F486362

General Info

Members Datasets Scaffolds Average Seq Length
942 492 1884 465

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10246668|Ga0207648_102466682
Length 424
Sequence MAGQYRTEKDTFGPIEVPAGRLWGAQTQRSLEHFRISGERMPAELVRALVEKADAIVAAADEVLAGRWPDEFPLVVWQTGSGTQTNMNANEVLANRASELLGGARGEGRLVHPNDDVNRSQSSNDIFPTAMNVAAVVAMRERVLPALARLRDTLRAKAEASADVVKIGRTHLQDATPLTLGHEISGYVAQLAHELAAGGTAVGTGLNAPVEFGARVAAELASRLGHPFVTAPNKFEALAAHDALTKIANDVRLLSSGPRSGLAEITIPENEPGSSIMPGKVNPTQCEALTMCACQVMGNDAAVNIGGSQGHFELNVFKPVIAHGFLQSVRLLGDGMQSFEEHCVRGIEPNRERIDELVGRSLMLVTALAPKIGYDKSAAIAKKAHKEGTTLREAALALRYVTAAEYDEWVRAEDMVGNSSRKKG

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
219 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
269 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
270 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
380 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
401 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
405 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
406 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
407 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
412 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
413 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
420 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
421 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
422 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
423 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
424 2547132374 Acidovorax radicis N35 Isolate Unclassified
425 2547132512 Azospira oryzae 6a3 Isolate Unclassified
426 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
427 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
428 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
429 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
430 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
431 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
432 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
433 2643221569 Achromobacter sp. Root565 Isolate Unclassified
434 2643221594 Achromobacter sp. Root170 Isolate Unclassified
435 2643221609 Acidovorax sp. Root217 Isolate Unclassified
436 2643221611 Acidovorax sp. Root219 Isolate Unclassified
437 2643221621 Achromobacter sp. Root83 Isolate Unclassified
438 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
439 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
440 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
441 2643221651 Afipia sp. Root123D2 Isolate Unclassified
442 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
443 2643221658 Variovorax sp. Root411 Isolate Unclassified
444 2643221660 Methylibium sp. Root1272 Isolate Unclassified
445 2643221672 Variovorax sp. Root434 Isolate Unclassified
446 2643221717 Acidovorax sp. Root267 Isolate Unclassified
447 2738541277 Variovorax sp. GV051 Isolate Unclassified
448 2738541307 Variovorax sp. GV008 Isolate Unclassified
449 2738541337 Pelomonas sp. BT06 Isolate Unclassified
450 2738543012 Acidovorax sp. CF301 Isolate Unclassified
451 2738543019 Variovorax sp. GV040 Isolate Unclassified
452 2773857925 Microvirga vignae BR3299 Isolate Unclassified
453 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
454 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
455 2816332133 Acidovorax radicis 2721A Isolate Unclassified
456 2818991446 Variovorax sp. 1180 Isolate Unclassified
457 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
458 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
459 2842677519 Variovorax sp. R-72495 Isolate Unclassified
460 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
461 2842733646 Variovorax sp. R-72446 Isolate Unclassified
462 2842747753 Variovorax sp. R-72060 Isolate Unclassified
463 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
464 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
465 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
466 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
467 2885198086 Variovorax sp. 679 Isolate Unclassified
468 2885211737 Variovorax sp. 553 Isolate Unclassified
469 2885266251 Ralstonia sp. SET104 Isolate Nodule
470 2899924645 Variovorax sp. 369 Isolate Unclassified
471 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
472 2904456579 Variovorax sp. 2002 Isolate Unclassified
473 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
474 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
475 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
476 2919476304 Duganella sp. 3397 Isolate Unclassified
477 2928037797 Variovorax sp. 1126 Isolate Unclassified
478 2928044640 Variovorax sp. 1128 Isolate Unclassified
479 2928051484 Variovorax sp. 1133 Isolate Unclassified
480 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
481 2928070936 Variovorax gossypii 1167 Isolate Unclassified
482 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
483 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
484 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
485 2929520902 Variovorax beijingensis 502 Isolate Unclassified
486 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
487 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
488 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
489 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
490 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
491 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
492 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0.21
Isolates 7.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.87
Nodule 0.64
Rhizoplane 2.87
Rhizosphere 63.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10246668 3300026089 Bacteria 1592
2 JGI24741J21665_1000804 3300001915 Bacteria 9427
3 JGI24740J21852_10000278 3300001979 Bacteria 21674
4 JGI24740J21852_10001064 3300001979 Bacteria 12359
5 JGI25155J39150_1000008 3300002704 Bacteria 236146
6 JGI25156J39149_1000002 3300002705 Bacteria 343501
7 JGI25156J39149_1012444 3300002705 Bacteria 1869
8 JGI25156J39149_1012868 3300002705 Bacteria 1811
9 JGI25154J39366_1000010 3300002738 Bacteria 297985
10 JGI25154J39366_1000110 3300002738 Bacteria 71731
11 JGI25154J39366_1003035 3300002738 Bacteria 3810
12 JGI25157J39369_1000001 3300002741 Bacteria 363277
13 JGI25157J39369_1000015 3300002741 Bacteria 194042
14 JGI25150J39212_1003709 3300002774 Bacteria 3529
15 JGI25159J45721_1001031 3300002987 Bacteria 11936
16 JGI25159J45721_1003729 3300002987 Bacteria 5278
17 JGI25151J46595_10007117 3300003187 Bacteria 5518
18 JGI25160J50197_1000301 3300003354 Bacteria 34898
19 JGI25161J50226_1000043 3300003374 Bacteria 120741
20 JGI25161J50226_1004540 3300003374 Bacteria 2889
21 Ga0055538_1002482 3300003751 Bacteria 2685
22 Ga0055538_1002934 3300003751 Bacteria 2309
23 Ga0055539_1000075 3300003752 Bacteria 130079
24 Ga0055539_1000170 3300003752 Bacteria 57928
25 Ga0055539_1001228 3300003752 Bacteria 5157
26 Ga0055533_1000010 3300003756 Bacteria 491196
27 Ga0055533_1001222 3300003756 Bacteria 7141
28 Ga0055533_1002231 3300003756 Bacteria 4552
29 Ga0055533_1002410 3300003756 Bacteria 4260
30 Ga0055532_1000056 3300003758 Bacteria 158878
31 Ga0055525_1000363 3300003759 Bacteria 30516
32 Ga0055525_1001192 3300003759 Bacteria 5838
33 Ga0055535_1000013 3300003761 Bacteria 299614
34 Ga0055535_1000263 3300003761 Bacteria 55363
35 Ga0055542_1000004 3300003762 Bacteria 553532
36 Ga0055542_1001053 3300003762 Bacteria 17140
37 Ga0055529_1000074 3300003763 Bacteria 158872
38 Ga0055529_1000303 3300003763 Bacteria 56663
39 Ga0055526_1004895 3300003771 Bacteria 7886
40 Ga0055537_1000479 3300003773 Bacteria 25018
41 Ga0055537_1001694 3300003773 Bacteria 8165
42 Ga0055524_1000130 3300003775 Bacteria 88754
43 Ga0055536_1004820 3300003781 Bacteria 6750
44 Ga0055536_1005488 3300003781 Bacteria 6186
45 Ga0055536_1008676 3300003781 Bacteria 4323
46 Ga0055534_1001079 3300003784 Bacteria 11696
47 Ga0055534_1001759 3300003784 Bacteria 8165
48 Ga0055528_1000145 3300003790 Bacteria 58081
49 Ga0055528_1003313 3300003790 Bacteria 8165
50 Ga0055530_10000265 3300003791 Bacteria 47389
51 Ga0055530_10007868 3300003791 Bacteria 4389
52 Ga0055530_10013640 3300003791 Bacteria 2759
53 Ga0055530_10016000 3300003791 Bacteria 2418
54 Ga0055540_1000079 3300003792 Bacteria 112817
55 Ga0055540_1004516 3300003792 Bacteria 6231
56 Ga0055540_1005170 3300003792 Bacteria 5603
57 Ga0055531_10002186 3300003794 Bacteria 13339
58 Ga0055531_10006273 3300003794 Bacteria 6777
59 Ga0055541_1000278 3300003841 Bacteria 17679
60 Ga0055541_1002512 3300003841 Bacteria 3644
61 Ga0055543_1000805 3300004625 Bacteria 15454
62 Ga0065714_10004198 3300005288 Bacteria 5443
63 Ga0070676_10003870 3300005328 Bacteria 7863
64 Ga0070676_10056245 3300005328 Bacteria 2324
65 Ga0070683_100003533 3300005329 Bacteria 12724
66 Ga0070683_100119340 3300005329 Bacteria 2491
67 Ga0070690_100019559 3300005330 Bacteria 4113
68 Ga0070690_100067862 3300005330 Bacteria 2312
69 Ga0070670_100003950 3300005331 Bacteria 12373
70 Ga0070670_100004715 3300005331 Bacteria 11440
71 Ga0070670_100014050 3300005331 Bacteria 6868
72 Ga0070670_100149804 3300005331 Bacteria 2019
73 Ga0068869_100017109 3300005334 Bacteria 4907
74 Ga0068869_100058068 3300005334 Bacteria 2828
75 Ga0068869_100101671 3300005334 Bacteria 2175
76 Ga0070666_10003561 3300005335 Bacteria 9442
77 Ga0070666_10062188 3300005335 Bacteria 2529
78 Ga0070680_100006104 3300005336 Bacteria 9131
79 Ga0068868_100001107 3300005338 Bacteria 18443
80 Ga0068868_100002281 3300005338 Bacteria 13257
81 Ga0068868_100012489 3300005338 Bacteria 6211
82 Ga0068868_100068762 3300005338 Bacteria 2821
83 Ga0070660_100008902 3300005339 Bacteria 7037
84 Ga0070660_100071336 3300005339 Bacteria 2712
85 Ga0070689_100017673 3300005340 Bacteria 5244
86 Ga0070661_100000154 3300005344 Bacteria 56626
87 Ga0070661_100005559 3300005344 Bacteria 8688
88 Ga0070668_100062585 3300005347 Bacteria 2883
89 Ga0070669_100038621 3300005353 Bacteria 3466
90 Ga0070669_100175811 3300005353 Bacteria 1672
91 Ga0070675_100002327 3300005354 Bacteria 14133
92 Ga0070675_100055711 3300005354 Bacteria 3255
93 Ga0070675_100068410 3300005354 Bacteria 2940
94 Ga0070675_100079092 3300005354 Bacteria 2739
95 Ga0070675_100217010 3300005354 Bacteria 1664
96 Ga0070671_100003169 3300005355 Bacteria 12826
97 Ga0070671_100006639 3300005355 Bacteria 9248
98 Ga0070674_100012531 3300005356 Bacteria 5209
99 Ga0070674_100094518 3300005356 Bacteria 2165
100 Ga0070673_100004435 3300005364 Bacteria 8881
101 Ga0070673_100007098 3300005364 Bacteria 7356
102 Ga0070673_100141301 3300005364 Bacteria 2031
103 Ga0070688_100008223 3300005365 Bacteria 5654
104 Ga0070688_100011876 3300005365 Bacteria 4860
105 Ga0070659_100072608 3300005366 Bacteria 2738
106 Ga0070667_100002446 3300005367 Bacteria 16231
107 Ga0070667_100045319 3300005367 Bacteria 3697
108 Ga0070667_100049466 3300005367 Bacteria 3541
109 Ga0070667_100057059 3300005367 Bacteria 3299
110 Ga0070713_100000260 3300005436 Bacteria 34743
111 Ga0070701_10000785 3300005438 Bacteria 11356
112 Ga0070711_100049030 3300005439 Bacteria 2891
113 Ga0070700_100005781 3300005441 Bacteria 6564
114 Ga0070663_100000002 3300005455 Bacteria 298075
115 Ga0070663_100043557 3300005455 Bacteria 3159
116 Ga0070678_100002072 3300005456 Bacteria 10877
117 Ga0070678_100004119 3300005456 Bacteria 8191
118 Ga0070678_100123478 3300005456 Bacteria 2046
119 Ga0070662_100162058 3300005457 Bacteria 1750
120 Ga0070681_10060581 3300005458 Bacteria 3761
121 Ga0068867_100004890 3300005459 Bacteria 9431
122 Ga0068867_100008662 3300005459 Bacteria 7183
123 Ga0068867_100021092 3300005459 Bacteria 4646
124 Ga0068867_100026104 3300005459 Bacteria 4193
125 Ga0068867_100084636 3300005459 Bacteria 2396
126 Ga0070698_100192809 3300005471 Bacteria 1975
127 Ga0070679_100008378 3300005530 Bacteria 9727
128 Ga0070684_100047479 3300005535 Bacteria 3721
129 Ga0070684_100144926 3300005535 Bacteria 2149
130 Ga0068853_100119887 3300005539 Bacteria 2345
131 Ga0070672_100001173 3300005543 Bacteria 16022
132 Ga0070672_100011477 3300005543 Bacteria 6179
133 Ga0070672_100021015 3300005543 Bacteria 4772
134 Ga0070672_100109306 3300005543 Bacteria 2252
135 Ga0070696_100112285 3300005546 Bacteria 1964
136 Ga0070696_100161684 3300005546 Bacteria 1650
137 Ga0070693_100001943 3300005547 Bacteria 9464
138 Ga0070693_100080148 3300005547 Bacteria 1944
139 Ga0070704_100032829 3300005549 Bacteria 3505
140 Ga0068855_100008864 3300005563 Bacteria 12158
141 Ga0068855_100023596 3300005563 Bacteria 7367
142 Ga0068855_100032986 3300005563 Bacteria 6182
143 Ga0068855_100211745 3300005563 Bacteria 2177
144 Ga0070664_100000004 3300005564 Bacteria 298075
145 Ga0070664_100001898 3300005564 Bacteria 16789
146 Ga0070664_100021981 3300005564 Bacteria 5260
147 Ga0070664_100024552 3300005564 Bacteria 4987
148 Ga0070664_100075463 3300005564 Bacteria 2895
149 Ga0068857_100011891 3300005577 Bacteria 7571
150 Ga0068857_100114094 3300005577 Bacteria 2430
151 Ga0068854_100000007 3300005578 Bacteria 182830
152 Ga0068854_100019412 3300005578 Bacteria 4580
153 Ga0068854_100046118 3300005578 Bacteria 3102
154 Ga0068854_100049539 3300005578 Bacteria 3001
155 Ga0068856_100000105 3300005614 Bacteria 81780
156 Ga0068856_100003075 3300005614 Bacteria 17033
157 Ga0068856_100045672 3300005614 Bacteria 4314
158 Ga0068856_100062489 3300005614 Bacteria 3679
159 Ga0070702_100026225 3300005615 Bacteria 3129
160 Ga0068852_100000657 3300005616 Bacteria 22644
161 Ga0068852_100001399 3300005616 Bacteria 16231
162 Ga0068852_100046435 3300005616 Bacteria 3701
163 Ga0068852_100071851 3300005616 Bacteria 3040
164 Ga0068852_100086172 3300005616 Bacteria 2799
165 Ga0068852_100220107 3300005616 Bacteria 1805
166 Ga0068859_100040590 3300005617 Bacteria 4671
167 Ga0068859_100103867 3300005617 Bacteria 2900
168 Ga0068859_100215420 3300005617 Bacteria 2008
169 Ga0068864_100002769 3300005618 Bacteria 14470
170 Ga0068864_100014646 3300005618 Bacteria 6514
171 Ga0068861_100009167 3300005719 Bacteria 6824
172 Ga0068851_10002400 3300005834 Bacteria 8222
173 Ga0068851_10004032 3300005834 Bacteria 6591
174 Ga0068851_10013011 3300005834 Bacteria 3933
175 Ga0068851_10014932 3300005834 Bacteria 3694
176 Ga0068863_100038522 3300005841 Bacteria 4548
177 Ga0068863_100082128 3300005841 Bacteria 3053
178 Ga0068863_100091842 3300005841 Bacteria 2879
179 Ga0068858_100002093 3300005842 Bacteria 20270
180 Ga0068858_100002948 3300005842 Bacteria 17114
181 Ga0068858_100006154 3300005842 Bacteria 11707
182 Ga0068858_100024262 3300005842 Bacteria 5652
183 Ga0068860_100147079 3300005843 Bacteria 2267
184 Ga0081455_10072235 3300005937 Bacteria 2858
185 Ga0081540_1025348 3300005983 Bacteria 3415
186 Ga0081540_1028320 3300005983 Bacteria 3149
187 Ga0075365_10006297 3300006038 Bacteria 6515
188 Ga0075363_100008202 3300006048 Bacteria 4851
189 Ga0075363_100027756 3300006048 Bacteria 2905
190 Ga0075364_10043684 3300006051 Bacteria 2914
191 Ga0075432_10008307 3300006058 Bacteria 3541
192 Ga0075362_10005224 3300006177 Bacteria 4736
193 Ga0075362_10013155 3300006177 Bacteria 3305
194 Ga0075362_10024609 3300006177 Bacteria 2555
195 Ga0075367_10038654 3300006178 Bacteria 2779
196 Ga0075366_10002236 3300006195 Bacteria 9884
197 Ga0075366_10015544 3300006195 Bacteria 4365
198 Ga0075366_10026976 3300006195 Bacteria 3368
199 Ga0075366_10141961 3300006195 Bacteria 1452
200 Ga0097621_100003706 3300006237 Bacteria 10577
201 Ga0097621_100043803 3300006237 Bacteria 3609
202 Ga0075370_10001173 3300006353 Bacteria 11030
203 Ga0075370_10003518 3300006353 Bacteria 7469
204 Ga0075370_10006457 3300006353 Bacteria 5900
205 Ga0075370_10017583 3300006353 Bacteria 3865
206 Ga0075370_10038206 3300006353 Bacteria 2701
207 Ga0075370_10038706 3300006353 Bacteria 2684
208 Ga0075370_10047214 3300006353 Bacteria 2438
209 Ga0075370_10067516 3300006353 Bacteria 2041
210 Ga0075370_10109081 3300006353 Bacteria 1606
211 Ga0068871_100007836 3300006358 Bacteria 7651
212 Ga0068871_100010284 3300006358 Bacteria 6819
213 Ga0068871_100041229 3300006358 Bacteria 3701
214 Ga0068871_100142682 3300006358 Bacteria 2038
215 Ga0075428_100007264 3300006844 Bacteria 12269
216 Ga0075428_100027967 3300006844 Bacteria 6239
217 Ga0075428_100126167 3300006844 Bacteria 2785
218 Ga0075431_100017842 3300006847 Bacteria 7216
219 Ga0075433_10056526 3300006852 Bacteria 3427
220 Ga0075434_100017636 3300006871 Bacteria 6881
221 Ga0075434_100108235 3300006871 Bacteria 2790
222 Ga0068865_100023267 3300006881 Bacteria 4055
223 Ga0068865_100077489 3300006881 Bacteria 2376
224 Ga0075436_100002487 3300006914 Bacteria 12680
225 Ga0097620_100040590 3300006931 Bacteria 4671
226 Ga0097620_100103873 3300006931 Bacteria 2900
227 Ga0097620_100215428 3300006931 Bacteria 2008
228 Ga0099826_10013779 3300006948 Bacteria 6112
229 Ga0075435_100009943 3300007076 Bacteria 6928
230 Ga0075435_100106905 3300007076 Bacteria 2324
231 Ga0099794_10007301 3300007265 Bacteria 4531
232 Ga0105244_10013167 3300009036 Bacteria 4845
233 Ga0105240_10008549 3300009093 Bacteria 14630
234 Ga0105240_10013136 3300009093 Bacteria 11394
235 Ga0105240_10027970 3300009093 Bacteria 7374
236 Ga0105240_10047106 3300009093 Bacteria 5457
237 Ga0105240_10056972 3300009093 Bacteria 4886
238 Ga0105240_10072570 3300009093 Bacteria 4254
239 Ga0105240_10278239 3300009093 Bacteria 1923
240 Ga0111539_10003794 3300009094 Bacteria 19890
241 Ga0111539_10076735 3300009094 Bacteria 3934
242 Ga0105245_10015781 3300009098 Bacteria 6587
243 Ga0105245_10029552 3300009098 Bacteria 4844
244 Ga0114129_10000191 3300009147 Bacteria 69079
245 Ga0105243_10001633 3300009148 Bacteria 19478
246 Ga0105243_10094247 3300009148 Bacteria 2472
247 Ga0105243_10114106 3300009148 Bacteria 2267
248 Ga0105243_10175915 3300009148 Bacteria 1857
249 Ga0105241_10029165 3300009174 Bacteria 4114
250 Ga0105242_10011209 3300009176 Bacteria 6888
251 Ga0105242_10014042 3300009176 Bacteria 6198
252 Ga0105242_10018794 3300009176 Bacteria 5409
253 Ga0105242_10095363 3300009176 Bacteria 2511
254 Ga0105248_10035562 3300009177 Bacteria 5573
255 Ga0105248_10061334 3300009177 Bacteria 4222
256 Ga0105248_10231613 3300009177 Bacteria 2080
257 Ga0105237_10011535 3300009545 Bacteria 9346
258 Ga0105238_10094296 3300009551 Bacteria 2981
259 Ga0105238_10122429 3300009551 Bacteria 2580
260 Ga0105249_10286037 3300009553 Bacteria 1648
261 Ga0105239_10064425 3300010375 Bacteria 4023
262 Ga0105246_10095577 3300011119 Bacteria 2152
263 Ga0157326_1001558 3300012513 Bacteria 2513
264 Ga0157373_10010719 3300013100 Bacteria 6743
265 Ga0157371_10000223 3300013102 Bacteria 82671
266 Ga0157371_10027203 3300013102 Bacteria 4149
267 Ga0157370_10000074 3300013104 Bacteria 108622
268 Ga0157369_10001333 3300013105 Bacteria 30529
269 Ga0157369_10002601 3300013105 Bacteria 21597
270 Ga0157369_10042171 3300013105 Bacteria 4979
271 Ga0157369_10044657 3300013105 Bacteria 4821
272 Ga0157369_10124864 3300013105 Bacteria 2730
273 Ga0157374_10027309 3300013296 Bacteria 5145
274 Ga0157374_10087099 3300013296 Bacteria 2972
275 Ga0157374_10106087 3300013296 Bacteria 2699
276 Ga0157378_10104692 3300013297 Bacteria 2587
277 Ga0163162_10028421 3300013306 Bacteria 5533
278 Ga0163162_10057090 3300013306 Bacteria 3932
279 Ga0163162_10181338 3300013306 Bacteria 2232
280 Ga0157372_10000085 3300013307 Bacteria 96915
281 Ga0157372_10003798 3300013307 Bacteria 16216
282 Ga0157372_10189877 3300013307 Bacteria 2379
283 Ga0157372_10215889 3300013307 Bacteria 2223
284 Ga0157375_10017231 3300013308 Bacteria 6514
285 Ga0157375_10070595 3300013308 Bacteria 3503
286 Ga0157375_10306790 3300013308 Bacteria 1751
287 Ga0163163_10008501 3300014325 Bacteria 9123
288 Ga0157380_10084084 3300014326 Bacteria 2609
289 Ga0182008_10003393 3300014497 Bacteria 9644
290 Ga0182008_10005698 3300014497 Bacteria 7051
291 Ga0157377_10002089 3300014745 Bacteria 8780
292 Ga0157377_10013626 3300014745 Bacteria 4120
293 Ga0157379_10034664 3300014968 Bacteria 4500
294 Ga0157379_10043161 3300014968 Bacteria 4026
295 Ga0157379_10248816 3300014968 Bacteria 1613
296 Ga0157376_10122217 3300014969 Bacteria 2309
297 Ga0182006_1000867 3300015261 Bacteria 20300
298 Ga0182006_1003465 3300015261 Bacteria 8053
299 Ga0182007_10006348 3300015262 Bacteria 5083
300 Ga0182007_10027387 3300015262 Bacteria 1965
301 Ga0183362_10001 3300015683 Bacteria 2046624
302 Ga0163161_10001379 3300017792 Bacteria 18020
303 Ga0163161_10004878 3300017792 Bacteria 9346
304 Ga0154015_1416575 3300020610 Bacteria 9701
305 Ga0213872_10000029 3300021361 Bacteria 145850
306 Ga0213872_10000618 3300021361 Bacteria 26906
307 Ga0209435_100001 3300025206 Bacteria 1424171
308 Ga0209784_100008 3300025224 Bacteria 740293
309 Ga0209784_100500 3300025224 Bacteria 15408
310 Ga0209784_101272 3300025224 Bacteria 3684
311 Ga0209566_100006 3300025225 Bacteria 789272
312 Ga0209566_100280 3300025225 Bacteria 47182
313 Ga0209566_102291 3300025225 Bacteria 3702
314 Ga0209674_100003 3300025226 Bacteria 2196646
315 Ga0209674_100070 3300025226 Bacteria 242214
316 Ga0209674_100741 3300025226 Bacteria 11140
317 Ga0209672_100436 3300025228 Bacteria 23953
318 Ga0209672_101988 3300025228 Bacteria 5711
319 Ga0209672_102654 3300025228 Bacteria 4192
320 Ga0209147_100005 3300025229 Bacteria 1036530
321 Ga0209147_100541 3300025229 Bacteria 21608
322 Ga0209563_100010 3300025230 Bacteria 1337457
323 Ga0209563_100016 3300025230 Bacteria 802091
324 Ga0207427_100468 3300025231 Bacteria 22112
325 Ga0209258_100007 3300025242 Bacteria 1036530
326 Ga0209258_100022 3300025242 Bacteria 553584
327 Ga0209258_100163 3300025242 Bacteria 149677
328 Ga0209258_100903 3300025242 Bacteria 15270
329 Ga0207425_1001500 3300025245 Bacteria 9683
330 Ga0209646_1000001 3300025246 Bacteria 3092932
331 Ga0209646_1000016 3300025246 Bacteria 501688
332 Ga0209646_1000226 3300025246 Bacteria 60008
333 Ga0209026_1000001 3300025250 Bacteria 1228671
334 Ga0209026_1000021 3300025250 Bacteria 375165
335 Ga0209026_1001650 3300025250 Bacteria 9455
336 Ga0209677_100008 3300025253 Bacteria 802091
337 Ga0209677_100106 3300025253 Bacteria 89125
338 Ga0209677_100480 3300025253 Bacteria 22721
339 Ga0209148_1000034 3300025254 Bacteria 553584
340 Ga0209148_1000051 3300025254 Bacteria 401000
341 Ga0209759_1000001 3300025256 Bacteria 2799452
342 Ga0209759_1000025 3300025256 Bacteria 317082
343 Ga0209759_1000684 3300025256 Bacteria 30588
344 Ga0209759_1000939 3300025256 Bacteria 20977
345 Ga0209759_1001423 3300025256 Bacteria 13586
346 Ga0209759_1002409 3300025256 Bacteria 8224
347 Ga0209759_1019363 3300025256 Bacteria 1615
348 Ga0209129_1000023 3300025258 Bacteria 420646
349 Ga0209565_1000096 3300025263 Bacteria 134434
350 Ga0209565_1000288 3300025263 Bacteria 49295
351 Ga0209455_1000011 3300025272 Bacteria 947242
352 Ga0209455_1000059 3300025272 Bacteria 339995
353 Ga0209673_1000232 3300025273 Bacteria 108581
354 Ga0209673_1000838 3300025273 Bacteria 40184
355 Ga0209673_1004143 3300025273 Bacteria 7943
356 Ga0209673_1006206 3300025273 Bacteria 5834
357 Ga0209130_1000041 3300025284 Bacteria 261078
358 Ga0209130_1000113 3300025284 Bacteria 130804
359 Ga0209130_1000508 3300025284 Bacteria 39372
360 Ga0209130_1001465 3300025284 Bacteria 15515
361 Ga0209130_1002443 3300025284 Bacteria 9301
362 Ga0209130_1012728 3300025284 Bacteria 2184
363 Ga0209675_1000128 3300025291 Bacteria 103111
364 Ga0209675_1000276 3300025291 Bacteria 49295
365 Ga0209675_1002475 3300025291 Bacteria 9472
366 Ga0209675_1002568 3300025291 Bacteria 9212
367 Ga0209675_1003811 3300025291 Bacteria 6959
368 Ga0209676_1000005 3300025292 Bacteria 1076001
369 Ga0209676_1000054 3300025292 Bacteria 365890
370 Ga0209676_1000418 3300025292 Bacteria 75214
371 Ga0209676_1000705 3300025292 Bacteria 46561
372 Ga0209676_1003053 3300025292 Bacteria 10807
373 Ga0209025_1000531 3300025294 Bacteria 72578
374 Ga0209025_1001493 3300025294 Bacteria 30271
375 Ga0209025_1003884 3300025294 Bacteria 13507
376 Ga0209025_1006696 3300025294 Bacteria 8844
377 Ga0209025_1014270 3300025294 Bacteria 4906
378 Ga0209025_1016285 3300025294 Bacteria 4403
379 Ga0209025_1020721 3300025294 Bacteria 3576
380 Ga0209025_1053271 3300025294 Bacteria 1589
381 Ga0209564_1000394 3300025295 Bacteria 78197
382 Ga0209564_1000912 3300025295 Bacteria 38636
383 Ga0209564_1001098 3300025295 Bacteria 32197
384 Ga0209564_1009461 3300025295 Bacteria 4634
385 Ga0209564_1021392 3300025295 Bacteria 2328
386 Ga0209758_1000064 3300025297 Bacteria 311812
387 Ga0209758_1004529 3300025297 Bacteria 11503
388 Ga0209050_1000007 3300025298 Bacteria 1187891
389 Ga0209050_1000066 3300025298 Bacteria 305458
390 Ga0209050_1000570 3300025298 Bacteria 59779
391 Ga0209050_1000690 3300025298 Bacteria 50644
392 Ga0209050_1002949 3300025298 Bacteria 13300
393 Ga0209050_1016296 3300025298 Bacteria 3052
394 Ga0209050_1028547 3300025298 Bacteria 1807
395 Ga0209256_1000003 3300025299 Bacteria 1661127
396 Ga0209256_1000020 3300025299 Bacteria 542402
397 Ga0209256_1000577 3300025299 Bacteria 52302
398 Ga0209256_1017307 3300025299 Bacteria 2402
399 Ga0207426_1000001 3300025302 Bacteria 1341301
400 Ga0207426_1000031 3300025302 Bacteria 460699
401 Ga0207426_1000061 3300025302 Bacteria 362507
402 Ga0207426_1020654 3300025302 Bacteria 2286
403 Ga0209051_1000009 3300025303 Bacteria 706778
404 Ga0209051_1000044 3300025303 Bacteria 305458
405 Ga0209051_1000363 3300025303 Bacteria 66432
406 Ga0209051_1000385 3300025303 Bacteria 62270
407 Ga0209051_1000491 3300025303 Bacteria 51059
408 Ga0209051_1001856 3300025303 Bacteria 16643
409 Ga0209051_1001872 3300025303 Bacteria 16521
410 Ga0209051_1012913 3300025303 Bacteria 4009
411 Ga0209257_1000011 3300025304 Bacteria 1112630
412 Ga0209257_1000032 3300025304 Bacteria 680354
413 Ga0209257_1000055 3300025304 Bacteria 415534
414 Ga0209257_1000082 3300025304 Bacteria 305458
415 Ga0209257_1000502 3300025304 Bacteria 69204
416 Ga0209257_1007175 3300025304 Bacteria 6843
417 Ga0209257_1017587 3300025304 Bacteria 2805
418 Ga0207697_10073410 3300025315 Bacteria 1436
419 Ga0207656_10002382 3300025321 Bacteria 6320
420 Ga0207656_10002699 3300025321 Bacteria 6018
421 Ga0207655_1001588 3300025728 Bacteria 20387
422 Ga0207688_10031734 3300025901 Bacteria 2918
423 Ga0207688_10079934 3300025901 Bacteria 1866
424 Ga0207680_10002745 3300025903 Bacteria 8233
425 Ga0207645_10045934 3300025907 Bacteria 2790
426 Ga0207705_10022746 3300025909 Bacteria 4471
427 Ga0207705_10066011 3300025909 Bacteria 2617
428 Ga0207695_10001193 3300025913 Bacteria 44667
429 Ga0207695_10021707 3300025913 Bacteria 7317
430 Ga0207695_10053129 3300025913 Bacteria 4239
431 Ga0207695_10057592 3300025913 Bacteria 4036
432 Ga0207695_10111600 3300025913 Bacteria 2713
433 Ga0207695_10119697 3300025913 Bacteria 2603
434 Ga0207671_10111753 3300025914 Bacteria 2079
435 Ga0207663_10076611 3300025916 Bacteria 2174
436 Ga0207657_10078012 3300025919 Bacteria 2791
437 Ga0207657_10158475 3300025919 Bacteria 1839
438 Ga0207649_10000573 3300025920 Bacteria 25163
439 Ga0207649_10002026 3300025920 Bacteria 11523
440 Ga0207649_10016787 3300025920 Bacteria 4139
441 Ga0207694_10018078 3300025924 Bacteria 5329
442 Ga0207650_10001127 3300025925 Bacteria 19637
443 Ga0207650_10008883 3300025925 Bacteria 6865
444 Ga0207650_10056820 3300025925 Bacteria 2909
445 Ga0207650_10124999 3300025925 Bacteria 2007
446 Ga0207659_10000725 3300025926 Bacteria 19531
447 Ga0207659_10005217 3300025926 Bacteria 7864
448 Ga0207659_10007325 3300025926 Bacteria 6781
449 Ga0207659_10023175 3300025926 Bacteria 4141
450 Ga0207659_10029587 3300025926 Bacteria 3735
451 Ga0207687_10041114 3300025927 Bacteria 3173
452 Ga0207700_10000189 3300025928 Bacteria 36770
453 Ga0207644_10003511 3300025931 Bacteria 10148
454 Ga0207644_10008443 3300025931 Bacteria 6740
455 Ga0207644_10034969 3300025931 Bacteria 3518
456 Ga0207644_10047418 3300025931 Bacteria 3066
457 Ga0207644_10068715 3300025931 Bacteria 2585
458 Ga0207690_10016369 3300025932 Bacteria 4508
459 Ga0207690_10067507 3300025932 Bacteria 2453
460 Ga0207690_10073921 3300025932 Bacteria 2359
461 Ga0207706_10025633 3300025933 Bacteria 5282
462 Ga0207706_10128246 3300025933 Bacteria 2231
463 Ga0207686_10013089 3300025934 Bacteria 4581
464 Ga0207686_10063141 3300025934 Bacteria 2354
465 Ga0207686_10063988 3300025934 Bacteria 2341
466 Ga0207709_10001604 3300025935 Bacteria 15408
467 Ga0207709_10021990 3300025935 Bacteria 3614
468 Ga0207670_10019227 3300025936 Bacteria 4168
469 Ga0207670_10029754 3300025936 Bacteria 3482
470 Ga0207669_10007934 3300025937 Bacteria 4952
471 Ga0207691_10001444 3300025940 Bacteria 23682
472 Ga0207691_10002459 3300025940 Bacteria 18118
473 Ga0207691_10009240 3300025940 Bacteria 9460
474 Ga0207691_10010513 3300025940 Bacteria 8880
475 Ga0207691_10093396 3300025940 Bacteria 2694
476 Ga0207711_10008783 3300025941 Bacteria 8450
477 Ga0207711_10011843 3300025941 Bacteria 7247
478 Ga0207711_10129756 3300025941 Bacteria 2259
479 Ga0207689_10015681 3300025942 Bacteria 6416
480 Ga0207689_10097636 3300025942 Bacteria 2413
481 Ga0207661_10007156 3300025944 Bacteria 7926
482 Ga0207661_10092462 3300025944 Bacteria 2522
483 Ga0207679_10000002 3300025945 Bacteria 634491
484 Ga0207679_10001704 3300025945 Bacteria 13702
485 Ga0207679_10007132 3300025945 Bacteria 7080
486 Ga0207667_10004568 3300025949 Bacteria 16974
487 Ga0207667_10009460 3300025949 Bacteria 11475
488 Ga0207667_10061375 3300025949 Bacteria 3932
489 Ga0207651_10002950 3300025960 Bacteria 8227
490 Ga0207651_10004833 3300025960 Bacteria 6860
491 Ga0207640_10017885 3300025981 Bacteria 4155
492 Ga0207640_10018533 3300025981 Bacteria 4092
493 Ga0207640_10027293 3300025981 Bacteria 3477
494 Ga0207640_10086378 3300025981 Bacteria 2160
495 Ga0207658_10025926 3300025986 Bacteria 4107
496 Ga0207658_10052793 3300025986 Bacteria 3001
497 Ga0207677_10003064 3300026023 Bacteria 8834
498 Ga0207677_10008356 3300026023 Bacteria 5778
499 Ga0207677_10026784 3300026023 Bacteria 3621
500 Ga0207677_10030189 3300026023 Bacteria 3456
501 Ga0207703_10001773 3300026035 Bacteria 19268
502 Ga0207703_10012670 3300026035 Bacteria 6575
503 Ga0207678_10000003 3300026067 Bacteria 282716
504 Ga0207708_10067958 3300026075 Bacteria 2727
505 Ga0207702_10000010 3300026078 Bacteria 292789
506 Ga0207702_10000522 3300026078 Bacteria 43072
507 Ga0207702_10036919 3300026078 Bacteria 4087
508 Ga0207702_10099499 3300026078 Bacteria 2563
509 Ga0207702_10107674 3300026078 Bacteria 2472
510 Ga0207702_10118365 3300026078 Bacteria 2367
511 Ga0207641_10019102 3300026088 Bacteria 5621
512 Ga0207641_10036585 3300026088 Bacteria 4098
513 Ga0207641_10162307 3300026088 Bacteria 2033
514 Ga0207641_10190351 3300026088 Bacteria 1885
515 Ga0207641_10222677 3300026088 Bacteria 1750
516 Ga0207648_10019713 3300026089 Bacteria 6086
517 Ga0207648_10024255 3300026089 Bacteria 5417
518 Ga0207648_10067748 3300026089 Bacteria 3111
519 Ga0207648_10075838 3300026089 Bacteria 2931
520 Ga0207648_10160568 3300026089 Bacteria 1985
521 Ga0207676_10001271 3300026095 Bacteria 18758
522 Ga0207676_10012287 3300026095 Bacteria 6130
523 Ga0207676_10020956 3300026095 Bacteria 4791
524 Ga0207676_10035333 3300026095 Bacteria 3792
525 Ga0207674_10023464 3300026116 Bacteria 6607
526 Ga0207674_10079210 3300026116 Bacteria 3290
527 Ga0207674_10107212 3300026116 Bacteria 2771
528 Ga0207674_10232195 3300026116 Bacteria 1792
529 Ga0207675_100018746 3300026118 Bacteria 6458
530 Ga0207675_100065898 3300026118 Bacteria 3385
531 Ga0207675_100079404 3300026118 Bacteria 3075
532 Ga0207675_100193442 3300026118 Bacteria 1952
533 Ga0207675_100267998 3300026118 Bacteria 1657
534 Ga0207683_10000838 3300026121 Bacteria 28142
535 Ga0207683_10005156 3300026121 Bacteria 11217
536 Ga0207683_10006290 3300026121 Bacteria 10176
537 Ga0207683_10015911 3300026121 Bacteria 6405
538 Ga0207683_10037520 3300026121 Bacteria 4220
539 Ga0207683_10039060 3300026121 Bacteria 4140
540 Ga0207683_10089575 3300026121 Bacteria 2739
541 Ga0207683_10129250 3300026121 Bacteria 2271
542 Ga0207698_10001250 3300026142 Bacteria 14873
543 Ga0207698_10009072 3300026142 Bacteria 6319
544 Ga0207698_10019512 3300026142 Bacteria 4643
545 Ga0207698_10052932 3300026142 Bacteria 3112
546 Ga0207698_10195860 3300026142 Bacteria 1805
547 Ga0207428_10001012 3300027907 Bacteria 31168
548 Ga0207428_10012148 3300027907 Bacteria 7579
549 Ga0268264_10137133 3300028381 Bacteria 2177
550 Ga0265337_1032774 3300028556 Bacteria 1536
551 Ga0265323_10003116 3300028653 Bacteria 7378
552 Ga0265323_10008205 3300028653 Bacteria 4319
553 Ga0265336_10000051 3300028666 Bacteria 114796
554 Ga0307515_10000028 3300028794 Bacteria 368467
555 Ga0307515_10000458 3300028794 Bacteria 97523
556 Ga0307515_10016545 3300028794 Bacteria 13496
557 Ga0307515_10048179 3300028794 Bacteria 6450
558 Ga0307515_10056923 3300028794 Bacteria 5670
559 Ga0307512_10055475 3300030522 Bacteria 3124
560 Ga0265325_10001972 3300031241 Bacteria 14131
561 Ga0265340_10000047 3300031247 Bacteria 55910
562 Ga0265331_10002871 3300031250 Bacteria 11392
563 Ga0265331_10031690 3300031250 Bacteria 2626
564 Ga0307513_10000021 3300031456 Bacteria 228078
565 Ga0307509_10000120 3300031507 Bacteria 114238
566 Ga0307509_10013526 3300031507 Bacteria 9654
567 Ga0307509_10060091 3300031507 Bacteria 4019
568 Ga0307509_10069501 3300031507 Bacteria 3681
569 Ga0307408_100000046 3300031548 Bacteria 167686
570 Ga0307408_100003007 3300031548 Bacteria 11658
571 Ga0307408_100047082 3300031548 Bacteria 3086
572 Ga0307408_100079883 3300031548 Bacteria 2442
573 Ga0307508_10000163 3300031616 Bacteria 80086
574 Ga0307508_10019292 3300031616 Bacteria 6200
575 Ga0307508_10023931 3300031616 Bacteria 5543
576 Ga0307514_10000828 3300031649 Bacteria 49982
577 Ga0307514_10046625 3300031649 Bacteria 3386
578 Ga0265314_10000007 3300031711 Bacteria 491737
579 Ga0265342_10001861 3300031712 Bacteria 19067
580 Ga0316576_10003935 3300031727 Bacteria 8816
581 Ga0307516_10018571 3300031730 Bacteria 7222
582 Ga0307516_10022115 3300031730 Bacteria 6534
583 Ga0307405_10049640 3300031731 Bacteria 2594
584 Ga0307413_10016958 3300031824 Bacteria 3781
585 Ga0307410_10056048 3300031852 Bacteria 2678
586 Ga0307406_10002339 3300031901 Bacteria 10300
587 Ga0307406_10008992 3300031901 Bacteria 5587
588 Ga0307406_10105266 3300031901 Bacteria 1930
589 Ga0307412_10000135 3300031911 Bacteria 53519
590 Ga0307412_10015988 3300031911 Bacteria 4459
591 Ga0307409_100010337 3300031995 Bacteria 5795
592 Ga0307416_100003363 3300032002 Bacteria 9368
593 Ga0307416_100017961 3300032002 Bacteria 4968
594 Ga0307416_100099633 3300032002 Bacteria 2524
595 Ga0307411_10011035 3300032005 Bacteria 4852
596 Ga0307411_10019119 3300032005 Bacteria 3948
597 Ga0307411_10040848 3300032005 Bacteria 2946
598 Ga0307415_100016744 3300032126 Bacteria 4378
599 Ga0307415_100023469 3300032126 Bacteria 3830
600 Ga0307510_10002394 3300033180 Bacteria 21269
601 Ga0307510_10018033 3300033180 Bacteria 8317
602 Ga0373926_0037748 3300035083 Bacteria 1719
603 Ga0373949_0004987 3300035090 Bacteria 2994
604 Ga0373923_0048720 3300035111 Bacteria 1770
605 Ga0373923_0067250 3300035111 Bacteria 1532
606 Ga0373939_0000139 3300035114 Bacteria 20747
607 Ga0373941_0013544 3300035115 Bacteria 2158
608 Ga0373945_0012903 3300035116 Bacteria 2783
609 Ga0373956_0000193 3300035119 Bacteria 23411
610 Ga0373931_0000908 3300035691 Bacteria 12513
611 Ga0373931_0004912 3300035691 Bacteria 6148
612 Ga0373927_0005732 3300035695 Bacteria 8531
613 Ga0373933_0000364 3300035724 Bacteria 28986
614 Ga0373937_0000182 3300036401 Bacteria 61628
615 Ga0373925_0045523 3300037068 Bacteria 3260
616 Ga0395899_0012470 3300037312 Bacteria 6511
617 Ga0395900_0003483 3300037418 Bacteria 16983
618 Ga0395898_0006685 3300037466 Bacteria 12296
619 Ga0395898_0010478 3300037466 Bacteria 9690
620 Ga0395905_0002802 3300037471 Bacteria 19102
621 Ga0395905_0018172 3300037471 Bacteria 6674
622 Ga0395905_0024518 3300037471 Bacteria 5692
623 Ga0395905_0029244 3300037471 Bacteria 5193
624 Ga0395905_0113031 3300037471 Bacteria 2551
625 Ga0395901_0015357 3300038443 Bacteria 7793
626 Ga0395901_0015454 3300038443 Bacteria 7773
627 Ga0395901_0022158 3300038443 Bacteria 6509
628 Ga0436361_0034352 3300039447 Bacteria 2194
629 Ga0436361_0625540 3300039447 Bacteria 4196
630 Ga0436363_0667407 3300039450 Bacteria 4068
631 Ga0439436_0007418 3300041404 Bacteria 3375
632 Ga0439436_0020373 3300041404 Bacteria 1975
633 Ga0451807_0675626 3300041486 Bacteria 9142
634 Ga0439445_0008291 3300042004 Bacteria 2429
635 Ga0439449_0008125 3300042007 Bacteria 3988
636 Ga0439449_0012578 3300042007 Bacteria 3183
637 Ga0439457_009413 3300042014 Bacteria 2275
638 Ga0450890_000536 3300042127 Bacteria 5601
639 Ga0450891_000192 3300042129 Bacteria 5988
640 Ga0439446_0019780 3300042156 Bacteria 1894
641 Ga0450893_0000214 3300042532 Bacteria 7709
642 Ga0451577_0000742 3300042876 Bacteria 50207
643 Ga0451577_0043187 3300042876 Bacteria 4038
644 Ga0451577_0085905 3300042876 Bacteria 2807
645 Ga0451577_0133455 3300042876 Bacteria 2228
646 Ga0466969_0000001 3300044656 Bacteria 189617
647 Ga0466969_0004528 3300044656 Bacteria 7398
648 Ga0466969_0016894 3300044656 Bacteria 3815
649 Ga0466972_0055407 3300044658 Bacteria 1907
650 Ga0466965_0004669 3300044683 Bacteria 6109
651 Ga0466966_0005235 3300044684 Bacteria 8527
652 Ga0466966_0006418 3300044684 Bacteria 7777
653 Ga0466961_0011024 3300044693 Bacteria 5776
654 Ga0466963_0008073 3300044694 Bacteria 6301
655 Ga0466964_0003328 3300044706 Bacteria 5858
656 Ga0466964_0004632 3300044706 Bacteria 5086
657 Ga0466964_0028165 3300044706 Bacteria 2211
658 Ga0453684_0000065 3300044712 Bacteria 468481
659 Ga0453684_0009901 3300044712 Bacteria 16457
660 Ga0466971_0004295 3300044719 Bacteria 6142
661 Ga0466970_0004172 3300044765 Bacteria 7108
662 Ga0466957_0014724 3300044842 Bacteria 4557
663 Ga0466957_0062297 3300044842 Bacteria 2290
664 Ga0466959_0000063 3300045049 Bacteria 75428
665 Ga0466959_0006014 3300045049 Bacteria 8376
666 Ga0466959_0026775 3300045049 Bacteria 4276
667 Ga0451576_0013881 3300045051 Bacteria 8997
668 Ga0451576_0044822 3300045051 Bacteria 4660
669 Ga0451576_0136973 3300045051 Bacteria 2553
670 Ga0466958_0004695 3300045836 Bacteria 7252
671 Ga0466958_0017953 3300045836 Bacteria 4100
672 Ga0466958_0018095 3300045836 Bacteria 4083
673 Ga0495617_012554 3300046452 Bacteria 2888
674 Ga0495617_038624 3300046452 Bacteria 1596
675 Ga0495592_0002422 3300046454 Bacteria 13147
676 Ga0495590_0010273 3300046457 Bacteria 3526
677 Ga0495629_0011897 3300046459 Bacteria 6309
678 Ga0495638_0002153 3300046460 Bacteria 16525
679 Ga0495638_0061966 3300046460 Bacteria 2310
680 Ga0495651_0000027 3300046462 Bacteria 107496
681 Ga0495580_0021078 3300046472 Bacteria 4813
682 Ga0495580_0028185 3300046472 Bacteria 4084
683 Ga0495582_0011400 3300046473 Bacteria 4897
684 Ga0495605_0001486 3300046474 Bacteria 15297
685 Ga0495639_0004066 3300046475 Bacteria 6270
686 Ga0495584_0000621 3300046491 Bacteria 23734
687 Ga0495585_0007084 3300046492 Bacteria 6891
688 Ga0495585_0056295 3300046492 Bacteria 2172
689 Ga0495585_0059195 3300046492 Bacteria 2111
690 Ga0495594_0002498 3300046499 Bacteria 9578
691 Ga0495583_0000016 3300046506 Bacteria 312691
692 Ga0495606_0002620 3300046507 Bacteria 20518
693 Ga0495616_0004257 3300046513 Bacteria 9046
694 Ga0495616_0005761 3300046513 Bacteria 7576
695 Ga0495616_0027002 3300046513 Bacteria 3049
696 Ga0495628_0005560 3300046516 Bacteria 11034
697 Ga0495628_0094618 3300046516 Bacteria 2309
698 Ga0495637_0045719 3300046520 Bacteria 1855
699 Ga0495637_0050812 3300046520 Bacteria 1738
700 Ga0495643_0003120 3300046522 Bacteria 12380
701 Ga0495648_0000593 3300046524 Bacteria 38760
702 Ga0495666_0064639 3300046526 Bacteria 1746
703 Ga0495652_0036854 3300046529 Bacteria 4247
704 Ga0495652_0071658 3300046529 Bacteria 2891
705 Ga0495665_0003964 3300046531 Bacteria 7996
706 Ga0495586_0090949 3300046535 Bacteria 1686
707 Ga0495587_0006273 3300046536 Bacteria 7760
708 Ga0495597_0004154 3300046542 Bacteria 8032
709 Ga0495597_0015616 3300046542 Bacteria 3592
710 Ga0495645_0002395 3300046543 Bacteria 12721
711 Ga0495622_0005439 3300046557 Bacteria 5910
712 Ga0495633_0002301 3300046558 Bacteria 13619
713 Ga0495633_0015720 3300046558 Bacteria 3922
714 Ga0495656_0000110 3300046615 Bacteria 32732
715 Ga0495668_0044647 3300046616 Bacteria 2463
716 Ga0495634_0019399 3300046642 Bacteria 4832
717 Ga0495611_0008728 3300046648 Bacteria 4286
718 Ga0495625_0002383 3300046660 Bacteria 20428
719 Ga0495625_0010249 3300046660 Bacteria 7771
720 Ga0495625_0080003 3300046660 Bacteria 2277
721 Ga0495635_0030188 3300046663 Bacteria 3767
722 Ga0495659_0007216 3300046664 Bacteria 3519
723 Ga0495661_0002005 3300046665 Bacteria 16054
724 Ga0495599_0000531 3300046678 Bacteria 21912
725 Ga0495599_0022849 3300046678 Bacteria 3906
726 Ga0495599_0140589 3300046678 Bacteria 1498
727 Ga0495623_0016524 3300046679 Bacteria 4768
728 Ga0495647_0011450 3300046681 Bacteria 3040
729 Ga0495658_0001699 3300046683 Bacteria 11444
730 Ga0495669_0025706 3300046684 Bacteria 2569
731 Ga0495670_0002770 3300046691 Bacteria 8667
732 Ga0495670_0005224 3300046691 Bacteria 6392
733 Ga0495671_0080841 3300046692 Bacteria 1592
734 Ga0495671_0111269 3300046692 Bacteria 1337
735 Ga0495581_0008234 3300047315 Bacteria 6042
736 Ga0495636_0000920 3300047318 Bacteria 10942
737 Ga0495672_0012407 3300047320 Bacteria 5948
738 Ga0495676_0012265 3300047321 Bacteria 7722
739 Ga0495676_0016453 3300047321 Bacteria 6564
740 Ga0495683_0006098 3300047323 Bacteria 6608
741 Ga0495687_000138 3300047443 Bacteria 110840
742 Ga0495687_006782 3300047443 Bacteria 6925
743 Ga0495687_025727 3300047443 Bacteria 2777
744 Ga0495677_0003212 3300047445 Bacteria 6372
745 Ga0495685_000219 3300047447 Bacteria 19447
746 Ga0495673_0000060 3300047469 Bacteria 231642
747 Ga0495684_0038078 3300047471 Bacteria 3688
748 Ga0495686_0006352 3300047472 Bacteria 9067
749 Ga0495593_0000759 3300047673 Bacteria 18716
750 Ga0495593_0011141 3300047673 Bacteria 5171
751 Ga0496100_0018668 3300048903 Bacteria 4119
752 Ga0496101_0061878 3300048904 Bacteria 2720
753 Ga0496101_0232980 3300048904 Bacteria 1432
754 Ga0496102_0071667 3300048905 Bacteria 3182
755 Ga0496102_0072781 3300048905 Bacteria 3159
756 Ga0496104_0040730 3300048907 Bacteria 4355
757 Ga0496105_0062478 3300048908 Bacteria 3074
758 Ga0496106_0023204 3300048909 Bacteria 4609
759 Ga0496107_0137097 3300048910 Bacteria 1808
760 Ga0496108_0040990 3300048911 Bacteria 3863
761 Ga0496108_0087964 3300048911 Bacteria 2639
762 Ga0496109_0024792 3300048912 Bacteria 5336
763 Ga0496109_0027408 3300048912 Bacteria 5086
764 Ga0496110_0004858 3300048913 Bacteria 10483
765 Ga0496110_0009425 3300048913 Bacteria 7908
766 Ga0496111_0032942 3300048914 Bacteria 3695
767 Ga0496111_0053081 3300048914 Bacteria 2928
768 Ga0496111_0086850 3300048914 Bacteria 2289
769 Ga0496112_0050038 3300048915 Bacteria 4096
770 Ga0496113_0146119 3300048916 Bacteria 1863
771 Ga0496115_0027971 3300048918 Bacteria 4415
772 Ga0496115_0066235 3300048918 Bacteria 2919
773 Ga0496116_0010521 3300048919 Bacteria 7738
774 Ga0496117_0025555 3300048920 Bacteria 4640
775 Ga0496119_0035106 3300048922 Bacteria 3290
776 Ga0496121_0000314 3300048924 Bacteria 100909
777 Ga0496121_0072459 3300048924 Bacteria 2765
778 Ga0496122_0000046 3300048925 Bacteria 274640
779 Ga0496122_0000217 3300048925 Bacteria 128502
780 Ga0496123_0000082 3300048926 Bacteria 188909
781 Ga0496123_0001126 3300048926 Bacteria 39890
782 Ga0496123_0022919 3300048926 Bacteria 4796
783 Ga0496124_0000038 3300048927 Bacteria 312485
784 Ga0496124_0057503 3300048927 Bacteria 3276
785 Ga0496125_0000028 3300048928 Bacteria 387222
786 Ga0496125_0000532 3300048928 Bacteria 65618
787 Ga0496125_0079036 3300048928 Bacteria 2525
788 Ga0495682_0002647 3300049460 Bacteria 8374
789 Ga0501034_0006242 3300049571 Bacteria 12827
790 Ga0501041_0172858 3300049577 Bacteria 1352
791 Ga0501042_0143664 3300049578 Bacteria 1721
792 Ga0501043_0156886 3300049579 Bacteria 1780
793 Ga0501047_0023913 3300049581 Bacteria 5866
794 Ga0501068_0067902 3300049584 Bacteria 2173
795 Ga0501069_0001500 3300049585 Bacteria 11533
796 Ga0501070_0003950 3300049586 Bacteria 12768
797 Ga0501072_0110293 3300049588 Bacteria 2190
798 Ga0501073_0000374 3300049589 Bacteria 30124
799 Ga0501073_0009188 3300049589 Bacteria 7290
800 Ga0501073_0019817 3300049589 Bacteria 4854
801 Ga0501074_0000125 3300049590 Bacteria 39203
802 Ga0501076_0025005 3300049592 Bacteria 4619
803 Ga0501198_000005 3300049649 Bacteria 156657
804 Ga0501222_000003 3300049662 Bacteria 157406
805 Ga0501079_0013497 3300049741 Bacteria 6229
806 Ga0501080_0001248 3300049742 Bacteria 21187
807 Ga0501080_0007975 3300049742 Bacteria 9595
808 Ga0501080_0039560 3300049742 Bacteria 4401
809 Ga0501083_0007469 3300049744 Bacteria 7746
810 Ga0501266_001164 3300049763 Bacteria 3377
811 Ga0501035_0067904 3300049822 Bacteria 3162
812 Ga0501035_0095951 3300049822 Bacteria 2606
813 nmdc:mga03683_20354_c1 3300050489 Bacteria 2545
814 nmdc:mga03683_22410_c1 3300050489 Bacteria 2449
815 nmdc:mga00v17_10232_c1 3300050491 Bacteria 5114
816 nmdc:mga00v17_48905_c1 3300050491 Bacteria 2563
817 nmdc:mga0k408_1565_c1 3300050493 Bacteria 12364
818 nmdc:mga0k408_26727_c1 3300050493 Bacteria 3274
819 nmdc:mga0k408_4867_c1 3300050493 Bacteria 7123
820 nmdc:mga0k408_6461_c1 3300050493 Bacteria 6248
821 nmdc:mga0k408_6553_c1 3300050493 Bacteria 6203
822 nmdc:mga0k408_76088_c1 3300050493 Bacteria 1962
823 nmdc:mga06z11_50874_c1 3300050494 Bacteria 2119
824 nmdc:mga07m45_18826_c1 3300050496 Bacteria 3734
825 nmdc:mga07m45_19735_c1 3300050496 Bacteria 3654
826 nmdc:mga07m45_202_c1 3300050496 Bacteria 23538
827 nmdc:mga07m45_21064_c1 3300050496 Bacteria 3547
828 nmdc:mga07m45_2832_c1 3300050496 Bacteria 8203
829 nmdc:mga07m45_43302_c1 3300050496 Bacteria 2524
830 nmdc:mga07m45_61657_c1 3300050496 Bacteria 2125
831 nmdc:mga07m45_716_c1 3300050496 Bacteria 14102
832 nmdc:mga07m45_8065_c1 3300050496 Bacteria 5399
833 nmdc:mga05p37_109213_c1 3300050507 Bacteria 3403
834 nmdc:mga0qj67_172497_c1 3300050509 Bacteria 1756
835 nmdc:mga0qj67_61514_c1 3300050509 Bacteria 2981
836 nmdc:mga06r32_704_c1 3300050510 Bacteria 29199
837 nmdc:mga08y16_59229_c1 3300050511 Bacteria 4001
838 nmdc:mga08y16_7529_c1 3300050511 Bacteria 11403
839 nmdc:mga0n895_13563_c1 3300050512 Bacteria 7361
840 nmdc:mga0rr50_11608_c1 3300050513 Bacteria 5651
841 nmdc:mga0rr50_119039_c1 3300050513 Bacteria 2099
842 nmdc:mga0rr50_33844_c1 3300050513 Bacteria 3654
843 nmdc:mga0rr50_7922_c1 3300050513 Bacteria 6590
844 nmdc:mga08x19_118322_c1 3300050514 Bacteria 1773
845 nmdc:mga08x19_9403_c1 3300050514 Bacteria 5853
846 nmdc:mga0a205_95540_c1 3300050515 Bacteria 2871
847 Ga0495601_0000822 3300053077 Bacteria 16815
848 Ga0500610_0000344 3300053079 Bacteria 14067
849 Ga0500610_0020666 3300053079 Bacteria 3217
850 Ga0500635_0000145 3300053080 Bacteria 40070
851 Ga0500651_0000353 3300053093 Bacteria 25788
852 Ga0500566_0000008 3300053094 Bacteria 143641
853 Ga0500562_004134 3300053108 Bacteria 3662
854 Ga0500569_000840 3300053109 Bacteria 5448
855 Ga0500572_001770 3300053111 Bacteria 5559
856 Ga0500614_003737 3300053123 Bacteria 3259
857 Ga0500652_035527 3300053131 Bacteria 1980
858 Ga0500559_0000011 3300053136 Bacteria 164751
859 Ga0500568_0005309 3300053139 Bacteria 6691
860 Ga0500600_0030483 3300053149 Bacteria 3174
861 Ga0500603_000040 3300053150 Bacteria 30803
862 Ga0500639_000010 3300053163 Bacteria 136747
863 Ga0500636_0034879 3300053177 Bacteria 2978
864 Ga0500637_0024809 3300053178 Bacteria 3288
865 Ga0500645_000274 3300053730 Bacteria 36869
866 Ga0500645_003458 3300053730 Bacteria 6402
867 Ga0587072_001478 3300059643 Bacteria 2920
868 Ga0466962_0008617 3300061719 Bacteria 4888
869 2511245553 2511231002 Bacteria 5042903
870 2513227406 2513020051 Bacteria 6053213
871 2513874577 2513237139 Bacteria 8737671
872 2513894527 2513237141 Bacteria 8496279
873 2524610238 2524023250 Bacteria 5457705
874 2548498292 2547132374 Bacteria 5530232
875 2548849106 2547132512 Bacteria 3416496
876 2599446114 2599185178 Bacteria 5365746
877 2599624514 2599185214 Bacteria 8209958
878 2599672624 2599185226 Bacteria 8233575
879 2599683624 2599185227 Bacteria 8246414
880 2599694233 2599185229 Bacteria 8216126
881 2643745913 2643221544 Bacteria 5886209
882 2643789322 2643221554 Bacteria 6603920
883 2643862684 2643221569 Bacteria 6064337
884 2643980310 2643221594 Bacteria 5811388
885 2644062964 2643221609 Bacteria 6756331
886 2644070647 2643221611 Bacteria 6820941
887 2644121910 2643221621 Bacteria 6212786
888 2644163167 2643221628 Bacteria 5745828
889 2644220868 2643221639 Bacteria 6649903
890 2644259689 2643221646 Bacteria 6433402
891 2644287379 2643221651 Bacteria 4798932
892 2644304754 2643221654 Bacteria 5273570
893 2644328078 2643221658 Bacteria 6064537
894 2644338114 2643221660 Bacteria 4208257
895 2644398613 2643221672 Bacteria 6322190
896 2644648826 2643221717 Bacteria 5676132
897 2738720186 2738541277 Bacteria 7458140
898 2738881730 2738541307 Bacteria 8606193
899 2739057284 2738541337 Bacteria 6183410
900 2739243723 2738543012 Bacteria 7115078
901 2739279385 2738543019 Bacteria 7459457
902 2774870257 2773857925 Bacteria 6472445
903 2805916573 2802429603 Bacteria 8777136
904 2809032376 2808606395 Bacteria 6020352
905 2816472553 2816332133 Bacteria 7249298
906 2819595927 2818991446 Bacteria 7757362
907 2831266924 2831265667 Bacteria 7184833
908 2838056983 2838054893 Bacteria 7451788
909 2842678798 2842677519 Bacteria 5615038
910 2842720292 2842718218 Bacteria 4560148
911 2842735547 2842733646 Bacteria 5716726
912 2842751360 2842747753 Bacteria 5578255
913 2857542486 2857537821 Bacteria 5248181
914 2857544781 2857542790 Bacteria 5326616
915 2884299549 2884298095 Bacteria 3823049
916 2885192848 2885192300 Bacteria 5882526
917 2885199021 2885198086 Bacteria 7212419
918 2885212716 2885211737 Bacteria 7212420
919 2885266755 2885266251 Bacteria 4796748
920 2899925275 2899924645 Bacteria 7487985
921 2904456432 2904449895 Bacteria 6927402
922 2904460705 2904456579 Bacteria 6819253
923 2904480318 2904479285 Bacteria 5073931
924 2904548380 2904541872 Bacteria 8915136
925 2919464427 2919462493 Bacteria 5817112
926 2919480809 2919476304 Bacteria 5888696
927 2928038602 2928037797 Bacteria 7273642
928 2928045793 2928044640 Bacteria 7271509
929 2928053410 2928051484 Bacteria 7773759
930 2928067015 2928064002 Bacteria 7419480
931 2928071086 2928070936 Bacteria 8062541
932 2928084972 2928084124 Bacteria 7159212
933 2928119752 2928115317 Bacteria 6477646
934 2929163773 2929160207 Bacteria 9075316
935 2929524915 2929520902 Bacteria 6765052
936 2945912432 2945909444 Bacteria 7065066
937 2945948342 2945945610 Bacteria 5951079
938 2945977017 2945972063 Bacteria 6086495
939 2945985250 2945984333 Bacteria 7358892
940 2954771993 2954767861 Bacteria 5535784
941 2974322718 2974320154 Bacteria 4571377
942 8006930500 8006926726 Bacteria 6749210
943 Ga0207648_10246668
944 JGI24741J21665_1000804
945 JGI24740J21852_10000278
946 JGI24740J21852_10001064
947 JGI25155J39150_1000008
948 JGI25156J39149_1000002
949 JGI25156J39149_1012444
950 JGI25156J39149_1012868
951 JGI25154J39366_1000010
952 JGI25154J39366_1000110
953 JGI25154J39366_1003035
954 JGI25157J39369_1000001
955 JGI25157J39369_1000015
956 JGI25150J39212_1003709
957 JGI25159J45721_1001031
958 JGI25159J45721_1003729
959 JGI25151J46595_10007117
960 JGI25160J50197_1000301
961 JGI25161J50226_1000043
962 JGI25161J50226_1004540
963 Ga0055538_1002482
964 Ga0055538_1002934
965 Ga0055539_1000075
966 Ga0055539_1000170
967 Ga0055539_1001228
968 Ga0055533_1000010
969 Ga0055533_1001222
970 Ga0055533_1002231
971 Ga0055533_1002410
972 Ga0055532_1000056
973 Ga0055525_1000363
974 Ga0055525_1001192
975 Ga0055535_1000013
976 Ga0055535_1000263
977 Ga0055542_1000004
978 Ga0055542_1001053
979 Ga0055529_1000074
980 Ga0055529_1000303
981 Ga0055526_1004895
982 Ga0055537_1000479
983 Ga0055537_1001694
984 Ga0055524_1000130
985 Ga0055536_1004820
986 Ga0055536_1005488
987 Ga0055536_1008676
988 Ga0055534_1001079
989 Ga0055534_1001759
990 Ga0055528_1000145
991 Ga0055528_1003313
992 Ga0055530_10000265
993 Ga0055530_10007868
994 Ga0055530_10013640
995 Ga0055530_10016000
996 Ga0055540_1000079
997 Ga0055540_1004516
998 Ga0055540_1005170
999 Ga0055531_10002186
1000 Ga0055531_10006273
1001 Ga0055541_1000278
1002 Ga0055541_1002512
1003 Ga0055543_1000805
1004 Ga0065714_10004198
1005 Ga0070676_10003870
1006 Ga0070676_10056245
1007 Ga0070683_100003533
1008 Ga0070683_100119340
1009 Ga0070690_100019559
1010 Ga0070690_100067862
1011 Ga0070670_100003950
1012 Ga0070670_100004715
1013 Ga0070670_100014050
1014 Ga0070670_100149804
1015 Ga0068869_100017109
1016 Ga0068869_100058068
1017 Ga0068869_100101671
1018 Ga0070666_10003561
1019 Ga0070666_10062188
1020 Ga0070680_100006104
1021 Ga0068868_100001107
1022 Ga0068868_100002281
1023 Ga0068868_100012489
1024 Ga0068868_100068762
1025 Ga0070660_100008902
1026 Ga0070660_100071336
1027 Ga0070689_100017673
1028 Ga0070661_100000154
1029 Ga0070661_100005559
1030 Ga0070668_100062585
1031 Ga0070669_100038621
1032 Ga0070669_100175811
1033 Ga0070675_100002327
1034 Ga0070675_100055711
1035 Ga0070675_100068410
1036 Ga0070675_100079092
1037 Ga0070675_100217010
1038 Ga0070671_100003169
1039 Ga0070671_100006639
1040 Ga0070674_100012531
1041 Ga0070674_100094518
1042 Ga0070673_100004435
1043 Ga0070673_100007098
1044 Ga0070673_100141301
1045 Ga0070688_100008223
1046 Ga0070688_100011876
1047 Ga0070659_100072608
1048 Ga0070667_100002446
1049 Ga0070667_100045319
1050 Ga0070667_100049466
1051 Ga0070667_100057059
1052 Ga0070713_100000260
1053 Ga0070701_10000785
1054 Ga0070711_100049030
1055 Ga0070700_100005781
1056 Ga0070663_100000002
1057 Ga0070663_100043557
1058 Ga0070678_100002072
1059 Ga0070678_100004119
1060 Ga0070678_100123478
1061 Ga0070662_100162058
1062 Ga0070681_10060581
1063 Ga0068867_100004890
1064 Ga0068867_100008662
1065 Ga0068867_100021092
1066 Ga0068867_100026104
1067 Ga0068867_100084636
1068 Ga0070698_100192809
1069 Ga0070679_100008378
1070 Ga0070684_100047479
1071 Ga0070684_100144926
1072 Ga0068853_100119887
1073 Ga0070672_100001173
1074 Ga0070672_100011477
1075 Ga0070672_100021015
1076 Ga0070672_100109306
1077 Ga0070696_100112285
1078 Ga0070696_100161684
1079 Ga0070693_100001943
1080 Ga0070693_100080148
1081 Ga0070704_100032829
1082 Ga0068855_100008864
1083 Ga0068855_100023596
1084 Ga0068855_100032986
1085 Ga0068855_100211745
1086 Ga0070664_100000004
1087 Ga0070664_100001898
1088 Ga0070664_100021981
1089 Ga0070664_100024552
1090 Ga0070664_100075463
1091 Ga0068857_100011891
1092 Ga0068857_100114094
1093 Ga0068854_100000007
1094 Ga0068854_100019412
1095 Ga0068854_100046118
1096 Ga0068854_100049539
1097 Ga0068856_100000105
1098 Ga0068856_100003075
1099 Ga0068856_100045672
1100 Ga0068856_100062489
1101 Ga0070702_100026225
1102 Ga0068852_100000657
1103 Ga0068852_100001399
1104 Ga0068852_100046435
1105 Ga0068852_100071851
1106 Ga0068852_100086172
1107 Ga0068852_100220107
1108 Ga0068859_100040590
1109 Ga0068859_100103867
1110 Ga0068859_100215420
1111 Ga0068864_100002769
1112 Ga0068864_100014646
1113 Ga0068861_100009167
1114 Ga0068851_10002400
1115 Ga0068851_10004032
1116 Ga0068851_10013011
1117 Ga0068851_10014932
1118 Ga0068863_100038522
1119 Ga0068863_100082128
1120 Ga0068863_100091842
1121 Ga0068858_100002093
1122 Ga0068858_100002948
1123 Ga0068858_100006154
1124 Ga0068858_100024262
1125 Ga0068860_100147079
1126 Ga0081455_10072235
1127 Ga0081540_1025348
1128 Ga0081540_1028320
1129 Ga0075365_10006297
1130 Ga0075363_100008202
1131 Ga0075363_100027756
1132 Ga0075364_10043684
1133 Ga0075432_10008307
1134 Ga0075362_10005224
1135 Ga0075362_10013155
1136 Ga0075362_10024609
1137 Ga0075367_10038654
1138 Ga0075366_10002236
1139 Ga0075366_10015544
1140 Ga0075366_10026976
1141 Ga0075366_10141961
1142 Ga0097621_100003706
1143 Ga0097621_100043803
1144 Ga0075370_10001173
1145 Ga0075370_10003518
1146 Ga0075370_10006457
1147 Ga0075370_10017583
1148 Ga0075370_10038206
1149 Ga0075370_10038706
1150 Ga0075370_10047214
1151 Ga0075370_10067516
1152 Ga0075370_10109081
1153 Ga0068871_100007836
1154 Ga0068871_100010284
1155 Ga0068871_100041229
1156 Ga0068871_100142682
1157 Ga0075428_100007264
1158 Ga0075428_100027967
1159 Ga0075428_100126167
1160 Ga0075431_100017842
1161 Ga0075433_10056526
1162 Ga0075434_100017636
1163 Ga0075434_100108235
1164 Ga0068865_100023267
1165 Ga0068865_100077489
1166 Ga0075436_100002487
1167 Ga0097620_100040590
1168 Ga0097620_100103873
1169 Ga0097620_100215428
1170 Ga0099826_10013779
1171 Ga0075435_100009943
1172 Ga0075435_100106905
1173 Ga0099794_10007301
1174 Ga0105244_10013167
1175 Ga0105240_10008549
1176 Ga0105240_10013136
1177 Ga0105240_10027970
1178 Ga0105240_10047106
1179 Ga0105240_10056972
1180 Ga0105240_10072570
1181 Ga0105240_10278239
1182 Ga0111539_10003794
1183 Ga0111539_10076735
1184 Ga0105245_10015781
1185 Ga0105245_10029552
1186 Ga0114129_10000191
1187 Ga0105243_10001633
1188 Ga0105243_10094247
1189 Ga0105243_10114106
1190 Ga0105243_10175915
1191 Ga0105241_10029165
1192 Ga0105242_10011209
1193 Ga0105242_10014042
1194 Ga0105242_10018794
1195 Ga0105242_10095363
1196 Ga0105248_10035562
1197 Ga0105248_10061334
1198 Ga0105248_10231613
1199 Ga0105237_10011535
1200 Ga0105238_10094296
1201 Ga0105238_10122429
1202 Ga0105249_10286037
1203 Ga0105239_10064425
1204 Ga0105246_10095577
1205 Ga0157326_1001558
1206 Ga0157373_10010719
1207 Ga0157371_10000223
1208 Ga0157371_10027203
1209 Ga0157370_10000074
1210 Ga0157369_10001333
1211 Ga0157369_10002601
1212 Ga0157369_10042171
1213 Ga0157369_10044657
1214 Ga0157369_10124864
1215 Ga0157374_10027309
1216 Ga0157374_10087099
1217 Ga0157374_10106087
1218 Ga0157378_10104692
1219 Ga0163162_10028421
1220 Ga0163162_10057090
1221 Ga0163162_10181338
1222 Ga0157372_10000085
1223 Ga0157372_10003798
1224 Ga0157372_10189877
1225 Ga0157372_10215889
1226 Ga0157375_10017231
1227 Ga0157375_10070595
1228 Ga0157375_10306790
1229 Ga0163163_10008501
1230 Ga0157380_10084084
1231 Ga0182008_10003393
1232 Ga0182008_10005698
1233 Ga0157377_10002089
1234 Ga0157377_10013626
1235 Ga0157379_10034664
1236 Ga0157379_10043161
1237 Ga0157379_10248816
1238 Ga0157376_10122217
1239 Ga0182006_1000867
1240 Ga0182006_1003465
1241 Ga0182007_10006348
1242 Ga0182007_10027387
1243 Ga0183362_10001
1244 Ga0163161_10001379
1245 Ga0163161_10004878
1246 Ga0154015_1416575
1247 Ga0213872_10000029
1248 Ga0213872_10000618
1249 Ga0209435_100001
1250 Ga0209784_100008
1251 Ga0209784_100500
1252 Ga0209784_101272
1253 Ga0209566_100006
1254 Ga0209566_100280
1255 Ga0209566_102291
1256 Ga0209674_100003
1257 Ga0209674_100070
1258 Ga0209674_100741
1259 Ga0209672_100436
1260 Ga0209672_101988
1261 Ga0209672_102654
1262 Ga0209147_100005
1263 Ga0209147_100541
1264 Ga0209563_100010
1265 Ga0209563_100016
1266 Ga0207427_100468
1267 Ga0209258_100007
1268 Ga0209258_100022
1269 Ga0209258_100163
1270 Ga0209258_100903
1271 Ga0207425_1001500
1272 Ga0209646_1000001
1273 Ga0209646_1000016
1274 Ga0209646_1000226
1275 Ga0209026_1000001
1276 Ga0209026_1000021
1277 Ga0209026_1001650
1278 Ga0209677_100008
1279 Ga0209677_100106
1280 Ga0209677_100480
1281 Ga0209148_1000034
1282 Ga0209148_1000051
1283 Ga0209759_1000001
1284 Ga0209759_1000025
1285 Ga0209759_1000684
1286 Ga0209759_1000939
1287 Ga0209759_1001423
1288 Ga0209759_1002409
1289 Ga0209759_1019363
1290 Ga0209129_1000023
1291 Ga0209565_1000096
1292 Ga0209565_1000288
1293 Ga0209455_1000011
1294 Ga0209455_1000059
1295 Ga0209673_1000232
1296 Ga0209673_1000838
1297 Ga0209673_1004143
1298 Ga0209673_1006206
1299 Ga0209130_1000041
1300 Ga0209130_1000113
1301 Ga0209130_1000508
1302 Ga0209130_1001465
1303 Ga0209130_1002443
1304 Ga0209130_1012728
1305 Ga0209675_1000128
1306 Ga0209675_1000276
1307 Ga0209675_1002475
1308 Ga0209675_1002568
1309 Ga0209675_1003811
1310 Ga0209676_1000005
1311 Ga0209676_1000054
1312 Ga0209676_1000418
1313 Ga0209676_1000705
1314 Ga0209676_1003053
1315 Ga0209025_1000531
1316 Ga0209025_1001493
1317 Ga0209025_1003884
1318 Ga0209025_1006696
1319 Ga0209025_1014270
1320 Ga0209025_1016285
1321 Ga0209025_1020721
1322 Ga0209025_1053271
1323 Ga0209564_1000394
1324 Ga0209564_1000912
1325 Ga0209564_1001098
1326 Ga0209564_1009461
1327 Ga0209564_1021392
1328 Ga0209758_1000064
1329 Ga0209758_1004529
1330 Ga0209050_1000007
1331 Ga0209050_1000066
1332 Ga0209050_1000570
1333 Ga0209050_1000690
1334 Ga0209050_1002949
1335 Ga0209050_1016296
1336 Ga0209050_1028547
1337 Ga0209256_1000003
1338 Ga0209256_1000020
1339 Ga0209256_1000577
1340 Ga0209256_1017307
1341 Ga0207426_1000001
1342 Ga0207426_1000031
1343 Ga0207426_1000061
1344 Ga0207426_1020654
1345 Ga0209051_1000009
1346 Ga0209051_1000044
1347 Ga0209051_1000363
1348 Ga0209051_1000385
1349 Ga0209051_1000491
1350 Ga0209051_1001856
1351 Ga0209051_1001872
1352 Ga0209051_1012913
1353 Ga0209257_1000011
1354 Ga0209257_1000032
1355 Ga0209257_1000055
1356 Ga0209257_1000082
1357 Ga0209257_1000502
1358 Ga0209257_1007175
1359 Ga0209257_1017587
1360 Ga0207697_10073410
1361 Ga0207656_10002382
1362 Ga0207656_10002699
1363 Ga0207655_1001588
1364 Ga0207688_10031734
1365 Ga0207688_10079934
1366 Ga0207680_10002745
1367 Ga0207645_10045934
1368 Ga0207705_10022746
1369 Ga0207705_10066011
1370 Ga0207695_10001193
1371 Ga0207695_10021707
1372 Ga0207695_10053129
1373 Ga0207695_10057592
1374 Ga0207695_10111600
1375 Ga0207695_10119697
1376 Ga0207671_10111753
1377 Ga0207663_10076611
1378 Ga0207657_10078012
1379 Ga0207657_10158475
1380 Ga0207649_10000573
1381 Ga0207649_10002026
1382 Ga0207649_10016787
1383 Ga0207694_10018078
1384 Ga0207650_10001127
1385 Ga0207650_10008883
1386 Ga0207650_10056820
1387 Ga0207650_10124999
1388 Ga0207659_10000725
1389 Ga0207659_10005217
1390 Ga0207659_10007325
1391 Ga0207659_10023175
1392 Ga0207659_10029587
1393 Ga0207687_10041114
1394 Ga0207700_10000189
1395 Ga0207644_10003511
1396 Ga0207644_10008443
1397 Ga0207644_10034969
1398 Ga0207644_10047418
1399 Ga0207644_10068715
1400 Ga0207690_10016369
1401 Ga0207690_10067507
1402 Ga0207690_10073921
1403 Ga0207706_10025633
1404 Ga0207706_10128246
1405 Ga0207686_10013089
1406 Ga0207686_10063141
1407 Ga0207686_10063988
1408 Ga0207709_10001604
1409 Ga0207709_10021990
1410 Ga0207670_10019227
1411 Ga0207670_10029754
1412 Ga0207669_10007934
1413 Ga0207691_10001444
1414 Ga0207691_10002459
1415 Ga0207691_10009240
1416 Ga0207691_10010513
1417 Ga0207691_10093396
1418 Ga0207711_10008783
1419 Ga0207711_10011843
1420 Ga0207711_10129756
1421 Ga0207689_10015681
1422 Ga0207689_10097636
1423 Ga0207661_10007156
1424 Ga0207661_10092462
1425 Ga0207679_10000002
1426 Ga0207679_10001704
1427 Ga0207679_10007132
1428 Ga0207667_10004568
1429 Ga0207667_10009460
1430 Ga0207667_10061375
1431 Ga0207651_10002950
1432 Ga0207651_10004833
1433 Ga0207640_10017885
1434 Ga0207640_10018533
1435 Ga0207640_10027293
1436 Ga0207640_10086378
1437 Ga0207658_10025926
1438 Ga0207658_10052793
1439 Ga0207677_10003064
1440 Ga0207677_10008356
1441 Ga0207677_10026784
1442 Ga0207677_10030189
1443 Ga0207703_10001773
1444 Ga0207703_10012670
1445 Ga0207678_10000003
1446 Ga0207708_10067958
1447 Ga0207702_10000010
1448 Ga0207702_10000522
1449 Ga0207702_10036919
1450 Ga0207702_10099499
1451 Ga0207702_10107674
1452 Ga0207702_10118365
1453 Ga0207641_10019102
1454 Ga0207641_10036585
1455 Ga0207641_10162307
1456 Ga0207641_10190351
1457 Ga0207641_10222677
1458 Ga0207648_10019713
1459 Ga0207648_10024255
1460 Ga0207648_10067748
1461 Ga0207648_10075838
1462 Ga0207648_10160568
1463 Ga0207676_10001271
1464 Ga0207676_10012287
1465 Ga0207676_10020956
1466 Ga0207676_10035333
1467 Ga0207674_10023464
1468 Ga0207674_10079210
1469 Ga0207674_10107212
1470 Ga0207674_10232195
1471 Ga0207675_100018746
1472 Ga0207675_100065898
1473 Ga0207675_100079404
1474 Ga0207675_100193442
1475 Ga0207675_100267998
1476 Ga0207683_10000838
1477 Ga0207683_10005156
1478 Ga0207683_10006290
1479 Ga0207683_10015911
1480 Ga0207683_10037520
1481 Ga0207683_10039060
1482 Ga0207683_10089575
1483 Ga0207683_10129250
1484 Ga0207698_10001250
1485 Ga0207698_10009072
1486 Ga0207698_10019512
1487 Ga0207698_10052932
1488 Ga0207698_10195860
1489 Ga0207428_10001012
1490 Ga0207428_10012148
1491 Ga0268264_10137133
1492 Ga0265337_1032774
1493 Ga0265323_10003116
1494 Ga0265323_10008205
1495 Ga0265336_10000051
1496 Ga0307515_10000028
1497 Ga0307515_10000458
1498 Ga0307515_10016545
1499 Ga0307515_10048179
1500 Ga0307515_10056923
1501 Ga0307512_10055475
1502 Ga0265325_10001972
1503 Ga0265340_10000047
1504 Ga0265331_10002871
1505 Ga0265331_10031690
1506 Ga0307513_10000021
1507 Ga0307509_10000120
1508 Ga0307509_10013526
1509 Ga0307509_10060091
1510 Ga0307509_10069501
1511 Ga0307408_100000046
1512 Ga0307408_100003007
1513 Ga0307408_100047082
1514 Ga0307408_100079883
1515 Ga0307508_10000163
1516 Ga0307508_10019292
1517 Ga0307508_10023931
1518 Ga0307514_10000828
1519 Ga0307514_10046625
1520 Ga0265314_10000007
1521 Ga0265342_10001861
1522 Ga0316576_10003935
1523 Ga0307516_10018571
1524 Ga0307516_10022115
1525 Ga0307405_10049640
1526 Ga0307413_10016958
1527 Ga0307410_10056048
1528 Ga0307406_10002339
1529 Ga0307406_10008992
1530 Ga0307406_10105266
1531 Ga0307412_10000135
1532 Ga0307412_10015988
1533 Ga0307409_100010337
1534 Ga0307416_100003363
1535 Ga0307416_100017961
1536 Ga0307416_100099633
1537 Ga0307411_10011035
1538 Ga0307411_10019119
1539 Ga0307411_10040848
1540 Ga0307415_100016744
1541 Ga0307415_100023469
1542 Ga0307510_10002394
1543 Ga0307510_10018033
1544 Ga0373926_0037748
1545 Ga0373949_0004987
1546 Ga0373923_0048720
1547 Ga0373923_0067250
1548 Ga0373939_0000139
1549 Ga0373941_0013544
1550 Ga0373945_0012903
1551 Ga0373956_0000193
1552 Ga0373931_0000908
1553 Ga0373931_0004912
1554 Ga0373927_0005732
1555 Ga0373933_0000364
1556 Ga0373937_0000182
1557 Ga0373925_0045523
1558 Ga0395899_0012470
1559 Ga0395900_0003483
1560 Ga0395898_0006685
1561 Ga0395898_0010478
1562 Ga0395905_0002802
1563 Ga0395905_0018172
1564 Ga0395905_0024518
1565 Ga0395905_0029244
1566 Ga0395905_0113031
1567 Ga0395901_0015357
1568 Ga0395901_0015454
1569 Ga0395901_0022158
1570 Ga0436361_0034352
1571 Ga0436361_0625540
1572 Ga0436363_0667407
1573 Ga0439436_0007418
1574 Ga0439436_0020373
1575 Ga0451807_0675626
1576 Ga0439445_0008291
1577 Ga0439449_0008125
1578 Ga0439449_0012578
1579 Ga0439457_009413
1580 Ga0450890_000536
1581 Ga0450891_000192
1582 Ga0439446_0019780
1583 Ga0450893_0000214
1584 Ga0451577_0000742
1585 Ga0451577_0043187
1586 Ga0451577_0085905
1587 Ga0451577_0133455
1588 Ga0466969_0000001
1589 Ga0466969_0004528
1590 Ga0466969_0016894
1591 Ga0466972_0055407
1592 Ga0466965_0004669
1593 Ga0466966_0005235
1594 Ga0466966_0006418
1595 Ga0466961_0011024
1596 Ga0466963_0008073
1597 Ga0466964_0003328
1598 Ga0466964_0004632
1599 Ga0466964_0028165
1600 Ga0453684_0000065
1601 Ga0453684_0009901
1602 Ga0466971_0004295
1603 Ga0466970_0004172
1604 Ga0466957_0014724
1605 Ga0466957_0062297
1606 Ga0466959_0000063
1607 Ga0466959_0006014
1608 Ga0466959_0026775
1609 Ga0451576_0013881
1610 Ga0451576_0044822
1611 Ga0451576_0136973
1612 Ga0466958_0004695
1613 Ga0466958_0017953
1614 Ga0466958_0018095
1615 Ga0495617_012554
1616 Ga0495617_038624
1617 Ga0495592_0002422
1618 Ga0495590_0010273
1619 Ga0495629_0011897
1620 Ga0495638_0002153
1621 Ga0495638_0061966
1622 Ga0495651_0000027
1623 Ga0495580_0021078
1624 Ga0495580_0028185
1625 Ga0495582_0011400
1626 Ga0495605_0001486
1627 Ga0495639_0004066
1628 Ga0495584_0000621
1629 Ga0495585_0007084
1630 Ga0495585_0056295
1631 Ga0495585_0059195
1632 Ga0495594_0002498
1633 Ga0495583_0000016
1634 Ga0495606_0002620
1635 Ga0495616_0004257
1636 Ga0495616_0005761
1637 Ga0495616_0027002
1638 Ga0495628_0005560
1639 Ga0495628_0094618
1640 Ga0495637_0045719
1641 Ga0495637_0050812
1642 Ga0495643_0003120
1643 Ga0495648_0000593
1644 Ga0495666_0064639
1645 Ga0495652_0036854
1646 Ga0495652_0071658
1647 Ga0495665_0003964
1648 Ga0495586_0090949
1649 Ga0495587_0006273
1650 Ga0495597_0004154
1651 Ga0495597_0015616
1652 Ga0495645_0002395
1653 Ga0495622_0005439
1654 Ga0495633_0002301
1655 Ga0495633_0015720
1656 Ga0495656_0000110
1657 Ga0495668_0044647
1658 Ga0495634_0019399
1659 Ga0495611_0008728
1660 Ga0495625_0002383
1661 Ga0495625_0010249
1662 Ga0495625_0080003
1663 Ga0495635_0030188
1664 Ga0495659_0007216
1665 Ga0495661_0002005
1666 Ga0495599_0000531
1667 Ga0495599_0022849
1668 Ga0495599_0140589
1669 Ga0495623_0016524
1670 Ga0495647_0011450
1671 Ga0495658_0001699
1672 Ga0495669_0025706
1673 Ga0495670_0002770
1674 Ga0495670_0005224
1675 Ga0495671_0080841
1676 Ga0495671_0111269
1677 Ga0495581_0008234
1678 Ga0495636_0000920
1679 Ga0495672_0012407
1680 Ga0495676_0012265
1681 Ga0495676_0016453
1682 Ga0495683_0006098
1683 Ga0495687_000138
1684 Ga0495687_006782
1685 Ga0495687_025727
1686 Ga0495677_0003212
1687 Ga0495685_000219
1688 Ga0495673_0000060
1689 Ga0495684_0038078
1690 Ga0495686_0006352
1691 Ga0495593_0000759
1692 Ga0495593_0011141
1693 Ga0496100_0018668
1694 Ga0496101_0061878
1695 Ga0496101_0232980
1696 Ga0496102_0071667
1697 Ga0496102_0072781
1698 Ga0496104_0040730
1699 Ga0496105_0062478
1700 Ga0496106_0023204
1701 Ga0496107_0137097
1702 Ga0496108_0040990
1703 Ga0496108_0087964
1704 Ga0496109_0024792
1705 Ga0496109_0027408
1706 Ga0496110_0004858
1707 Ga0496110_0009425
1708 Ga0496111_0032942
1709 Ga0496111_0053081
1710 Ga0496111_0086850
1711 Ga0496112_0050038
1712 Ga0496113_0146119
1713 Ga0496115_0027971
1714 Ga0496115_0066235
1715 Ga0496116_0010521
1716 Ga0496117_0025555
1717 Ga0496119_0035106
1718 Ga0496121_0000314
1719 Ga0496121_0072459
1720 Ga0496122_0000046
1721 Ga0496122_0000217
1722 Ga0496123_0000082
1723 Ga0496123_0001126
1724 Ga0496123_0022919
1725 Ga0496124_0000038
1726 Ga0496124_0057503
1727 Ga0496125_0000028
1728 Ga0496125_0000532
1729 Ga0496125_0079036
1730 Ga0495682_0002647
1731 Ga0501034_0006242
1732 Ga0501041_0172858
1733 Ga0501042_0143664
1734 Ga0501043_0156886
1735 Ga0501047_0023913
1736 Ga0501068_0067902
1737 Ga0501069_0001500
1738 Ga0501070_0003950
1739 Ga0501072_0110293
1740 Ga0501073_0000374
1741 Ga0501073_0009188
1742 Ga0501073_0019817
1743 Ga0501074_0000125
1744 Ga0501076_0025005
1745 Ga0501198_000005
1746 Ga0501222_000003
1747 Ga0501079_0013497
1748 Ga0501080_0001248
1749 Ga0501080_0007975
1750 Ga0501080_0039560
1751 Ga0501083_0007469
1752 Ga0501266_001164
1753 Ga0501035_0067904
1754 Ga0501035_0095951
1755 nmdc:mga03683_20354_c1
1756 nmdc:mga03683_22410_c1
1757 nmdc:mga00v17_10232_c1
1758 nmdc:mga00v17_48905_c1
1759 nmdc:mga0k408_1565_c1
1760 nmdc:mga0k408_26727_c1
1761 nmdc:mga0k408_4867_c1
1762 nmdc:mga0k408_6461_c1
1763 nmdc:mga0k408_6553_c1
1764 nmdc:mga0k408_76088_c1
1765 nmdc:mga06z11_50874_c1
1766 nmdc:mga07m45_18826_c1
1767 nmdc:mga07m45_19735_c1
1768 nmdc:mga07m45_202_c1
1769 nmdc:mga07m45_21064_c1
1770 nmdc:mga07m45_2832_c1
1771 nmdc:mga07m45_43302_c1
1772 nmdc:mga07m45_61657_c1
1773 nmdc:mga07m45_716_c1
1774 nmdc:mga07m45_8065_c1
1775 nmdc:mga05p37_109213_c1
1776 nmdc:mga0qj67_172497_c1
1777 nmdc:mga0qj67_61514_c1
1778 nmdc:mga06r32_704_c1
1779 nmdc:mga08y16_59229_c1
1780 nmdc:mga08y16_7529_c1
1781 nmdc:mga0n895_13563_c1
1782 nmdc:mga0rr50_11608_c1
1783 nmdc:mga0rr50_119039_c1
1784 nmdc:mga0rr50_33844_c1
1785 nmdc:mga0rr50_7922_c1
1786 nmdc:mga08x19_118322_c1
1787 nmdc:mga08x19_9403_c1
1788 nmdc:mga0a205_95540_c1
1789 Ga0495601_0000822
1790 Ga0500610_0000344
1791 Ga0500610_0020666
1792 Ga0500635_0000145
1793 Ga0500651_0000353
1794 Ga0500566_0000008
1795 Ga0500562_004134
1796 Ga0500569_000840
1797 Ga0500572_001770
1798 Ga0500614_003737
1799 Ga0500652_035527
1800 Ga0500559_0000011
1801 Ga0500568_0005309
1802 Ga0500600_0030483
1803 Ga0500603_000040
1804 Ga0500639_000010
1805 Ga0500636_0034879
1806 Ga0500637_0024809
1807 Ga0500645_000274
1808 Ga0500645_003458
1809 Ga0587072_001478
1810 Ga0466962_0008617
1811 2511245553
1812 2513227406
1813 2513874577
1814 2513894527
1815 2524610238
1816 2548498292
1817 2548849106
1818 2599446114
1819 2599624514
1820 2599672624
1821 2599683624
1822 2599694233
1823 2643745913
1824 2643789322
1825 2643862684
1826 2643980310
1827 2644062964
1828 2644070647
1829 2644121910
1830 2644163167
1831 2644220868
1832 2644259689
1833 2644287379
1834 2644304754
1835 2644328078
1836 2644338114
1837 2644398613
1838 2644648826
1839 2738720186
1840 2738881730
1841 2739057284
1842 2739243723
1843 2739279385
1844 2774870257
1845 2805916573
1846 2809032376
1847 2816472553
1848 2819595927
1849 2831266924
1850 2838056983
1851 2842678798
1852 2842720292
1853 2842735547
1854 2842751360
1855 2857542486
1856 2857544781
1857 2884299549
1858 2885192848
1859 2885199021
1860 2885212716
1861 2885266755
1862 2899925275
1863 2904456432
1864 2904460705
1865 2904480318
1866 2904548380
1867 2919464427
1868 2919480809
1869 2928038602
1870 2928045793
1871 2928053410
1872 2928067015
1873 2928071086
1874 2928084972
1875 2928119752
1876 2929163773
1877 2929524915
1878 2945912432
1879 2945948342
1880 2945977017
1881 2945985250
1882 2954771993
1883 2974322718
1884 8006930500

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10415

FumaraseC_C

Fumarase C C-terminus

364

417

0.98

PF00206

Lyase_1

Lyase

13

298

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tv2-assembly1.cif.gz_A structure of a class ii fumarate hydratase from burkholderia pseudomallei 0.9808 4 460
6os7-assembly1.cif.gz_A-2 e. coli fumarase mutant - r126a 0.9807 2 460
6nz9-assembly1.cif.gz_B crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9806 2 460
6nz9-assembly1.cif.gz_A-2 crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9803 2 460
6nzc-assembly1.cif.gz_B-2 crystal structure of e. coli fumarase c n326a variant with closed ss loop at 1.40 angstrom resolution 0.98 2 460
ID Description Score Start End Superfamily
1fuoB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.006 408 456 1.10.40.30
3tv2A03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.003 408 460 1.10.40.30
5uppB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.001 408 458 1.10.40.30
3e04D03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.001 408 458 1.10.40.30
5uppA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1 408 458 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A447KZK2-F1-model_v4 fumarate hydratase (EC 4.2.1.2) 0.9948 3 224 GO:0004333
GO:0006099
GO:0006106
GO:0006108
AF-A0A383EM57-F1-model_v4 Fumarate lyase N-terminal domain-containing protein 0.9899 4 112 GO:0005829
GO:0006531
GO:0008797
AF-A0A828RS23-F1-model_v4 deleted 0.9859 1 207
AF-A0A128FKB9-F1-model_v4 Fumarate hydratase class II (EC 4.2.1.2) 0.985 3 164 GO:0004333
GO:0006106
AF-A0A0U1SEZ2-F1-model_v4 fumarate hydratase (EC 4.2.1.2) 0.9836 3 212 GO:0004333
GO:0005739
GO:0006099
GO:0006106
GO:0006108

Map