga0068857_1021441832 | 58 |
| 204 | 3300005578 | Ga0068854_100587721 | Ga0068854_1005877211 | 58 |
| 205 | 3300005614 | Ga0068856_100489788 | Ga0068856_1004897882 | 58 |
| 206 | 3300005614 | Ga0068856_100832589 | Ga0068856_1008325892 | 58 |
| 207 | 3300005614 | Ga0068856_100907486 | Ga0068856_1009074862 | 58 |
| 208 | 3300005615 | Ga0070702_100061421 | Ga0070702_1000614213 | 58 |
| 209 | 3300005615 | Ga0070702_100630948 | Ga0070702_1006309482 | 58 |
| 210 | 3300005616 | Ga0068852_100022692 | Ga0068852_1000226925 | 58 |
| 211 | 3300005616 | Ga0068852_100223284 | Ga0068852_1002232842 | 58 |
| 212 | 3300005616 | Ga0068852_100772596 | Ga0068852_1007725962 | 58 |
| 213 | 3300005616 | Ga0068852_101379056 | Ga0068852_1013790562 | 58 |
| 214 | 3300005617 | Ga0068859_100237233 | Ga0068859_1002372333 | 58 |
| 215 | 3300005617 | Ga0068859_102459925 | Ga0068859_1024599252 | 58 |
| 216 | 3300005618 | Ga0068864_100073671 | Ga0068864_1000736713 | 58 |
| 217 | 3300005718 | Ga0068866_10195073 | Ga0068866_101950732 | 58 |
| 218 | 3300005718 | Ga0068866_10319886 | Ga0068866_103198862 | 58 |
| 219 | 3300005718 | Ga0068866_10857445 | Ga0068866_108574452 | 58 |
| 220 | 3300005719 | Ga0068861_100052716 | Ga0068861_1000527163 | 58 |
| 221 | 3300005719 | Ga0068861_100259325 | Ga0068861_1002593253 | 58 |
| 222 | 3300005719 | Ga0068861_101148943 | Ga0068861_1011489431 | 58 |
| 223 | 3300005719 | Ga0068861_101801330 | Ga0068861_1018013302 | 58 |
| 224 | 3300005719 | Ga0068861_102322041 | Ga0068861_1023220412 | 58 |
| 225 | 3300005834 | Ga0068851_10383285 | Ga0068851_103832852 | 58 |
| 226 | 3300005834 | Ga0068851_10499761 | Ga0068851_104997611 | 58 |
| 227 | 3300005840 | Ga0068870_10088952 | Ga0068870_100889522 | 58 |
| 228 | 3300005841 | Ga0068863_100133864 | Ga0068863_1001338642 | 58 |
| 229 | 3300005841 | Ga0068863_101629419 | Ga0068863_1016294192 | 58 |
| 230 | 3300005842 | Ga0068858_100023425 | Ga0068858_1000234254 | 58 |
| 231 | 3300005842 | Ga0068858_100060057 | Ga0068858_1000600573 | 58 |
| 232 | 3300005842 | Ga0068858_100514881 | Ga0068858_1005148811 | 58 |
| 233 | 3300005842 | Ga0068858_100938665 | Ga0068858_1009386652 | 58 |
| 234 | 3300005842 | Ga0068858_101650519 | Ga0068858_1016505191 | 58 |
| 235 | 3300005843 | Ga0068860_100292362 | Ga0068860_1002923622 | 58 |
| 236 | 3300005843 | Ga0068860_101077622 | Ga0068860_1010776222 | 58 |
| 237 | 3300005843 | Ga0068860_102009637 | Ga0068860_1020096372 | 58 |
| 238 | 3300005844 | Ga0068862_100145699 | Ga0068862_1001456993 | 58 |
| 239 | 3300005844 | Ga0068862_100502129 | Ga0068862_1005021291 | 58 |
| 240 | 3300005844 | Ga0068862_101100731 | Ga0068862_1011007312 | 58 |
| 241 | 3300005844 | Ga0068862_101222327 | Ga0068862_1012223272 | 58 |
| 242 | 3300005937 | Ga0081455_10000895 | Ga0081455_1000089540 | 58 |
| 243 | 3300005983 | Ga0081540_1002053 | Ga0081540_100205317 | 58 |
| 244 | 3300005983 | Ga0081540_1007807 | Ga0081540_10078073 | 58 |
| 245 | 3300005983 | Ga0081540_1011448 | Ga0081540_10114485 | 58 |
| 246 | 3300005983 | Ga0081540_1053737 | Ga0081540_10537373 | 58 |
| 247 | 3300005983 | Ga0081540_1315350 | Ga0081540_13153502 | 58 |
| 248 | 3300006028 | Ga0070717_10331799 | Ga0070717_103317992 | 58 |
| 249 | 3300006028 | Ga0070717_11674234 | Ga0070717_116742342 | 58 |
| 250 | 3300006038 | Ga0075365_10031510 | Ga0075365_100315105 | 58 |
| 251 | 3300006038 | Ga0075365_10114109 | Ga0075365_101141092 | 58 |
| 252 | 3300006042 | Ga0075368_10002535 | Ga0075368_100025353 | 58 |
| 253 | 3300006048 | Ga0075363_100084189 | Ga0075363_1000841893 | 58 |
| 254 | 3300006051 | Ga0075364_10040099 | Ga0075364_100400994 | 58 |
| 255 | 3300006173 | Ga0070716_100564558 | Ga0070716_1005645582 | 58 |
| 256 | 3300006175 | Ga0070712_100098016 | Ga0070712_1000980162 | 58 |
| 257 | 3300006175 | Ga0070712_100736895 | Ga0070712_1007368952 | 58 |
| 258 | 3300006177 | Ga0075362_10062304 | Ga0075362_100623043 | 58 |
| 259 | 3300006177 | Ga0075362_10191086 | Ga0075362_101910863 | 58 |
| 260 | 3300006177 | Ga0075362_10305662 | Ga0075362_103056622 | 58 |
| 261 | 3300006178 | Ga0075367_10032918 | Ga0075367_100329181 | 58 |
| 262 | 3300006178 | Ga0075367_10165209 | Ga0075367_101652093 | 58 |
| 263 | 3300006178 | Ga0075367_10546170 | Ga0075367_105461702 | 58 |
| 264 | 3300006186 | Ga0075369_10145910 | Ga0075369_101459102 | 58 |
| 265 | 3300006195 | Ga0075366_10155615 | Ga0075366_101556152 | 58 |
| 266 | 3300006237 | Ga0097621_100045438 | Ga0097621_1000454384 | 58 |
| 267 | 3300006237 | Ga0097621_100097225 | Ga0097621_1000972252 | 58 |
| 268 | 3300006237 | Ga0097621_102332976 | Ga0097621_1023329762 | 58 |
| 269 | 3300006353 | Ga0075370_10114646 | Ga0075370_101146462 | 58 |
| 270 | 3300006358 | Ga0068871_100031318 | Ga0068871_1000313183 | 58 |
| 271 | 3300006358 | Ga0068871_100563371 | Ga0068871_1005633712 | 58 |
| 272 | 3300006871 | Ga0075434_100207988 | Ga0075434_1002079882 | 58 |
| 273 | 3300006881 | Ga0068865_100039829 | Ga0068865_1000398293 | 58 |
| 274 | 3300006881 | Ga0068865_100442397 | Ga0068865_1004423972 | 58 |
| 275 | 3300006881 | Ga0068865_101867429 | Ga0068865_1018674292 | 58 |
| 276 | 3300006931 | Ga0097620_100237229 | Ga0097620_1002372292 | 58 |
| 277 | 3300006931 | Ga0097620_102459913 | Ga0097620_1024599132 | 58 |
| 278 | 3300007076 | Ga0075435_100040178 | Ga0075435_1000401783 | 58 |
| 279 | 3300007788 | Ga0099795_10001567 | Ga0099795_100015673 | 58 |
| 280 | 3300007788 | Ga0099795_10333478 | Ga0099795_103334781 | 58 |
| 281 | 3300009011 | Ga0105251_10099205 | Ga0105251_100992052 | 58 |
| 282 | 3300009093 | Ga0105240_10445166 | Ga0105240_104451662 | 58 |
| 283 | 3300009093 | Ga0105240_10696767 | Ga0105240_106967672 | 58 |
| 284 | 3300009094 | Ga0111539_11695168 | Ga0111539_116951682 | 58 |
| 285 | 3300009098 | Ga0105245_10027787 | Ga0105245_100277873 | 58 |
| 286 | 3300009098 | Ga0105245_10266547 | Ga0105245_102665473 | 58 |
| 287 | 3300009101 | Ga0105247_10121527 | Ga0105247_101215272 | 58 |
| 288 | 3300009101 | Ga0105247_10431196 | Ga0105247_104311962 | 58 |
| 289 | 3300009101 | Ga0105247_10981074 | Ga0105247_109810742 | 58 |
| 290 | 3300009148 | Ga0105243_10011026 | Ga0105243_100110263 | 58 |
| 291 | 3300009148 | Ga0105243_10104731 | Ga0105243_101047312 | 58 |
| 292 | 3300009148 | Ga0105243_11376315 | Ga0105243_113763152 | 58 |
| 293 | 3300009148 | Ga0105243_12011325 | Ga0105243_120113252 | 58 |
| 294 | 3300009174 | Ga0105241_11128652 | Ga0105241_111286522 | 58 |
| 295 | 3300009176 | Ga0105242_10483835 | Ga0105242_104838352 | 58 |
| 296 | 3300009176 | Ga0105242_10921034 | Ga0105242_109210342 | 58 |
| 297 | 3300009176 | Ga0105242_11784149 | Ga0105242_117841492 | 58 |
| 298 | 3300009176 | Ga0105242_11855893 | Ga0105242_118558932 | 58 |
| 299 | 3300009176 | Ga0105242_11930074 | Ga0105242_119300742 | 58 |
| 300 | 3300009177 | Ga0105248_10578130 | Ga0105248_105781302 | 58 |
| 301 | 3300009177 | Ga0105248_11000293 | Ga0105248_110002932 | 58 |
| 302 | 3300009177 | Ga0105248_12066583 | Ga0105248_120665832 | 58 |
| 303 | 3300009545 | Ga0105237_10167236 | Ga0105237_101672363 | 58 |
| 304 | 3300009545 | Ga0105237_10412156 | Ga0105237_104121562 | 58 |
| 305 | 3300009545 | Ga0105237_11690252 | Ga0105237_116902522 | 58 |
| 306 | 3300009545 | Ga0105237_12131593 | Ga0105237_121315931 | 58 |
| 307 | 3300009551 | Ga0105238_10380360 | Ga0105238_103803602 | 58 |
| 308 | 3300009551 | Ga0105238_10822089 | Ga0105238_108220892 | 58 |
| 309 | 3300009551 | Ga0105238_11643913 | Ga0105238_116439131 | 58 |
| 310 | 3300009553 | Ga0105249_10071994 | Ga0105249_100719943 | 58 |
| 311 | 3300009553 | Ga0105249_12135119 | Ga0105249_121351192 | 58 |
| 312 | 3300010375 | Ga0105239_10010954 | Ga0105239_100109545 | 58 |
| 313 | 3300010375 | Ga0105239_10120429 | Ga0105239_101204293 | 58 |
| 314 | 3300010375 | Ga0105239_10320168 | Ga0105239_103201682 | 58 |
| 315 | 3300010375 | Ga0105239_12453475 | Ga0105239_124534751 | 58 |
| 316 | 3300010375 | Ga0105239_12647613 | Ga0105239_126476132 | 58 |
| 317 | 3300011119 | Ga0105246_10037993 | Ga0105246_100379932 | 58 |
| 318 | 3300013100 | Ga0157373_10514487 | Ga0157373_105144872 | 58 |
| 319 | 3300013104 | Ga0157370_10034059 | Ga0157370_100340595 | 58 |
| 320 | 3300013296 | Ga0157374_10003326 | Ga0157374_100033264 | 58 |
| 321 | 3300013296 | Ga0157374_10266765 | Ga0157374_102667652 | 58 |
| 322 | 3300013296 | Ga0157374_10721465 | Ga0157374_107214652 | 58 |
| 323 | 3300013297 | Ga0157378_10260553 | Ga0157378_102605532 | 58 |
| 324 | 3300013297 | Ga0157378_10745098 | Ga0157378_107450982 | 58 |
| 325 | 3300013297 | Ga0157378_10793243 | Ga0157378_107932432 | 58 |
| 326 | 3300013297 | Ga0157378_10816321 | Ga0157378_108163212 | 58 |
| 327 | 3300013306 | Ga0163162_10015168 | Ga0163162_100151682 | 58 |
| 328 | 3300013306 | Ga0163162_10055092 | Ga0163162_100550923 | 58 |
| 329 | 3300013306 | Ga0163162_10116218 | Ga0163162_101162183 | 58 |
| 330 | 3300013306 | Ga0163162_11248021 | Ga0163162_112480212 | 58 |
| 331 | 3300013306 | Ga0163162_12015453 | Ga0163162_120154532 | 58 |
| 332 | 3300013308 | Ga0157375_10008539 | Ga0157375_1000853911 | 58 |
| 333 | 3300013308 | Ga0157375_10114306 | Ga0157375_101143063 | 58 |
| 334 | 3300013308 | Ga0157375_10309505 | Ga0157375_103095053 | 58 |
| 335 | 3300013308 | Ga0157375_11563643 | Ga0157375_115636432 | 58 |
| 336 | 3300014325 | Ga0163163_10007553 | Ga0163163_100075534 | 58 |
| 337 | 3300014325 | Ga0163163_10607263 | Ga0163163_106072632 | 58 |
| 338 | 3300014325 | Ga0163163_12792390 | Ga0163163_127923902 | 58 |
| 339 | 3300014326 | Ga0157380_12592928 | Ga0157380_125929282 | 58 |
| 340 | 3300014745 | Ga0157377_10369659 | Ga0157377_103696592 | 58 |
| 341 | 3300014745 | Ga0157377_10420363 | Ga0157377_104203632 | 58 |
| 342 | 3300014745 | Ga0157377_10426601 | Ga0157377_104266012 | 58 |
| 343 | 3300014968 | Ga0157379_10385425 | Ga0157379_103854253 | 58 |
| 344 | 3300014968 | Ga0157379_10463328 | Ga0157379_104633282 | 58 |
| 345 | 3300014968 | Ga0157379_11760015 | Ga0157379_117600152 | 58 |
| 346 | 3300014969 | Ga0157376_10017469 | Ga0157376_100174693 | 58 |
| 347 | 3300014969 | Ga0157376_10645767 | Ga0157376_106457673 | 58 |
| 348 | 3300014969 | Ga0157376_10768259 | Ga0157376_107682592 | 58 |
| 349 | 3300014969 | Ga0157376_10919498 | Ga0157376_109194982 | 58 |
| 350 | 3300017792 | Ga0163161_10123768 | Ga0163161_101237682 | 58 |
| 351 | 3300017792 | Ga0163161_10779376 | Ga0163161_107793762 | 58 |
| 352 | 3300017792 | Ga0163161_11426617 | Ga0163161_114266172 | 58 |
| 353 | 3300025297 | Ga0209758_1003142 | Ga0209758_100314214 | 58 |
| 354 | 3300025315 | Ga0207697_10062646 | Ga0207697_100626462 | 58 |
| 355 | 3300025321 | Ga0207656_10149549 | Ga0207656_101495492 | 58 |
| 356 | 3300025885 | Ga0207653_10195040 | Ga0207653_101950402 | 58 |
| 357 | 3300025898 | Ga0207692_10587239 | Ga0207692_105872391 | 58 |
| 358 | 3300025899 | Ga0207642_10057363 | Ga0207642_100573632 | 58 |
| 359 | 3300025900 | Ga0207710_10071000 | Ga0207710_100710003 | 58 |
| 360 | 3300025900 | Ga0207710_10292122 | Ga0207710_102921222 | 58 |
| 361 | 3300025901 | Ga0207688_10030058 | Ga0207688_100300582 | 58 |
| 362 | 3300025901 | Ga0207688_10104915 | Ga0207688_101049152 | 58 |
| 363 | 3300025903 | Ga0207680_10259017 | Ga0207680_102590172 | 58 |
| 364 | 3300025903 | Ga0207680_10421109 | Ga0207680_104211092 | 58 |
| 365 | 3300025904 | Ga0207647_10564080 | Ga0207647_105640802 | 58 |
| 366 | 3300025905 | Ga0207685_10078092 | Ga0207685_100780922 | 58 |
| 367 | 3300025906 | Ga0207699_10464097 | Ga0207699_104640972 | 58 |
| 368 | 3300025907 | Ga0207645_10401305 | Ga0207645_104013051 | 58 |
| 369 | 3300025907 | Ga0207645_10821891 | Ga0207645_108218911 | 58 |
| 370 | 3300025908 | Ga0207643_10033308 | Ga0207643_100333083 | 58 |
| 371 | 3300025909 | Ga0207705_10057990 | Ga0207705_100579902 | 58 |
| 372 | 3300025909 | Ga0207705_10113468 | Ga0207705_101134682 | 58 |
| 373 | 3300025909 | Ga0207705_10357462 | Ga0207705_103574622 | 58 |
| 374 | 3300025909 | Ga0207705_10642038 | Ga0207705_106420382 | 58 |
| 375 | 3300025910 | Ga0207684_10575771 | Ga0207684_105757711 | 58 |
| 376 | 3300025911 | Ga0207654_10372332 | Ga0207654_103723322 | 58 |
| 377 | 3300025912 | Ga0207707_10306841 | Ga0207707_103068412 | 58 |
| 378 | 3300025912 | Ga0207707_10798221 | Ga0207707_107982211 | 58 |
| 379 | 3300025913 | Ga0207695_10137206 | Ga0207695_101372062 | 58 |
| 380 | 3300025914 | Ga0207671_10370802 | Ga0207671_103708022 | 58 |
| 381 | 3300025914 | Ga0207671_10424414 | Ga0207671_104244142 | 58 |
| 382 | 3300025915 | Ga0207693_10050481 | Ga0207693_100504812 | 58 |
| 383 | 3300025915 | Ga0207693_10066564 | Ga0207693_100665642 | 58 |
| 384 | 3300025916 | Ga0207663_10867856 | Ga0207663_108678562 | 58 |
| 385 | 3300025917 | Ga0207660_10163892 | Ga0207660_101638922 | 58 |
| 386 | 3300025917 | Ga0207660_11317332 | Ga0207660_113173322 | 58 |
| 387 | 3300025918 | Ga0207662_10143963 | Ga0207662_101439632 | 58 |
| 388 | 3300025919 | Ga0207657_10527779 | Ga0207657_105277792 | 58 |
| 389 | 3300025920 | Ga0207649_10802599 | Ga0207649_108025992 | 58 |
| 390 | 3300025920 | Ga0207649_11052109 | Ga0207649_110521092 | 58 |
| 391 | 3300025921 | Ga0207652_10156528 | Ga0207652_101565282 | 58 |
| 392 | 3300025922 | Ga0207646_11119044 | Ga0207646_111190442 | 58 |
| 393 | 3300025923 | Ga0207681_10337974 | Ga0207681_103379742 | 58 |
| 394 | 3300025923 | Ga0207681_11028151 | Ga0207681_110281512 | 58 |
| 395 | 3300025924 | Ga0207694_10471411 | Ga0207694_104714112 | 58 |
| 396 | 3300025925 | Ga0207650_11098057 | Ga0207650_110980572 | 58 |
| 397 | 3300025927 | Ga0207687_10023036 | Ga0207687_100230366 | 58 |
| 398 | 3300025927 | Ga0207687_10075061 | Ga0207687_100750613 | 58 |
| 399 | 3300025931 | Ga0207644_10119591 | Ga0207644_101195912 | 58 |
| 400 | 3300025932 | Ga0207690_10299993 | Ga0207690_102999932 | 58 |
| 401 | 3300025932 | Ga0207690_10962236 | Ga0207690_109622362 | 58 |
| 402 | 3300025932 | Ga0207690_11162511 | Ga0207690_111625112 | 58 |
| 403 | 3300025933 | Ga0207706_10060448 | Ga0207706_100604484 | 58 |
| 404 | 3300025933 | Ga0207706_10250929 | Ga0207706_102509293 | 58 |
| 405 | 3300025933 | Ga0207706_11242256 | Ga0207706_112422562 | 58 |
| 406 | 3300025933 | Ga0207706_11443281 | Ga0207706_114432811 | 58 |
| 407 | 3300025934 | Ga0207686_10251825 | Ga0207686_102518252 | 58 |
| 408 | 3300025934 | Ga0207686_10760956 | Ga0207686_107609562 | 58 |
| 409 | 3300025934 | Ga0207686_10881960 | Ga0207686_108819602 | 58 |
| 410 | 3300025934 | Ga0207686_10890236 | Ga0207686_108902362 | 58 |
| 411 | 3300025935 | Ga0207709_10028413 | Ga0207709_100284133 | 58 |
| 412 | 3300025935 | Ga0207709_10067476 | Ga0207709_100674763 | 58 |
| 413 | 3300025935 | Ga0207709_11744745 | Ga0207709_117447452 | 58 |
| 414 | 3300025936 | Ga0207670_10048644 | Ga0207670_100486443 | 58 |
| 415 | 3300025936 | Ga0207670_10437426 | Ga0207670_104374262 | 58 |
| 416 | 3300025937 | Ga0207669_10012350 | Ga0207669_100123503 | 58 |
| 417 | 3300025937 | Ga0207669_10042118 | Ga0207669_100421183 | 58 |
| 418 | 3300025937 | Ga0207669_11136797 | Ga0207669_111367972 | 58 |
| 419 | 3300025937 | Ga0207669_11143130 | Ga0207669_111431302 | 58 |
| 420 | 3300025938 | Ga0207704_10042466 | Ga0207704_100424662 | 58 |
| 421 | 3300025938 | Ga0207704_10369105 | Ga0207704_103691052 | 58 |
| 422 | 3300025938 | Ga0207704_10708282 | Ga0207704_107082822 | 58 |
| 423 | 3300025938 | Ga0207704_11429730 | Ga0207704_114297302 | 58 |
| 424 | 3300025939 | Ga0207665_10569974 | Ga0207665_105699742 | 58 |
| 425 | 3300025939 | Ga0207665_11496642 | Ga0207665_114966422 | 58 |
| 426 | 3300025940 | Ga0207691_10059924 | Ga0207691_100599243 | 58 |
| 427 | 3300025940 | Ga0207691_10971201 | Ga0207691_109712012 | 58 |
| 428 | 3300025940 | Ga0207691_11150710 | Ga0207691_111507102 | 58 |
| 429 | 3300025941 | Ga0207711_10518245 | Ga0207711_105182452 | 58 |
| 430 | 3300025941 | Ga0207711_11003573 | Ga0207711_110035732 | 58 |
| 431 | 3300025941 | Ga0207711_11128492 | Ga0207711_111284922 | 58 |
| 432 | 3300025942 | Ga0207689_10075529 | Ga0207689_100755292 | 58 |
| 433 | 3300025942 | Ga0207689_10091812 | Ga0207689_100918123 | 58 |
| 434 | 3300025942 | Ga0207689_11200102 | Ga0207689_112001022 | 58 |
| 435 | 3300025942 | Ga0207689_11684504 | Ga0207689_116845042 | 58 |
| 436 | 3300025944 | Ga0207661_10615357 | Ga0207661_106153573 | 58 |
| 437 | 3300025945 | Ga0207679_10048953 | Ga0207679_100489533 | 58 |
| 438 | 3300025949 | Ga0207667_10010756 | Ga0207667_100107564 | 58 |
| 439 | 3300025949 | Ga0207667_10074694 | Ga0207667_100746943 | 58 |
| 440 | 3300025949 | Ga0207667_11037481 | Ga0207667_110374812 | 58 |
| 441 | 3300025960 | Ga0207651_10072156 | Ga0207651_100721562 | 58 |
| 442 | 3300025960 | Ga0207651_10091652 | Ga0207651_100916523 | 58 |
| 443 | 3300025960 | Ga0207651_11159675 | Ga0207651_111596752 | 58 |
| 444 | 3300025961 | Ga0207712_10057081 | Ga0207712_100570813 | 58 |
| 445 | 3300025961 | Ga0207712_10124192 | Ga0207712_101241923 | 58 |
| 446 | 3300025961 | Ga0207712_11806335 | Ga0207712_118063352 | 58 |
| 447 | 3300025972 | Ga0207668_10019967 | Ga0207668_100199673 | 58 |
| 448 | 3300025972 | Ga0207668_10036022 | Ga0207668_100360223 | 58 |
| 449 | 3300025972 | Ga0207668_10290683 | Ga0207668_102906832 | 58 |
| 450 | 3300025972 | Ga0207668_10767587 | Ga0207668_107675872 | 58 |
| 451 | 3300025972 | Ga0207668_11650731 | Ga0207668_116507312 | 58 |
| 452 | 3300025972 | Ga0207668_11651264 | Ga0207668_116512642 | 58 |
| 453 | 3300025981 | Ga0207640_10284821 | Ga0207640_102848212 | 58 |
| 454 | 3300025986 | Ga0207658_10317607 | Ga0207658_103176072 | 58 |
| 455 | 3300025986 | Ga0207658_10903315 | Ga0207658_109033152 | 58 |
| 456 | 3300025986 | Ga0207658_11080908 | Ga0207658_110809082 | 58 |
| 457 | 3300025986 | Ga0207658_12145365 | Ga0207658_121453651 | 58 |
| 458 | 3300026023 | Ga0207677_10011044 | Ga0207677_100110443 | 58 |
| 459 | 3300026023 | Ga0207677_10091669 | Ga0207677_100916692 | 58 |
| 460 | 3300026023 | Ga0207677_10424507 | Ga0207677_104245072 | 58 |
| 461 | 3300026023 | Ga0207677_11001803 | Ga0207677_110018032 | 58 |
| 462 | 3300026035 | Ga0207703_10075453 | Ga0207703_100754534 | 58 |
| 463 | 3300026035 | Ga0207703_10489198 | Ga0207703_104891982 | 58 |
| 464 | 3300026035 | Ga0207703_11888044 | Ga0207703_118880442 | 58 |
| 465 | 3300026041 | Ga0207639_10127272 | Ga0207639_101272722 | 58 |
| 466 | 3300026041 | Ga0207639_10408168 | Ga0207639_104081682 | 58 |
| 467 | 3300026041 | Ga0207639_11840782 | Ga0207639_118407822 | 58 |
| 468 | 3300026067 | Ga0207678_10010552 | Ga0207678_100105523 | 58 |
| 469 | 3300026067 | Ga0207678_10022770 | Ga0207678_100227706 | 58 |
| 470 | 3300026067 | Ga0207678_10203891 | Ga0207678_102038913 | 58 |
| 471 | 3300026067 | Ga0207678_10585696 | Ga0207678_105856962 | 58 |
| 472 | 3300026067 | Ga0207678_10737917 | Ga0207678_107379172 | 58 |
| 473 | 3300026075 | Ga0207708_10184300 | Ga0207708_101843002 | 58 |
| 474 | 3300026078 | Ga0207702_10628896 | Ga0207702_106288962 | 58 |
| 475 | 3300026078 | Ga0207702_11008951 | Ga0207702_110089512 | 58 |
| 476 | 3300026078 | Ga0207702_11251691 | Ga0207702_112516912 | 58 |
| 477 | 3300026088 | Ga0207641_10062468 | Ga0207641_100624683 | 58 |
| 478 | 3300026088 | Ga0207641_11298147 | Ga0207641_112981472 | 58 |
| 479 | 3300026089 | Ga0207648_10197558 | Ga0207648_101975583 | 58 |
| 480 | 3300026089 | Ga0207648_10307061 | Ga0207648_103070612 | 58 |
| 481 | 3300026095 | Ga0207676_12208683 | Ga0207676_122086832 | 58 |
| 482 | 3300026116 | Ga0207674_10111119 | Ga0207674_101111192 | 58 |
| 483 | 3300026118 | Ga0207675_100101117 | Ga0207675_1001011173 | 58 |
| 484 | 3300026118 | Ga0207675_100111822 | Ga0207675_1001118223 | 58 |
| 485 | 3300026118 | Ga0207675_100199723 | Ga0207675_1001997233 | 58 |
| 486 | 3300026118 | Ga0207675_100437879 | Ga0207675_1004378792 | 58 |
| 487 | 3300026121 | Ga0207683_10014660 | Ga0207683_100146605 | 58 |
| 488 | 3300026121 | Ga0207683_10044880 | Ga0207683_100448803 | 58 |
| 489 | 3300026121 | Ga0207683_11014122 | Ga0207683_110141222 | 58 |
| 490 | 3300026121 | Ga0207683_12039011 | Ga0207683_120390111 | 58 |
| 491 | 3300026142 | Ga0207698_10102309 | Ga0207698_101023092 | 58 |
| 492 | 3300026142 | Ga0207698_10282368 | Ga0207698_102823682 | 58 |
| 493 | 3300026142 | Ga0207698_10716743 | Ga0207698_107167432 | 58 |
| 494 | 3300027866 | Ga0209813_10356145 | Ga0209813_103561452 | 58 |
| 495 | 3300028379 | Ga0268266_10019219 | Ga0268266_100192195 | 58 |
| 496 | 3300028379 | Ga0268266_10073912 | Ga0268266_100739124 | 58 |
| 497 | 3300028380 | Ga0268265_10791409 | Ga0268265_107914092 | 58 |
| 498 | 3300028380 | Ga0268265_10927281 | Ga0268265_109272812 | 58 |
| 499 | 3300028380 | Ga0268265_11356582 | Ga0268265_113565822 | 58 |
| 500 | 3300028381 | Ga0268264_10257991 | Ga0268264_102579912 | 58 |
| 501 | 3300028381 | Ga0268264_11786333 | Ga0268264_117863332 | 58 |
| 502 | 3300028786 | Ga0307517_10308361 | Ga0307517_103083612 | 58 |
| 503 | 3300028794 | Ga0307515_10393531 | Ga0307515_103935312 | 58 |
| 504 | 3300030521 | Ga0307511_10210668 | Ga0307511_102106682 | 58 |
| 505 | 3300031456 | Ga0307513_10193775 | Ga0307513_101937753 | 58 |
| 506 | 3300031507 | Ga0307509_10272187 | Ga0307509_102721872 | 58 |
| 507 | 3300031616 | Ga0307508_10565863 | Ga0307508_105658632 | 58 |
| 508 | 3300031711 | Ga0265314_10548549 | Ga0265314_105485492 | 58 |
| 509 | 3300031730 | Ga0307516_10213055 | Ga0307516_102130553 | 58 |
| 510 | 3300032126 | Ga0307415_100020263 | Ga0307415_1000202633 | 58 |
| 511 | 3300033179 | Ga0307507_10596065 | Ga0307507_105960652 | 58 |
| 512 | 3300033180 | Ga0307510_10009746 | Ga0307510_100097469 | 58 |
| 513 | 3300034820 | Ga0373959_0017186 | Ga0373959_0017186_14_190 | 58 |
| 514 | 3300035111 | Ga0373923_0000827 | Ga0373923_0000827_1621_1803 | 58 |
| 515 | 3300035113 | Ga0373936_0041112 | Ga0373936_0041112_162_338 | 58 |
| 516 | 3300035117 | Ga0373953_0002753 | Ga0373953_0002753_328_510 | 58 |
| 517 | 3300035118 | Ga0373954_0000634 | Ga0373954_0000634_122_304 | 58 |
| 518 | 3300035118 | Ga0373954_0036508 | Ga0373954_0036508_1864_2046 | 58 |
| 519 | 3300035119 | Ga0373956_0001884 | Ga0373956_0001884_8103_8285 | 58 |
| 520 | 3300035120 | Ga0373957_0000200 | Ga0373957_0000200_3139_3321 | 58 |
| 521 | 3300035172 | Ga0373955_0005004 | Ga0373955_0005004_5411_5593 | 58 |
| 522 | 3300035410 | Ga0373924_0052392 | Ga0373924_0052392_406_588 | 58 |
| 523 | 3300035724 | Ga0373933_0002159 | Ga0373933_0002159_148_330 | 58 |
| 524 | 3300035724 | Ga0373933_0831574 | Ga0373933_0831574_190_366 | 58 |
| 525 | 3300036401 | Ga0373937_0014785 | Ga0373937_0014785_1147_1329 | 58 |
| 526 | 3300037068 | Ga0373925_1009403 | Ga0373925_1009403_455_631 | 58 |
| 527 | 3300041441 | Ga0451787_030782 | Ga0451787_030782_390_566 | 58 |
| 528 | 3300041441 | Ga0451787_437186 | Ga0451787_437186_294_470 | 58 |
| 529 | 3300041443 | Ga0451789_0439858 | Ga0451789_0439858_257_433 | 58 |
| 530 | 3300041451 | Ga0451791_1349316 | Ga0451791_1349316_312_488 | 58 |
| 531 | 3300041452 | Ga0451793_0751178 | Ga0451793_0751178_45_221 | 58 |
| 532 | 3300041453 | Ga0451797_0172161 | Ga0451797_0172161_395_571 | 58 |
| 533 | 3300041456 | Ga0451795_1524981 | Ga0451795_1524981_103_279 | 58 |
| 534 | 3300041458 | Ga0451798_1057041 | Ga0451798_1057041_293_469 | 58 |
| 535 | 3300041459 | Ga0451800_1604853 | Ga0451800_1604853_85_261 | 58 |
| 536 | 3300041460 | Ga0451802_0019777 | Ga0451802_0019777_14_190 | 58 |
| 537 | 3300041460 | Ga0451802_0304564 | Ga0451802_0304564_259_435 | 58 |
| 538 | 3300041486 | Ga0451807_1607086 | Ga0451807_1607086_138_314 | 58 |
| 539 | 3300041491 | Ga0451833_1216072 | Ga0451833_1216072_372_548 | 58 |
| 540 | 3300041501 | Ga0451845_0985256 | Ga0451845_0985256_357_533 | 58 |
| 541 | 3300041507 | Ga0451851_1322556 | Ga0451851_1322556_136_312 | 58 |
| 542 | 3300041509 | Ga0451843_0728618 | Ga0451843_0728618_187_363 | 58 |
| 543 | 3300041512 | Ga0451853_1746509 | Ga0451853_1746509_521_697 | 58 |
| 544 | 3300041512 | Ga0451853_1810983 | Ga0451853_1810983_102_278 | 58 |
| 545 | 3300041512 | Ga0451853_4067572 | Ga0451853_4067572_318_494 | 58 |
| 546 | 3300046452 | Ga0495617_019330 | Ga0495617_019330_782_958 | 58 |
| 547 | 3300046453 | Ga0495627_098214 | Ga0495627_098214_25_201 | 58 |
| 548 | 3300046454 | Ga0495592_0002897 | Ga0495592_0002897_7946_8128 | 58 |
| 549 | 3300046455 | Ga0495603_0017151 | Ga0495603_0017151_947_1123 | 58 |
| 550 | 3300046455 | Ga0495603_0031419 | Ga0495603_0031419_260_436 | 58 |
| 551 | 3300046455 | Ga0495603_0238001 | Ga0495603_0238001_602_778 | 58 |
| 552 | 3300046455 | Ga0495603_0399053 | Ga0495603_0399053_562_738 | 58 |
| 553 | 3300046457 | Ga0495590_0035683 | Ga0495590_0035683_131_307 | 58 |
| 554 | 3300046458 | Ga0495591_057252 | Ga0495591_057252_830_1006 | 58 |
| 555 | 3300046459 | Ga0495629_0002158 | Ga0495629_0002158_2078_2260 | 58 |
| 556 | 3300046459 | Ga0495629_0682498 | Ga0495629_0682498_68_244 | 58 |
| 557 | 3300046459 | Ga0495629_0755711 | Ga0495629_0755711_95_271 | 58 |
| 558 | 3300046460 | Ga0495638_0131924 | Ga0495638_0131924_696_872 | 58 |
| 559 | 3300046460 | Ga0495638_0343294 | Ga0495638_0343294_199_375 | 58 |
| 560 | 3300046461 | Ga0495641_0295354 | Ga0495641_0295354_157_333 | 58 |
| 561 | 3300046462 | Ga0495651_0101857 | Ga0495651_0101857_1622_1804 | 58 |
| 562 | 3300046463 | Ga0495653_0017446 | Ga0495653_0017446_778_960 | 58 |
| 563 | 3300046471 | Ga0495650_0146812 | Ga0495650_0146812_370_546 | 58 |
| 564 | 3300046473 | Ga0495582_0201669 | Ga0495582_0201669_40_216 | 58 |
| 565 | 3300046473 | Ga0495582_0535426 | Ga0495582_0535426_228_404 | 58 |
| 566 | 3300046474 | Ga0495605_0191943 | Ga0495605_0191943_538_714 | 58 |
| 567 | 3300046475 | Ga0495639_0189724 | Ga0495639_0189724_55_231 | 58 |
| 568 | 3300046476 | Ga0495662_0050496 | Ga0495662_0050496_1441_1617 | 58 |
| 569 | 3300046477 | Ga0495664_0136401 | Ga0495664_0136401_1009_1185 | 58 |
| 570 | 3300046477 | Ga0495664_0870317 | Ga0495664_0870317_39_215 | 58 |
| 571 | 3300046491 | Ga0495584_0368802 | Ga0495584_0368802_224_400 | 58 |
| 572 | 3300046492 | Ga0495585_0019025 | Ga0495585_0019025_1228_1404 | 58 |
| 573 | 3300046499 | Ga0495594_0499582 | Ga0495594_0499582_401_577 | 58 |
| 574 | 3300046500 | Ga0495596_0152289 | Ga0495596_0152289_188_364 | 58 |
| 575 | 3300046501 | Ga0495607_0072805 | Ga0495607_0072805_391_567 | 58 |
| 576 | 3300046506 | Ga0495583_0087005 | Ga0495583_0087005_196_372 | 58 |
| 577 | 3300046507 | Ga0495606_0104556 | Ga0495606_0104556_1283_1459 | 58 |
| 578 | 3300046507 | Ga0495606_0151584 | Ga0495606_0151584_546_722 | 58 |
| 579 | 3300046507 | Ga0495606_0189315 | Ga0495606_0189315_208_384 | 58 |
| 580 | 3300046511 | Ga0495608_0002218 | Ga0495608_0002218_13370_13552 | 58 |
| 581 | 3300046512 | Ga0495610_0121293 | Ga0495610_0121293_607_783 | 58 |
| 582 | 3300046513 | Ga0495616_0370522 | Ga0495616_0370522_40_216 | 58 |
| 583 | 3300046515 | Ga0495620_0070690 | Ga0495620_0070690_440_616 | 58 |
| 584 | 3300046516 | Ga0495628_0038487 | Ga0495628_0038487_3306_3488 | 58 |
| 585 | 3300046518 | Ga0495631_0229711 | Ga0495631_0229711_351_527 | 58 |
| 586 | 3300046522 | Ga0495643_0287355 | Ga0495643_0287355_430_606 | 58 |
| 587 | 3300046522 | Ga0495643_0481943 | Ga0495643_0481943_252_428 | 58 |
| 588 | 3300046523 | Ga0495644_0097550 | Ga0495644_0097550_272_448 | 58 |
| 589 | 3300046524 | Ga0495648_0095285 | Ga0495648_0095285_306_482 | 58 |
| 590 | 3300046525 | Ga0495663_0153991 | Ga0495663_0153991_578_754 | 58 |
| 591 | 3300046528 | Ga0495642_0175473 | Ga0495642_0175473_572_748 | 58 |
| 592 | 3300046529 | Ga0495652_0038809 | Ga0495652_0038809_3291_3473 | 58 |
| 593 | 3300046530 | Ga0495654_0065774 | Ga0495654_0065774_313_489 | 58 |
| 594 | 3300046531 | Ga0495665_0604613 | Ga0495665_0604613_282_458 | 58 |
| 595 | 3300046533 | Ga0495640_0005616 | Ga0495640_0005616_3343_3525 | 58 |
| 596 | 3300046536 | Ga0495587_0025519 | Ga0495587_0025519_638_820 | 58 |
| 597 | 3300046536 | Ga0495587_0824488 | Ga0495587_0824488_100_276 | 58 |
| 598 | 3300046537 | Ga0495598_0145952 | Ga0495598_0145952_80_256 | 58 |
| 599 | 3300046537 | Ga0495598_0169757 | Ga0495598_0169757_240_416 | 58 |
| 600 | 3300046538 | Ga0495609_0029965 | Ga0495609_0029965_47_223 | 58 |
| 601 | 3300046542 | Ga0495597_0066671 | Ga0495597_0066671_777_953 | 58 |
| 602 | 3300046543 | Ga0495645_0213847 | Ga0495645_0213847_508_690 | 58 |
| 603 | 3300046543 | Ga0495645_0784040 | Ga0495645_0784040_85_261 | 58 |
| 604 | 3300046557 | Ga0495622_0005946 | Ga0495622_0005946_988_1164 | 58 |
| 605 | 3300046558 | Ga0495633_0217864 | Ga0495633_0217864_501_677 | 58 |
| 606 | 3300046559 | Ga0495667_0009980 | Ga0495667_0009980_3500_3682 | 58 |
| 607 | 3300046615 | Ga0495656_0068283 | Ga0495656_0068283_918_1094 | 58 |
| 608 | 3300046615 | Ga0495656_0125502 | Ga0495656_0125502_37_213 | 58 |
| 609 | 3300046615 | Ga0495656_0151554 | Ga0495656_0151554_550_726 | 58 |
| 610 | 3300046616 | Ga0495668_0070449 | Ga0495668_0070449_1166_1342 | 58 |
| 611 | 3300046616 | Ga0495668_0260170 | Ga0495668_0260170_304_480 | 58 |
| 612 | 3300046642 | Ga0495634_0034579 | Ga0495634_0034579_2791_2973 | 58 |
| 613 | 3300046642 | Ga0495634_0874064 | Ga0495634_0874064_88_264 | 58 |
| 614 | 3300046648 | Ga0495611_0229269 | Ga0495611_0229269_590_766 | 58 |
| 615 | 3300046663 | Ga0495635_0001058 | Ga0495635_0001058_4742_4924 | 58 |
| 616 | 3300046663 | Ga0495635_0653495 | Ga0495635_0653495_313_489 | 58 |
| 617 | 3300046674 | Ga0495588_0289516 | Ga0495588_0289516_74_250 | 58 |
| 618 | 3300046674 | Ga0495588_0630690 | Ga0495588_0630690_374_550 | 58 |
| 619 | 3300046675 | Ga0495657_0011523 | Ga0495657_0011523_4743_4925 | 58 |
| 620 | 3300046678 | Ga0495599_0003523 | Ga0495599_0003523_1413_1595 | 58 |
| 621 | 3300046679 | Ga0495623_0006259 | Ga0495623_0006259_650_832 | 58 |
| 622 | 3300046680 | Ga0495646_0000934 | Ga0495646_0000934_2708_2890 | 58 |
| 623 | 3300046684 | Ga0495669_0003832 | Ga0495669_0003832_1616_1792 | 58 |
| 624 | 3300046684 | Ga0495669_0584821 | Ga0495669_0584821_155_331 | 58 |
| 625 | 3300046690 | Ga0495624_0612487 | Ga0495624_0612487_320_496 | 58 |
| 626 | 3300046694 | Ga0495649_0257830 | Ga0495649_0257830_500_676 | 58 |
| 627 | 3300046794 | Ga0495589_0384953 | Ga0495589_0384953_201_377 | 58 |
| 628 | 3300046794 | Ga0495589_0405868 | Ga0495589_0405868_430_606 | 58 |
| 629 | 3300046809 | Ga0495600_0001795 | Ga0495600_0001795_11038_11220 | 58 |
| 630 | 3300046809 | Ga0495600_0586700 | Ga0495600_0586700_299_475 | 58 |
| 631 | 3300047315 | Ga0495581_0523461 | Ga0495581_0523461_253_429 | 58 |
| 632 | 3300047315 | Ga0495581_0637219 | Ga0495581_0637219_222_398 | 58 |
| 633 | 3300047315 | Ga0495581_0670891 | Ga0495581_0670891_397_573 | 58 |
| 634 | 3300047315 | Ga0495581_0858503 | Ga0495581_0858503_54_230 | 58 |
| 635 | 3300047317 | Ga0495604_0091763 | Ga0495604_0091763_657_839 | 58 |
| 636 | 3300047317 | Ga0495604_0864322 | Ga0495604_0864322_321_497 | 58 |
| 637 | 3300047319 | Ga0495674_0007182 | Ga0495674_0007182_10262_10444 | 58 |
| 638 | 3300047320 | Ga0495672_0046495 | Ga0495672_0046495_1087_1263 | 58 |
| 639 | 3300047320 | Ga0495672_0420365 | Ga0495672_0420365_395_571 | 58 |
| 640 | 3300047321 | Ga0495676_0304106 | Ga0495676_0304106_719_895 | 58 |
| 641 | 3300047321 | Ga0495676_0325429 | Ga0495676_0325429_296_472 | 58 |
| 642 | 3300047321 | Ga0495676_1101575 | Ga0495676_1101575_251_427 | 58 |
| 643 | 3300047322 | Ga0495680_0233868 | Ga0495680_0233868_469_651 | 58 |
| 644 | 3300047323 | Ga0495683_0104787 | Ga0495683_0104787_696_872 | 58 |
| 645 | 3300047444 | Ga0495675_0002644 | Ga0495675_0002644_111_293 | 58 |
| 646 | 3300047444 | Ga0495675_0004307 | Ga0495675_0004307_8185_8367 | 58 |
| 647 | 3300047445 | Ga0495677_0124151 | Ga0495677_0124151_386_562 | 58 |
| 648 | 3300047445 | Ga0495677_0156220 | Ga0495677_0156220_509_685 | 58 |
| 649 | 3300047446 | Ga0495679_099085 | Ga0495679_099085_68_244 | 58 |
| 650 | 3300047447 | Ga0495685_090611 | Ga0495685_090611_288_464 | 58 |
| 651 | 3300047447 | Ga0495685_130572 | Ga0495685_130572_609_785 | 58 |
| 652 | 3300047469 | Ga0495673_0160260 | Ga0495673_0160260_548_724 | 58 |
| 653 | 3300047471 | Ga0495684_0016173 | Ga0495684_0016173_5400_5582 | 58 |
| 654 | 3300047472 | Ga0495686_0065615 | Ga0495686_0065615_1156_1332 | 58 |
| 655 | 3300047472 | Ga0495686_0269147 | Ga0495686_0269147_570_746 | 58 |
| 656 | 3300047472 | Ga0495686_0400024 | Ga0495686_0400024_441_617 | 58 |
| 657 | 3300047673 | Ga0495593_0007370 | Ga0495593_0007370_1902_2084 | 58 |
| 658 | 3300047673 | Ga0495593_0329846 | Ga0495593_0329846_66_242 | 58 |
| 659 | 3300048088 | Ga0495602_0048110 | Ga0495602_0048110_778_960 | 58 |
| 660 | 3300048090 | Ga0495615_0018636 | Ga0495615_0018636_756_932 | 58 |
| 661 | 3300048091 | Ga0495626_0179278 | Ga0495626_0179278_246_422 | 58 |
| 662 | 3300048903 | Ga0496100_0009207 | Ga0496100_0009207_5142_5318 | 58 |
| 663 | 3300048903 | Ga0496100_0035542 | Ga0496100_0035542_2225_2401 | 58 |
| 664 | 3300048903 | Ga0496100_0193147 | Ga0496100_0193147_846_1022 | 58 |
| 665 | 3300048903 | Ga0496100_0347828 | Ga0496100_0347828_50_226 | 58 |
| 666 | 3300048903 | Ga0496100_0863678 | Ga0496100_0863678_315_491 | 58 |
| 667 | 3300048904 | Ga0496101_0000875 | Ga0496101_0000875_4364_4540 | 58 |
| 668 | 3300048904 | Ga0496101_0176638 | Ga0496101_0176638_144_320 | 58 |
| 669 | 3300048904 | Ga0496101_0227712 | Ga0496101_0227712_148_324 | 58 |
| 670 | 3300048905 | Ga0496102_0009695 | Ga0496102_0009695_5010_5186 | 58 |
| 671 | 3300048905 | Ga0496102_0248458 | Ga0496102_0248458_728_904 | 58 |
| 672 | 3300048905 | Ga0496102_0564003 | Ga0496102_0564003_476_652 | 58 |
| 673 | 3300048906 | Ga0496103_0006163 | Ga0496103_0006163_3546_3722 | 58 |
| 674 | 3300048906 | Ga0496103_0364652 | Ga0496103_0364652_240_416 | 58 |
| 675 | 3300048906 | Ga0496103_0759658 | Ga0496103_0759658_74_250 | 58 |
| 676 | 3300048907 | Ga0496104_0036083 | Ga0496104_0036083_2279_2455 | 58 |
| 677 | 3300048907 | Ga0496104_0879326 | Ga0496104_0879326_46_222 | 58 |
| 678 | 3300048907 | Ga0496104_0894838 | Ga0496104_0894838_339_515 | 58 |
| 679 | 3300048908 | Ga0496105_0017743 | Ga0496105_0017743_3256_3432 | 58 |
| 680 | 3300048908 | Ga0496105_0668324 | Ga0496105_0668324_354_530 | 58 |
| 681 | 3300048909 | Ga0496106_0016638 | Ga0496106_0016638_3992_4168 | 58 |
| 682 | 3300048909 | Ga0496106_0320307 | Ga0496106_0320307_11_187 | 58 |
| 683 | 3300048909 | Ga0496106_0375713 | Ga0496106_0375713_717_893 | 58 |
| 684 | 3300048909 | Ga0496106_0516371 | Ga0496106_0516371_303_479 | 58 |
| 685 | 3300048909 | Ga0496106_0533776 | Ga0496106_0533776_244_420 | 58 |
| 686 | 3300048909 | Ga0496106_0787576 | Ga0496106_0787576_188_364 | 58 |
| 687 | 3300048910 | Ga0496107_0015387 | Ga0496107_0015387_997_1173 | 58 |
| 688 | 3300048910 | Ga0496107_0255773 | Ga0496107_0255773_729_905 | 58 |
| 689 | 3300048910 | Ga0496107_0406021 | Ga0496107_0406021_821_997 | 58 |
| 690 | 3300048910 | Ga0496107_0686432 | Ga0496107_0686432_264_440 | 58 |
| 691 | 3300048910 | Ga0496107_0978125 | Ga0496107_0978125_224_400 | 58 |
| 692 | 3300048911 | Ga0496108_0002192 | Ga0496108_0002192_5984_6160 | 58 |
| 693 | 3300048911 | Ga0496108_0330641 | Ga0496108_0330641_724_900 | 58 |
| 694 | 3300048911 | Ga0496108_1590037 | Ga0496108_1590037_149_325 | 58 |
| 695 | 3300048912 | Ga0496109_0010462 | Ga0496109_0010462_4634_4810 | 58 |
| 696 | 3300048912 | Ga0496109_0079860 | Ga0496109_0079860_1185_1361 | 58 |
| 697 | 3300048912 | Ga0496109_0189821 | Ga0496109_0189821_701_877 | 58 |
| 698 | 3300048912 | Ga0496109_0316599 | Ga0496109_0316599_345_521 | 58 |
| 699 | 3300048913 | Ga0496110_0026863 | Ga0496110_0026863_1196_1372 | 58 |
| 700 | 3300048913 | Ga0496110_0599451 | Ga0496110_0599451_370_546 | 58 |
| 701 | 3300048914 | Ga0496111_0018238 | Ga0496111_0018238_3565_3765 | 58 |
| 702 | 3300048914 | Ga0496111_0037599 | Ga0496111_0037599_2026_2202 | 58 |
| 703 | 3300048914 | Ga0496111_0211959 | Ga0496111_0211959_1007_1183 | 58 |
| 704 | 3300048915 | Ga0496112_0016391 | Ga0496112_0016391_1054_1230 | 58 |
| 705 | 3300048915 | Ga0496112_0018840 | Ga0496112_0018840_364_540 | 58 |
| 706 | 3300048915 | Ga0496112_1690878 | Ga0496112_1690878_98_298 | 58 |
| 707 | 3300048916 | Ga0496113_0001312 | Ga0496113_0001312_10437_10613 | 58 |
| 708 | 3300048916 | Ga0496113_0082648 | Ga0496113_0082648_1330_1530 | 58 |
| 709 | 3300048916 | Ga0496113_0405020 | Ga0496113_0405020_556_732 | 58 |
| 710 | 3300048916 | Ga0496113_0610121 | Ga0496113_0610121_508_684 | 58 |
| 711 | 3300048917 | Ga0496114_0004461 | Ga0496114_0004461_6786_6962 | 58 |
| 712 | 3300048917 | Ga0496114_0227293 | Ga0496114_0227293_1125_1301 | 58 |
| 713 | 3300048917 | Ga0496114_0263839 | Ga0496114_0263839_355_531 | 58 |
| 714 | 3300048917 | Ga0496114_0544542 | Ga0496114_0544542_477_653 | 58 |
| 715 | 3300048918 | Ga0496115_0009478 | Ga0496115_0009478_1727_1903 | 58 |
| 716 | 3300048918 | Ga0496115_0039849 | Ga0496115_0039849_2313_2489 | 58 |
| 717 | 3300048918 | Ga0496115_0792938 | Ga0496115_0792938_337_513 | 58 |
| 718 | 3300048918 | Ga0496115_0948707 | Ga0496115_0948707_127_303 | 58 |
| 719 | 3300048918 | Ga0496115_1450641 | Ga0496115_1450641_218_394 | 58 |
| 720 | 3300048919 | Ga0496116_0108802 | Ga0496116_0108802_256_432 | 58 |
| 721 | 3300048920 | Ga0496117_0290918 | Ga0496117_0290918_598_774 | 58 |
| 722 | 3300048920 | Ga0496117_0329210 | Ga0496117_0329210_444_620 | 58 |
| 723 | 3300048921 | Ga0496118_0562123 | Ga0496118_0562123_164_340 | 58 |
| 724 | 3300048922 | Ga0496119_0308491 | Ga0496119_0308491_592_768 | 58 |
| 725 | 3300048922 | Ga0496119_0541226 | Ga0496119_0541226_145_321 | 58 |
| 726 | 3300048923 | Ga0496120_0492318 | Ga0496120_0492318_129_305 | 58 |
| 727 | 3300048924 | Ga0496121_0000330 | Ga0496121_0000330_45718_45894 | 58 |
| 728 | 3300048924 | Ga0496121_0117819 | Ga0496121_0117819_1578_1754 | 58 |
| 729 | 3300048924 | Ga0496121_0228466 | Ga0496121_0228466_1053_1229 | 58 |
| 730 | 3300048924 | Ga0496121_0361152 | Ga0496121_0361152_217_393 | 58 |
| 731 | 3300048924 | Ga0496121_0394458 | Ga0496121_0394458_397_573 | 58 |
| 732 | 3300048924 | Ga0496121_0455971 | Ga0496121_0455971_165_341 | 58 |
| 733 | 3300048924 | Ga0496121_0487080 | Ga0496121_0487080_95_271 | 58 |
| 734 | 3300048927 | Ga0496124_0221282 | Ga0496124_0221282_1069_1245 | 58 |
| 735 | 3300048927 | Ga0496124_0624549 | Ga0496124_0624549_59_235 | 58 |
| 736 | 3300048927 | Ga0496124_0670127 | Ga0496124_0670127_275_451 | 58 |
| 737 | 3300048928 | Ga0496125_0200197 | Ga0496125_0200197_87_263 | 58 |
| 738 | 3300048928 | Ga0496125_0326519 | Ga0496125_0326519_588_764 | 58 |
| 739 | 3300048928 | Ga0496125_0503762 | Ga0496125_0503762_342_518 | 58 |
| 740 | 3300048928 | Ga0496125_0637333 | Ga0496125_0637333_40_216 | 58 |
| 741 | 3300048929 | Ga0496126_0004961 | Ga0496126_0004961_7013_7189 | 58 |
| 742 | 3300048929 | Ga0496126_0141728 | Ga0496126_0141728_1239_1415 | 58 |
| 743 | 3300048929 | Ga0496126_0508953 | Ga0496126_0508953_576_752 | 58 |
| 744 | 3300048929 | Ga0496126_0803743 | Ga0496126_0803743_170_346 | 58 |
| 745 | 3300048929 | Ga0496126_0911493 | Ga0496126_0911493_385_561 | 58 |
| 746 | 3300048929 | Ga0496126_1379753 | Ga0496126_1379753_244_420 | 58 |
| 747 | 3300049460 | Ga0495682_0163941 | Ga0495682_0163941_307_483 | 58 |
| 748 | 3300049571 | Ga0501034_0317047 | Ga0501034_0317047_1232_1408 | 58 |
| 749 | 3300050489 | nmdc:mga03683_130945_c1 | nmdc:mga03683_130945_c1_823_999 | 58 |
| 750 | 3300050490 | nmdc:mga03n38_576503_c1 | nmdc:mga03n38_576503_c1_444_620 | 58 |
| 751 | 3300050490 | nmdc:mga03n38_641608_c1 | nmdc:mga03n38_641608_c1_419_595 | 58 |
| 752 | 3300050491 | nmdc:mga00v17_355964_c1 | nmdc:mga00v17_355964_c1_688_864 | 58 |
| 753 | 3300050492 | nmdc:mga0yw44_1187532_c1 | nmdc:mga0yw44_1187532_c1_205_381 | 58 |
| 754 | 3300050492 | nmdc:mga0yw44_162553_c1 | nmdc:mga0yw44_162553_c1_756_932 | 58 |
| 755 | 3300050492 | nmdc:mga0yw44_259422_c1 | nmdc:mga0yw44_259422_c1_773_949 | 58 |
| 756 | 3300050492 | nmdc:mga0yw44_945852_c1 | nmdc:mga0yw44_945852_c1_87_263 | 58 |
| 757 | 3300050493 | nmdc:mga0k408_133036_c1 | nmdc:mga0k408_133036_c1_515_691 | 58 |
| 758 | 3300050494 | nmdc:mga06z11_160840_c1 | nmdc:mga06z11_160840_c1_373_549 | 58 |
| 759 | 3300050494 | nmdc:mga06z11_779412_c1 | nmdc:mga06z11_779412_c1_343_519 | 58 |
| 760 | 3300050494 | nmdc:mga06z11_832089_c1 | nmdc:mga06z11_832089_c1_183_359 | 58 |
| 761 | 3300050496 | nmdc:mga07m45_506050_c1 | nmdc:mga07m45_506050_c1_63_239 | 58 |
| 762 | 3300050511 | nmdc:mga08y16_1965971_c1 | nmdc:mga08y16_1965971_c1_116_292 | 58 |
| 763 | 3300050516 | nmdc:mga0sz30_179116_c1 | nmdc:mga0sz30_179116_c1_159_335 | 58 |
| 764 | 3300053077 | Ga0495601_0016288 | Ga0495601_0016288_3569_3751 | 58 |
| 765 | 3300053080 | Ga0500635_0418585 | Ga0500635_0418585_289_465 | 58 |
| 766 | 3300053080 | Ga0500635_0425954 | Ga0500635_0425954_219_395 | 58 |
| 767 | 3300053083 | Ga0495655_0004786 | Ga0495655_0004786_1174_1350 | 58 |
| 768 | 3300053084 | Ga0495595_0000335 | Ga0495595_0000335_13108_13290 | 58 |
| 769 | 3300053085 | Ga0495619_0001292 | Ga0495619_0001292_4184_4366 | 58 |
| 770 | 3300053088 | Ga0500644_0516922 | Ga0500644_0516922_80_256 | 58 |
| 771 | 3300053092 | Ga0500583_0068458 | Ga0500583_0068458_998_1174 | 58 |
| 772 | 3300053093 | Ga0500651_0323447 | Ga0500651_0323447_196_372 | 58 |
| 773 | 3300053094 | Ga0500566_0011427 | Ga0500566_0011427_2211_2387 | 58 |
| 774 | 3300053094 | Ga0500566_0493869 | Ga0500566_0493869_157_333 | 58 |
| 775 | 3300053095 | Ga0500640_215211 | Ga0500640_215211_350_526 | 58 |
| 776 | 3300053096 | Ga0500641_0032365 | Ga0500641_0032365_1333_1509 | 58 |
| 777 | 3300053096 | Ga0500641_0223095 | Ga0500641_0223095_425_601 | 58 |
| 778 | 3300053102 | Ga0500554_018197 | Ga0500554_018197_951_1127 | 58 |
| 779 | 3300053103 | Ga0500555_139554 | Ga0500555_139554_160_336 | 58 |
| 780 | 3300053104 | Ga0500556_0047237 | Ga0500556_0047237_1046_1222 | 58 |
| 781 | 3300053108 | Ga0500562_063611 | Ga0500562_063611_781_957 | 58 |
| 782 | 3300053109 | Ga0500569_326036 | Ga0500569_326036_15_191 | 58 |
| 783 | 3300053116 | Ga0500592_089901 | Ga0500592_089901_164_340 | 58 |
| 784 | 3300053118 | Ga0500594_0196453 | Ga0500594_0196453_230_406 | 58 |
| 785 | 3300053118 | Ga0500594_0230160 | Ga0500594_0230160_176_352 | 58 |
| 786 | 3300053119 | Ga0500595_000468 | Ga0500595_000468_10870_11046 | 58 |
| 787 | 3300053119 | Ga0500595_013495 | Ga0500595_013495_1673_1849 | 58 |
| 788 | 3300053119 | Ga0500595_025974 | Ga0500595_025974_754_930 | 58 |
| 789 | 3300053124 | Ga0500617_208270 | Ga0500617_208270_15_191 | 58 |
| 790 | 3300053130 | Ga0500642_0112653 | Ga0500642_0112653_694_870 | 58 |
| 791 | 3300053133 | Ga0500655_058888 | Ga0500655_058888_239_415 | 58 |
| 792 | 3300053134 | Ga0500658_0130238 | Ga0500658_0130238_145_321 | 58 |
| 793 | 3300053136 | Ga0500559_0145617 | Ga0500559_0145617_156_332 | 58 |
| 794 | 3300053137 | Ga0500561_0204129 | Ga0500561_0204129_407_583 | 58 |
| 795 | 3300053139 | Ga0500568_0003017 | Ga0500568_0003017_4329_4505 | 58 |
| 796 | 3300053139 | Ga0500568_0300981 | Ga0500568_0300981_39_215 | 58 |
| 797 | 3300053146 | Ga0500588_0303387 | Ga0500588_0303387_262_438 | 58 |
| 798 | 3300053147 | Ga0500589_111338 | Ga0500589_111338_297_473 | 58 |
| 799 | 3300053147 | Ga0500589_307102 | Ga0500589_307102_86_262 | 58 |
| 800 | 3300053148 | Ga0500590_210120 | Ga0500590_210120_16_192 | 58 |
| 801 | 3300053150 | Ga0500603_161253 | Ga0500603_161253_355_531 | 58 |
| 802 | 3300053151 | Ga0500604_0317164 | Ga0500604_0317164_163_339 | 58 |
| 803 | 3300053156 | Ga0500622_0125384 | Ga0500622_0125384_27_203 | 58 |
| 804 | 3300053156 | Ga0500622_0217827 | Ga0500622_0217827_618_794 | 58 |
| 805 | 3300053158 | Ga0500627_0131079 | Ga0500627_0131079_765_941 | 58 |
| 806 | 3300053161 | Ga0500634_0306566 | Ga0500634_0306566_145_321 | 58 |
| 807 | 3300053162 | Ga0500638_002107 | Ga0500638_002107_3034_3210 | 58 |
| 808 | 3300053162 | Ga0500638_068294 | Ga0500638_068294_236_412 | 58 |
| 809 | 3300053177 | Ga0500636_0164781 | Ga0500636_0164781_79_255 | 58 |
| 810 | 3300053178 | Ga0500637_0000546 | Ga0500637_0000546_14169_14345 | 58 |
| 811 | 3300053178 | Ga0500637_0064084 | Ga0500637_0064084_347_526 | 58 |
| 812 | 3300053178 | Ga0500637_0171751 | Ga0500637_0171751_732_908 | 58 |
| 813 | 3300053727 | Ga0500611_141671 | Ga0500611_141671_398_574 | 58 |
| 814 | 3300053731 | Ga0500609_028950 | Ga0500609_028950_380_556 | 58 |
| 815 | 3300053732 | Ga0500656_003876 | Ga0500656_003876_485_661 | 58 |
| 816 | 3300053735 | Ga0500596_070711 | Ga0500596_070711_146_322 | 58 |
| 817 | 3300054114 | Ga0501084_0203487 | Ga0501084_0203487_809_985 | 58 |
| 818 | 3300055283 | Ga0500661_000782 | Ga0500661_000782_2000_2176 | 58 |
| 819 | 3300060353 | Ga0501082_0013785 | Ga0501082_0013785_4973_5149 | 58 |
| 820 | 3300005337 | Ga0070682_101350930 | Ga0070682_1013509302 | 59 |
| 821 | 3300005437 | Ga0070710_10080672 | Ga0070710_100806722 | 59 |
| 822 | 3300005439 | Ga0070711_100111738 | Ga0070711_1001117383 | 59 |
| 823 | 3300005983 | Ga0081540_1002582 | Ga0081540_100258210 | 59 |
| 824 | 3300006028 | Ga0070717_10651567 | Ga0070717_106515672 | 59 |
| 825 | 3300006173 | Ga0070716_101130306 | Ga0070716_1011303062 | 59 |
| 826 | 3300006175 | Ga0070712_100452239 | Ga0070712_1004522392 | 59 |
| 827 | 3300013104 | Ga0157370_11088082 | Ga0157370_110880822 | 59 |
| 828 | 3300025898 | Ga0207692_10090497 | Ga0207692_100904972 | 59 |
| 829 | 3300025906 | Ga0207699_10011455 | Ga0207699_100114554 | 59 |
| 830 | 3300025915 | Ga0207693_10031699 | Ga0207693_100316992 | 59 |
| 831 | 3300025916 | Ga0207663_10021008 | Ga0207663_100210085 | 59 |
| 832 | 3300025928 | Ga0207700_10043969 | Ga0207700_100439693 | 59 |
| 833 | 3300025939 | Ga0207665_10376901 | Ga0207665_103769012 | 59 |
| 834 | 3300030763 | Ga0265763_1028070 | Ga0265763_10280702 | 59 |
| 835 | 3300031090 | Ga0265760_10293071 | Ga0265760_102930712 | 59 |
| 836 | 3300031238 | Ga0265332_10369523 | Ga0265332_103695232 | 59 |
| 837 | 3300031250 | Ga0265331_10030702 | Ga0265331_100307023 | 59 |
| 838 | 3300031711 | Ga0265314_10059242 | Ga0265314_100592423 | 59 |
| 839 | 3300031712 | Ga0265342_10010007 | Ga0265342_100100073 | 59 |
| 840 | 3300046462 | Ga0495651_0057664 | Ga0495651_0057664_398_577 | 59 |
| 841 | 3300046477 | Ga0495664_0304389 | Ga0495664_0304389_481_660 | 59 |
| 842 | 3300046511 | Ga0495608_0882922 | Ga0495608_0882922_308_487 | 59 |
| 843 | 3300046529 | Ga0495652_0309464 | Ga0495652_0309464_212_391 | 59 |
| 844 | 3300046543 | Ga0495645_0251676 | Ga0495645_0251676_15_194 | 59 |
| 845 | 3300046642 | Ga0495634_0762418 | Ga0495634_0762418_345_524 | 59 |
| 846 | 3300046678 | Ga0495599_0163130 | Ga0495599_0163130_19_198 | 59 |
| 847 | 3300046679 | Ga0495623_0023756 | Ga0495623_0023756_400_579 | 59 |
| 848 | 3300046680 | Ga0495646_0125268 | Ga0495646_0125268_979_1158 | 59 |
| 849 | 3300046689 | Ga0495613_0306306 | Ga0495613_0306306_500_679 | 59 |
| 850 | 3300046809 | Ga0495600_0319738 | Ga0495600_0319738_438_617 | 59 |
| 851 | 3300047317 | Ga0495604_0014661 | Ga0495604_0014661_2418_2597 | 59 |
| 852 | 3300047319 | Ga0495674_0943608 | Ga0495674_0943608_183_362 | 59 |
| 853 | 3300048088 | Ga0495602_0027742 | Ga0495602_0027742_2372_2551 | 59 |
| 854 | 3300001904 | JGI24736J21556_1069384 | JGI24736J21556_10693841 | 60 |
| 855 | 3300001989 | JGI24739J22299_10113909 | JGI24739J22299_101139092 | 60 |
| 856 | 3300002067 | JGI24735J21928_10002229 | JGI24735J21928_100022294 | 60 |
| 857 | 3300005327 | Ga0070658_10002866 | Ga0070658_100028663 | 60 |
| 858 | 3300005327 | Ga0070658_10116973 | Ga0070658_101169733 | 60 |
| 859 | 3300005339 | Ga0070660_100064724 | Ga0070660_1000647244 | 60 |
| 860 | 3300005344 | Ga0070661_100202483 | Ga0070661_1002024832 | 60 |
| 861 | 3300005344 | Ga0070661_101196721 | Ga0070661_1011967212 | 60 |
| 862 | 3300005366 | Ga0070659_100032739 | Ga0070659_1000327394 | 60 |
| 863 | 3300005458 | Ga0070681_11890369 | Ga0070681_118903692 | 60 |
| 864 | 3300005539 | Ga0068853_100206278 | Ga0068853_1002062783 | 60 |
| 865 | 3300005563 | Ga0068855_100036502 | Ga0068855_1000365024 | 60 |
| 866 | 3300005563 | Ga0068855_100037055 | Ga0068855_1000370555 | 60 |
| 867 | 3300005563 | Ga0068855_100778579 | Ga0068855_1007785792 | 60 |
| 868 | 3300005614 | Ga0068856_100662677 | Ga0068856_1006626772 | 60 |
| 869 | 3300005617 | Ga0068859_100986570 | Ga0068859_1009865702 | 60 |
| 870 | 3300006931 | Ga0097620_100986525 | Ga0097620_1009865252 | 60 |
| 871 | 3300009093 | Ga0105240_10381267 | Ga0105240_103812672 | 60 |
| 872 | 3300009093 | Ga0105240_12057348 | Ga0105240_120573482 | 60 |
| 873 | 3300009174 | Ga0105241_10302898 | Ga0105241_103028982 | 60 |
| 874 | 3300009545 | Ga0105237_10099940 | Ga0105237_100999403 | 60 |
| 875 | 3300009545 | Ga0105237_11103806 | Ga0105237_111038062 | 60 |
| 876 | 3300009551 | Ga0105238_10189353 | Ga0105238_101893532 | 60 |
| 877 | 3300010375 | Ga0105239_13516621 | Ga0105239_135166211 | 60 |
| 878 | 3300013104 | Ga0157370_10016923 | Ga0157370_100169235 | 60 |
| 879 | 3300013104 | Ga0157370_10038959 | Ga0157370_100389593 | 60 |
| 880 | 3300013105 | Ga0157369_10000362 | Ga0157369_100003627 | 60 |
| 881 | 3300013307 | Ga0157372_10234078 | Ga0157372_102340783 | 60 |
| 882 | 3300013307 | Ga0157372_11808161 | Ga0157372_118081612 | 60 |
| 883 | 3300020069 | Ga0197907_10425857 | Ga0197907_104258572 | 60 |
| 884 | 3300020070 | Ga0206356_11624406 | Ga0206356_116244062 | 60 |
| 885 | 3300020080 | Ga0206350_10387633 | Ga0206350_103876331 | 60 |
| 886 | 3300020081 | Ga0206354_10084247 | Ga0206354_100842471 | 60 |
| 887 | 3300020082 | Ga0206353_10739046 | Ga0206353_107390462 | 60 |
| 888 | 3300022467 | Ga0224712_10000787 | Ga0224712_100007873 | 60 |
| 889 | 3300025228 | Ga0209672_100948 | Ga0209672_1009488 | 60 |
| 890 | 3300025256 | Ga0209759_1001867 | Ga0209759_10018673 | 60 |
| 891 | 3300025904 | Ga0207647_10000340 | Ga0207647_100003406 | 60 |
| 892 | 3300025909 | Ga0207705_10000352 | Ga0207705_1000035227 | 60 |
| 893 | 3300025909 | Ga0207705_10102825 | Ga0207705_101028252 | 60 |
| 894 | 3300025912 | Ga0207707_11494105 | Ga0207707_114941052 | 60 |
| 895 | 3300025913 | Ga0207695_10047671 | Ga0207695_100476714 | 60 |
| 896 | 3300025913 | Ga0207695_10349841 | Ga0207695_103498412 | 60 |
| 897 | 3300025914 | Ga0207671_10327034 | Ga0207671_103270343 | 60 |
| 898 | 3300025914 | Ga0207671_10385238 | Ga0207671_103852382 | 60 |
| 899 | 3300025919 | Ga0207657_10202353 | Ga0207657_102023532 | 60 |
| 900 | 3300025924 | Ga0207694_10575780 | Ga0207694_105757802 | 60 |
| 901 | 3300025924 | Ga0207694_11126951 | Ga0207694_111269512 | 60 |
| 902 | 3300025932 | Ga0207690_10006937 | Ga0207690_100069373 | 60 |
| 903 | 3300025949 | Ga0207667_10002243 | Ga0207667_100022433 | 60 |
| 904 | 3300025949 | Ga0207667_10011404 | Ga0207667_100114044 | 60 |
| 905 | 3300025981 | Ga0207640_11985875 | Ga0207640_119858751 | 60 |
| 906 | 3300026041 | Ga0207639_10131727 | Ga0207639_101317272 | 60 |
| 907 | 3300026078 | Ga0207702_10462376 | Ga0207702_104623762 | 60 |
| 908 | 3300037312 | Ga0395899_0000007 | Ga0395899_0000007_299820_300002 | 60 |
| 909 | 3300037312 | Ga0395899_0021494 | Ga0395899_0021494_3089_3271 | 60 |
| 910 | 3300037312 | Ga0395899_0070803 | Ga0395899_0070803_679_861 | 60 |
| 911 | 3300037418 | Ga0395900_0003760 | Ga0395900_0003760_8856_9038 | 60 |
| 912 | 3300037418 | Ga0395900_0006222 | Ga0395900_0006222_9290_9472 | 60 |
| 913 | 3300037418 | Ga0395900_0019019 | Ga0395900_0019019_1478_1660 | 60 |
| 914 | 3300037418 | Ga0395900_0363491 | Ga0395900_0363491_654_836 | 60 |
| 915 | 3300037418 | Ga0395900_0671412 | Ga0395900_0671412_225_407 | 60 |
| 916 | 3300037466 | Ga0395898_0000276 | Ga0395898_0000276_114353_114535 | 60 |
| 917 | 3300037466 | Ga0395898_0148480 | Ga0395898_0148480_1267_1449 | 60 |
| 918 | 3300037471 | Ga0395905_1286533 | Ga0395905_1286533_26_208 | 60 |
| 919 | 3300038443 | Ga0395901_0000017 | Ga0395901_0000017_133940_134122 | 60 |
| 920 | 3300038443 | Ga0395901_0000410 | Ga0395901_0000410_44869_45051 | 60 |
| 921 | 3300038443 | Ga0395901_0002433 | Ga0395901_0002433_3922_4104 | 60 |
| 922 | 3300042005 | Ga0439448_0000098 | Ga0439448_0000098_884_1066 | 60 |
| 923 | 3300042012 | Ga0439455_0179302 | Ga0439455_0179302_215_397 | 60 |
| 924 | 3300044656 | Ga0466969_0000523 | Ga0466969_0000523_2396_2587 | 60 |
| 925 | 3300044658 | Ga0466972_0007257 | Ga0466972_0007257_50_241 | 60 |
| 926 | 3300044659 | Ga0466973_0019878 | Ga0466973_0019878_3097_3288 | 60 |
| 927 | 3300044660 | Ga0466974_0175636 | Ga0466974_0175636_419_601 | 60 |
| 928 | 3300044683 | Ga0466965_0076266 | Ga0466965_0076266_507_698 | 60 |
| 929 | 3300044684 | Ga0466966_0223709 | Ga0466966_0223709_800_982 | 60 |
| 930 | 3300044693 | Ga0466961_0175977 | Ga0466961_0175977_494_685 | 60 |
| 931 | 3300044694 | Ga0466963_0031580 | Ga0466963_0031580_1152_1343 | 60 |
| 932 | 3300044706 | Ga0466964_0187202 | Ga0466964_0187202_323_514 | 60 |
| 933 | 3300044719 | Ga0466971_0188451 | Ga0466971_0188451_483_665 | 60 |
| 934 | 3300044719 | Ga0466971_0241865 | Ga0466971_0241865_155_346 | 60 |
| 935 | 3300044765 | Ga0466970_0000982 | Ga0466970_0000982_4337_4528 | 60 |
| 936 | 3300044842 | Ga0466957_0007915 | Ga0466957_0007915_5531_5722 | 60 |
| 937 | 3300045049 | Ga0466959_0074060 | Ga0466959_0074060_1597_1788 | 60 |
| 938 | 3300045049 | Ga0466959_0152395 | Ga0466959_0152395_779_961 | 60 |
| 939 | 3300045049 | Ga0466959_0415505 | Ga0466959_0415505_120_302 | 60 |
| 940 | 3300045836 | Ga0466958_0005985 | Ga0466958_0005985_1593_1775 | 60 |
| 941 | 3300045836 | Ga0466958_0007577 | Ga0466958_0007577_5535_5726 | 60 |
| 942 | 3300061719 | Ga0466962_0018323 | Ga0466962_0018323_2949_3140 | 60 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar