F486362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 492 | 1884 | 465 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10246668|Ga0207648_102466682 |
| Length | 424 |
| Sequence | MAGQYRTEKDTFGPIEVPAGRLWGAQTQRSLEHFRISGERMPAELVRALVEKADAIVAAADEVLAGRWPDEFPLVVWQTGSGTQTNMNANEVLANRASELLGGARGEGRLVHPNDDVNRSQSSNDIFPTAMNVAAVVAMRERVLPALARLRDTLRAKAEASADVVKIGRTHLQDATPLTLGHEISGYVAQLAHELAAGGTAVGTGLNAPVEFGARVAAELASRLGHPFVTAPNKFEALAAHDALTKIANDVRLLSSGPRSGLAEITIPENEPGSSIMPGKVNPTQCEALTMCACQVMGNDAAVNIGGSQGHFELNVFKPVIAHGFLQSVRLLGDGMQSFEEHCVRGIEPNRERIDELVGRSLMLVTALAPKIGYDKSAAIAKKAHKEGTTLREAALALRYVTAAEYDEWVRAEDMVGNSSRKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 268 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 269 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 270 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 405 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 406 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 407 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 408 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 409 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 412 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 414 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 416 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 417 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 420 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 421 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 422 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 423 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 424 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 425 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 426 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 427 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 428 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 429 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 430 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 431 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 432 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 433 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 434 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 435 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 436 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 437 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 438 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 439 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 440 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 441 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 442 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 443 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 444 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 445 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 446 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 447 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 448 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 449 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 450 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 451 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 452 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 453 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 454 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 455 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 456 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 457 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 458 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 459 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 460 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 461 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 462 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 463 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 464 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 465 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 466 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 467 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 468 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 469 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 470 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 471 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 472 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 473 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 474 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 475 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 476 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 477 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 478 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 479 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 480 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 481 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 482 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 483 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 484 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 485 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 486 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 487 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 488 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 489 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 490 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 491 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 492 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.93 |
| Metatranscriptomes | 0.21 |
| Isolates | 7.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.87 |
| Nodule | 0.64 |
| Rhizoplane | 2.87 |
| Rhizosphere | 63.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207648_10246668 | 3300026089 | Bacteria | 1592 |
| 2 | JGI24741J21665_1000804 | 3300001915 | Bacteria | 9427 |
| 3 | JGI24740J21852_10000278 | 3300001979 | Bacteria | 21674 |
| 4 | JGI24740J21852_10001064 | 3300001979 | Bacteria | 12359 |
| 5 | JGI25155J39150_1000008 | 3300002704 | Bacteria | 236146 |
| 6 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 7 | JGI25156J39149_1012444 | 3300002705 | Bacteria | 1869 |
| 8 | JGI25156J39149_1012868 | 3300002705 | Bacteria | 1811 |
| 9 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 10 | JGI25154J39366_1000110 | 3300002738 | Bacteria | 71731 |
| 11 | JGI25154J39366_1003035 | 3300002738 | Bacteria | 3810 |
| 12 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 13 | JGI25157J39369_1000015 | 3300002741 | Bacteria | 194042 |
| 14 | JGI25150J39212_1003709 | 3300002774 | Bacteria | 3529 |
| 15 | JGI25159J45721_1001031 | 3300002987 | Bacteria | 11936 |
| 16 | JGI25159J45721_1003729 | 3300002987 | Bacteria | 5278 |
| 17 | JGI25151J46595_10007117 | 3300003187 | Bacteria | 5518 |
| 18 | JGI25160J50197_1000301 | 3300003354 | Bacteria | 34898 |
| 19 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 20 | JGI25161J50226_1004540 | 3300003374 | Bacteria | 2889 |
| 21 | Ga0055538_1002482 | 3300003751 | Bacteria | 2685 |
| 22 | Ga0055538_1002934 | 3300003751 | Bacteria | 2309 |
| 23 | Ga0055539_1000075 | 3300003752 | Bacteria | 130079 |
| 24 | Ga0055539_1000170 | 3300003752 | Bacteria | 57928 |
| 25 | Ga0055539_1001228 | 3300003752 | Bacteria | 5157 |
| 26 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 27 | Ga0055533_1001222 | 3300003756 | Bacteria | 7141 |
| 28 | Ga0055533_1002231 | 3300003756 | Bacteria | 4552 |
| 29 | Ga0055533_1002410 | 3300003756 | Bacteria | 4260 |
| 30 | Ga0055532_1000056 | 3300003758 | Bacteria | 158878 |
| 31 | Ga0055525_1000363 | 3300003759 | Bacteria | 30516 |
| 32 | Ga0055525_1001192 | 3300003759 | Bacteria | 5838 |
| 33 | Ga0055535_1000013 | 3300003761 | Bacteria | 299614 |
| 34 | Ga0055535_1000263 | 3300003761 | Bacteria | 55363 |
| 35 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 36 | Ga0055542_1001053 | 3300003762 | Bacteria | 17140 |
| 37 | Ga0055529_1000074 | 3300003763 | Bacteria | 158872 |
| 38 | Ga0055529_1000303 | 3300003763 | Bacteria | 56663 |
| 39 | Ga0055526_1004895 | 3300003771 | Bacteria | 7886 |
| 40 | Ga0055537_1000479 | 3300003773 | Bacteria | 25018 |
| 41 | Ga0055537_1001694 | 3300003773 | Bacteria | 8165 |
| 42 | Ga0055524_1000130 | 3300003775 | Bacteria | 88754 |
| 43 | Ga0055536_1004820 | 3300003781 | Bacteria | 6750 |
| 44 | Ga0055536_1005488 | 3300003781 | Bacteria | 6186 |
| 45 | Ga0055536_1008676 | 3300003781 | Bacteria | 4323 |
| 46 | Ga0055534_1001079 | 3300003784 | Bacteria | 11696 |
| 47 | Ga0055534_1001759 | 3300003784 | Bacteria | 8165 |
| 48 | Ga0055528_1000145 | 3300003790 | Bacteria | 58081 |
| 49 | Ga0055528_1003313 | 3300003790 | Bacteria | 8165 |
| 50 | Ga0055530_10000265 | 3300003791 | Bacteria | 47389 |
| 51 | Ga0055530_10007868 | 3300003791 | Bacteria | 4389 |
| 52 | Ga0055530_10013640 | 3300003791 | Bacteria | 2759 |
| 53 | Ga0055530_10016000 | 3300003791 | Bacteria | 2418 |
| 54 | Ga0055540_1000079 | 3300003792 | Bacteria | 112817 |
| 55 | Ga0055540_1004516 | 3300003792 | Bacteria | 6231 |
| 56 | Ga0055540_1005170 | 3300003792 | Bacteria | 5603 |
| 57 | Ga0055531_10002186 | 3300003794 | Bacteria | 13339 |
| 58 | Ga0055531_10006273 | 3300003794 | Bacteria | 6777 |
| 59 | Ga0055541_1000278 | 3300003841 | Bacteria | 17679 |
| 60 | Ga0055541_1002512 | 3300003841 | Bacteria | 3644 |
| 61 | Ga0055543_1000805 | 3300004625 | Bacteria | 15454 |
| 62 | Ga0065714_10004198 | 3300005288 | Bacteria | 5443 |
| 63 | Ga0070676_10003870 | 3300005328 | Bacteria | 7863 |
| 64 | Ga0070676_10056245 | 3300005328 | Bacteria | 2324 |
| 65 | Ga0070683_100003533 | 3300005329 | Bacteria | 12724 |
| 66 | Ga0070683_100119340 | 3300005329 | Bacteria | 2491 |
| 67 | Ga0070690_100019559 | 3300005330 | Bacteria | 4113 |
| 68 | Ga0070690_100067862 | 3300005330 | Bacteria | 2312 |
| 69 | Ga0070670_100003950 | 3300005331 | Bacteria | 12373 |
| 70 | Ga0070670_100004715 | 3300005331 | Bacteria | 11440 |
| 71 | Ga0070670_100014050 | 3300005331 | Bacteria | 6868 |
| 72 | Ga0070670_100149804 | 3300005331 | Bacteria | 2019 |
| 73 | Ga0068869_100017109 | 3300005334 | Bacteria | 4907 |
| 74 | Ga0068869_100058068 | 3300005334 | Bacteria | 2828 |
| 75 | Ga0068869_100101671 | 3300005334 | Bacteria | 2175 |
| 76 | Ga0070666_10003561 | 3300005335 | Bacteria | 9442 |
| 77 | Ga0070666_10062188 | 3300005335 | Bacteria | 2529 |
| 78 | Ga0070680_100006104 | 3300005336 | Bacteria | 9131 |
| 79 | Ga0068868_100001107 | 3300005338 | Bacteria | 18443 |
| 80 | Ga0068868_100002281 | 3300005338 | Bacteria | 13257 |
| 81 | Ga0068868_100012489 | 3300005338 | Bacteria | 6211 |
| 82 | Ga0068868_100068762 | 3300005338 | Bacteria | 2821 |
| 83 | Ga0070660_100008902 | 3300005339 | Bacteria | 7037 |
| 84 | Ga0070660_100071336 | 3300005339 | Bacteria | 2712 |
| 85 | Ga0070689_100017673 | 3300005340 | Bacteria | 5244 |
| 86 | Ga0070661_100000154 | 3300005344 | Bacteria | 56626 |
| 87 | Ga0070661_100005559 | 3300005344 | Bacteria | 8688 |
| 88 | Ga0070668_100062585 | 3300005347 | Bacteria | 2883 |
| 89 | Ga0070669_100038621 | 3300005353 | Bacteria | 3466 |
| 90 | Ga0070669_100175811 | 3300005353 | Bacteria | 1672 |
| 91 | Ga0070675_100002327 | 3300005354 | Bacteria | 14133 |
| 92 | Ga0070675_100055711 | 3300005354 | Bacteria | 3255 |
| 93 | Ga0070675_100068410 | 3300005354 | Bacteria | 2940 |
| 94 | Ga0070675_100079092 | 3300005354 | Bacteria | 2739 |
| 95 | Ga0070675_100217010 | 3300005354 | Bacteria | 1664 |
| 96 | Ga0070671_100003169 | 3300005355 | Bacteria | 12826 |
| 97 | Ga0070671_100006639 | 3300005355 | Bacteria | 9248 |
| 98 | Ga0070674_100012531 | 3300005356 | Bacteria | 5209 |
| 99 | Ga0070674_100094518 | 3300005356 | Bacteria | 2165 |
| 100 | Ga0070673_100004435 | 3300005364 | Bacteria | 8881 |
| 101 | Ga0070673_100007098 | 3300005364 | Bacteria | 7356 |
| 102 | Ga0070673_100141301 | 3300005364 | Bacteria | 2031 |
| 103 | Ga0070688_100008223 | 3300005365 | Bacteria | 5654 |
| 104 | Ga0070688_100011876 | 3300005365 | Bacteria | 4860 |
| 105 | Ga0070659_100072608 | 3300005366 | Bacteria | 2738 |
| 106 | Ga0070667_100002446 | 3300005367 | Bacteria | 16231 |
| 107 | Ga0070667_100045319 | 3300005367 | Bacteria | 3697 |
| 108 | Ga0070667_100049466 | 3300005367 | Bacteria | 3541 |
| 109 | Ga0070667_100057059 | 3300005367 | Bacteria | 3299 |
| 110 | Ga0070713_100000260 | 3300005436 | Bacteria | 34743 |
| 111 | Ga0070701_10000785 | 3300005438 | Bacteria | 11356 |
| 112 | Ga0070711_100049030 | 3300005439 | Bacteria | 2891 |
| 113 | Ga0070700_100005781 | 3300005441 | Bacteria | 6564 |
| 114 | Ga0070663_100000002 | 3300005455 | Bacteria | 298075 |
| 115 | Ga0070663_100043557 | 3300005455 | Bacteria | 3159 |
| 116 | Ga0070678_100002072 | 3300005456 | Bacteria | 10877 |
| 117 | Ga0070678_100004119 | 3300005456 | Bacteria | 8191 |
| 118 | Ga0070678_100123478 | 3300005456 | Bacteria | 2046 |
| 119 | Ga0070662_100162058 | 3300005457 | Bacteria | 1750 |
| 120 | Ga0070681_10060581 | 3300005458 | Bacteria | 3761 |
| 121 | Ga0068867_100004890 | 3300005459 | Bacteria | 9431 |
| 122 | Ga0068867_100008662 | 3300005459 | Bacteria | 7183 |
| 123 | Ga0068867_100021092 | 3300005459 | Bacteria | 4646 |
| 124 | Ga0068867_100026104 | 3300005459 | Bacteria | 4193 |
| 125 | Ga0068867_100084636 | 3300005459 | Bacteria | 2396 |
| 126 | Ga0070698_100192809 | 3300005471 | Bacteria | 1975 |
| 127 | Ga0070679_100008378 | 3300005530 | Bacteria | 9727 |
| 128 | Ga0070684_100047479 | 3300005535 | Bacteria | 3721 |
| 129 | Ga0070684_100144926 | 3300005535 | Bacteria | 2149 |
| 130 | Ga0068853_100119887 | 3300005539 | Bacteria | 2345 |
| 131 | Ga0070672_100001173 | 3300005543 | Bacteria | 16022 |
| 132 | Ga0070672_100011477 | 3300005543 | Bacteria | 6179 |
| 133 | Ga0070672_100021015 | 3300005543 | Bacteria | 4772 |
| 134 | Ga0070672_100109306 | 3300005543 | Bacteria | 2252 |
| 135 | Ga0070696_100112285 | 3300005546 | Bacteria | 1964 |
| 136 | Ga0070696_100161684 | 3300005546 | Bacteria | 1650 |
| 137 | Ga0070693_100001943 | 3300005547 | Bacteria | 9464 |
| 138 | Ga0070693_100080148 | 3300005547 | Bacteria | 1944 |
| 139 | Ga0070704_100032829 | 3300005549 | Bacteria | 3505 |
| 140 | Ga0068855_100008864 | 3300005563 | Bacteria | 12158 |
| 141 | Ga0068855_100023596 | 3300005563 | Bacteria | 7367 |
| 142 | Ga0068855_100032986 | 3300005563 | Bacteria | 6182 |
| 143 | Ga0068855_100211745 | 3300005563 | Bacteria | 2177 |
| 144 | Ga0070664_100000004 | 3300005564 | Bacteria | 298075 |
| 145 | Ga0070664_100001898 | 3300005564 | Bacteria | 16789 |
| 146 | Ga0070664_100021981 | 3300005564 | Bacteria | 5260 |
| 147 | Ga0070664_100024552 | 3300005564 | Bacteria | 4987 |
| 148 | Ga0070664_100075463 | 3300005564 | Bacteria | 2895 |
| 149 | Ga0068857_100011891 | 3300005577 | Bacteria | 7571 |
| 150 | Ga0068857_100114094 | 3300005577 | Bacteria | 2430 |
| 151 | Ga0068854_100000007 | 3300005578 | Bacteria | 182830 |
| 152 | Ga0068854_100019412 | 3300005578 | Bacteria | 4580 |
| 153 | Ga0068854_100046118 | 3300005578 | Bacteria | 3102 |
| 154 | Ga0068854_100049539 | 3300005578 | Bacteria | 3001 |
| 155 | Ga0068856_100000105 | 3300005614 | Bacteria | 81780 |
| 156 | Ga0068856_100003075 | 3300005614 | Bacteria | 17033 |
| 157 | Ga0068856_100045672 | 3300005614 | Bacteria | 4314 |
| 158 | Ga0068856_100062489 | 3300005614 | Bacteria | 3679 |
| 159 | Ga0070702_100026225 | 3300005615 | Bacteria | 3129 |
| 160 | Ga0068852_100000657 | 3300005616 | Bacteria | 22644 |
| 161 | Ga0068852_100001399 | 3300005616 | Bacteria | 16231 |
| 162 | Ga0068852_100046435 | 3300005616 | Bacteria | 3701 |
| 163 | Ga0068852_100071851 | 3300005616 | Bacteria | 3040 |
| 164 | Ga0068852_100086172 | 3300005616 | Bacteria | 2799 |
| 165 | Ga0068852_100220107 | 3300005616 | Bacteria | 1805 |
| 166 | Ga0068859_100040590 | 3300005617 | Bacteria | 4671 |
| 167 | Ga0068859_100103867 | 3300005617 | Bacteria | 2900 |
| 168 | Ga0068859_100215420 | 3300005617 | Bacteria | 2008 |
| 169 | Ga0068864_100002769 | 3300005618 | Bacteria | 14470 |
| 170 | Ga0068864_100014646 | 3300005618 | Bacteria | 6514 |
| 171 | Ga0068861_100009167 | 3300005719 | Bacteria | 6824 |
| 172 | Ga0068851_10002400 | 3300005834 | Bacteria | 8222 |
| 173 | Ga0068851_10004032 | 3300005834 | Bacteria | 6591 |
| 174 | Ga0068851_10013011 | 3300005834 | Bacteria | 3933 |
| 175 | Ga0068851_10014932 | 3300005834 | Bacteria | 3694 |
| 176 | Ga0068863_100038522 | 3300005841 | Bacteria | 4548 |
| 177 | Ga0068863_100082128 | 3300005841 | Bacteria | 3053 |
| 178 | Ga0068863_100091842 | 3300005841 | Bacteria | 2879 |
| 179 | Ga0068858_100002093 | 3300005842 | Bacteria | 20270 |
| 180 | Ga0068858_100002948 | 3300005842 | Bacteria | 17114 |
| 181 | Ga0068858_100006154 | 3300005842 | Bacteria | 11707 |
| 182 | Ga0068858_100024262 | 3300005842 | Bacteria | 5652 |
| 183 | Ga0068860_100147079 | 3300005843 | Bacteria | 2267 |
| 184 | Ga0081455_10072235 | 3300005937 | Bacteria | 2858 |
| 185 | Ga0081540_1025348 | 3300005983 | Bacteria | 3415 |
| 186 | Ga0081540_1028320 | 3300005983 | Bacteria | 3149 |
| 187 | Ga0075365_10006297 | 3300006038 | Bacteria | 6515 |
| 188 | Ga0075363_100008202 | 3300006048 | Bacteria | 4851 |
| 189 | Ga0075363_100027756 | 3300006048 | Bacteria | 2905 |
| 190 | Ga0075364_10043684 | 3300006051 | Bacteria | 2914 |
| 191 | Ga0075432_10008307 | 3300006058 | Bacteria | 3541 |
| 192 | Ga0075362_10005224 | 3300006177 | Bacteria | 4736 |
| 193 | Ga0075362_10013155 | 3300006177 | Bacteria | 3305 |
| 194 | Ga0075362_10024609 | 3300006177 | Bacteria | 2555 |
| 195 | Ga0075367_10038654 | 3300006178 | Bacteria | 2779 |
| 196 | Ga0075366_10002236 | 3300006195 | Bacteria | 9884 |
| 197 | Ga0075366_10015544 | 3300006195 | Bacteria | 4365 |
| 198 | Ga0075366_10026976 | 3300006195 | Bacteria | 3368 |
| 199 | Ga0075366_10141961 | 3300006195 | Bacteria | 1452 |
| 200 | Ga0097621_100003706 | 3300006237 | Bacteria | 10577 |
| 201 | Ga0097621_100043803 | 3300006237 | Bacteria | 3609 |
| 202 | Ga0075370_10001173 | 3300006353 | Bacteria | 11030 |
| 203 | Ga0075370_10003518 | 3300006353 | Bacteria | 7469 |
| 204 | Ga0075370_10006457 | 3300006353 | Bacteria | 5900 |
| 205 | Ga0075370_10017583 | 3300006353 | Bacteria | 3865 |
| 206 | Ga0075370_10038206 | 3300006353 | Bacteria | 2701 |
| 207 | Ga0075370_10038706 | 3300006353 | Bacteria | 2684 |
| 208 | Ga0075370_10047214 | 3300006353 | Bacteria | 2438 |
| 209 | Ga0075370_10067516 | 3300006353 | Bacteria | 2041 |
| 210 | Ga0075370_10109081 | 3300006353 | Bacteria | 1606 |
| 211 | Ga0068871_100007836 | 3300006358 | Bacteria | 7651 |
| 212 | Ga0068871_100010284 | 3300006358 | Bacteria | 6819 |
| 213 | Ga0068871_100041229 | 3300006358 | Bacteria | 3701 |
| 214 | Ga0068871_100142682 | 3300006358 | Bacteria | 2038 |
| 215 | Ga0075428_100007264 | 3300006844 | Bacteria | 12269 |
| 216 | Ga0075428_100027967 | 3300006844 | Bacteria | 6239 |
| 217 | Ga0075428_100126167 | 3300006844 | Bacteria | 2785 |
| 218 | Ga0075431_100017842 | 3300006847 | Bacteria | 7216 |
| 219 | Ga0075433_10056526 | 3300006852 | Bacteria | 3427 |
| 220 | Ga0075434_100017636 | 3300006871 | Bacteria | 6881 |
| 221 | Ga0075434_100108235 | 3300006871 | Bacteria | 2790 |
| 222 | Ga0068865_100023267 | 3300006881 | Bacteria | 4055 |
| 223 | Ga0068865_100077489 | 3300006881 | Bacteria | 2376 |
| 224 | Ga0075436_100002487 | 3300006914 | Bacteria | 12680 |
| 225 | Ga0097620_100040590 | 3300006931 | Bacteria | 4671 |
| 226 | Ga0097620_100103873 | 3300006931 | Bacteria | 2900 |
| 227 | Ga0097620_100215428 | 3300006931 | Bacteria | 2008 |
| 228 | Ga0099826_10013779 | 3300006948 | Bacteria | 6112 |
| 229 | Ga0075435_100009943 | 3300007076 | Bacteria | 6928 |
| 230 | Ga0075435_100106905 | 3300007076 | Bacteria | 2324 |
| 231 | Ga0099794_10007301 | 3300007265 | Bacteria | 4531 |
| 232 | Ga0105244_10013167 | 3300009036 | Bacteria | 4845 |
| 233 | Ga0105240_10008549 | 3300009093 | Bacteria | 14630 |
| 234 | Ga0105240_10013136 | 3300009093 | Bacteria | 11394 |
| 235 | Ga0105240_10027970 | 3300009093 | Bacteria | 7374 |
| 236 | Ga0105240_10047106 | 3300009093 | Bacteria | 5457 |
| 237 | Ga0105240_10056972 | 3300009093 | Bacteria | 4886 |
| 238 | Ga0105240_10072570 | 3300009093 | Bacteria | 4254 |
| 239 | Ga0105240_10278239 | 3300009093 | Bacteria | 1923 |
| 240 | Ga0111539_10003794 | 3300009094 | Bacteria | 19890 |
| 241 | Ga0111539_10076735 | 3300009094 | Bacteria | 3934 |
| 242 | Ga0105245_10015781 | 3300009098 | Bacteria | 6587 |
| 243 | Ga0105245_10029552 | 3300009098 | Bacteria | 4844 |
| 244 | Ga0114129_10000191 | 3300009147 | Bacteria | 69079 |
| 245 | Ga0105243_10001633 | 3300009148 | Bacteria | 19478 |
| 246 | Ga0105243_10094247 | 3300009148 | Bacteria | 2472 |
| 247 | Ga0105243_10114106 | 3300009148 | Bacteria | 2267 |
| 248 | Ga0105243_10175915 | 3300009148 | Bacteria | 1857 |
| 249 | Ga0105241_10029165 | 3300009174 | Bacteria | 4114 |
| 250 | Ga0105242_10011209 | 3300009176 | Bacteria | 6888 |
| 251 | Ga0105242_10014042 | 3300009176 | Bacteria | 6198 |
| 252 | Ga0105242_10018794 | 3300009176 | Bacteria | 5409 |
| 253 | Ga0105242_10095363 | 3300009176 | Bacteria | 2511 |
| 254 | Ga0105248_10035562 | 3300009177 | Bacteria | 5573 |
| 255 | Ga0105248_10061334 | 3300009177 | Bacteria | 4222 |
| 256 | Ga0105248_10231613 | 3300009177 | Bacteria | 2080 |
| 257 | Ga0105237_10011535 | 3300009545 | Bacteria | 9346 |
| 258 | Ga0105238_10094296 | 3300009551 | Bacteria | 2981 |
| 259 | Ga0105238_10122429 | 3300009551 | Bacteria | 2580 |
| 260 | Ga0105249_10286037 | 3300009553 | Bacteria | 1648 |
| 261 | Ga0105239_10064425 | 3300010375 | Bacteria | 4023 |
| 262 | Ga0105246_10095577 | 3300011119 | Bacteria | 2152 |
| 263 | Ga0157326_1001558 | 3300012513 | Bacteria | 2513 |
| 264 | Ga0157373_10010719 | 3300013100 | Bacteria | 6743 |
| 265 | Ga0157371_10000223 | 3300013102 | Bacteria | 82671 |
| 266 | Ga0157371_10027203 | 3300013102 | Bacteria | 4149 |
| 267 | Ga0157370_10000074 | 3300013104 | Bacteria | 108622 |
| 268 | Ga0157369_10001333 | 3300013105 | Bacteria | 30529 |
| 269 | Ga0157369_10002601 | 3300013105 | Bacteria | 21597 |
| 270 | Ga0157369_10042171 | 3300013105 | Bacteria | 4979 |
| 271 | Ga0157369_10044657 | 3300013105 | Bacteria | 4821 |
| 272 | Ga0157369_10124864 | 3300013105 | Bacteria | 2730 |
| 273 | Ga0157374_10027309 | 3300013296 | Bacteria | 5145 |
| 274 | Ga0157374_10087099 | 3300013296 | Bacteria | 2972 |
| 275 | Ga0157374_10106087 | 3300013296 | Bacteria | 2699 |
| 276 | Ga0157378_10104692 | 3300013297 | Bacteria | 2587 |
| 277 | Ga0163162_10028421 | 3300013306 | Bacteria | 5533 |
| 278 | Ga0163162_10057090 | 3300013306 | Bacteria | 3932 |
| 279 | Ga0163162_10181338 | 3300013306 | Bacteria | 2232 |
| 280 | Ga0157372_10000085 | 3300013307 | Bacteria | 96915 |
| 281 | Ga0157372_10003798 | 3300013307 | Bacteria | 16216 |
| 282 | Ga0157372_10189877 | 3300013307 | Bacteria | 2379 |
| 283 | Ga0157372_10215889 | 3300013307 | Bacteria | 2223 |
| 284 | Ga0157375_10017231 | 3300013308 | Bacteria | 6514 |
| 285 | Ga0157375_10070595 | 3300013308 | Bacteria | 3503 |
| 286 | Ga0157375_10306790 | 3300013308 | Bacteria | 1751 |
| 287 | Ga0163163_10008501 | 3300014325 | Bacteria | 9123 |
| 288 | Ga0157380_10084084 | 3300014326 | Bacteria | 2609 |
| 289 | Ga0182008_10003393 | 3300014497 | Bacteria | 9644 |
| 290 | Ga0182008_10005698 | 3300014497 | Bacteria | 7051 |
| 291 | Ga0157377_10002089 | 3300014745 | Bacteria | 8780 |
| 292 | Ga0157377_10013626 | 3300014745 | Bacteria | 4120 |
| 293 | Ga0157379_10034664 | 3300014968 | Bacteria | 4500 |
| 294 | Ga0157379_10043161 | 3300014968 | Bacteria | 4026 |
| 295 | Ga0157379_10248816 | 3300014968 | Bacteria | 1613 |
| 296 | Ga0157376_10122217 | 3300014969 | Bacteria | 2309 |
| 297 | Ga0182006_1000867 | 3300015261 | Bacteria | 20300 |
| 298 | Ga0182006_1003465 | 3300015261 | Bacteria | 8053 |
| 299 | Ga0182007_10006348 | 3300015262 | Bacteria | 5083 |
| 300 | Ga0182007_10027387 | 3300015262 | Bacteria | 1965 |
| 301 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 302 | Ga0163161_10001379 | 3300017792 | Bacteria | 18020 |
| 303 | Ga0163161_10004878 | 3300017792 | Bacteria | 9346 |
| 304 | Ga0154015_1416575 | 3300020610 | Bacteria | 9701 |
| 305 | Ga0213872_10000029 | 3300021361 | Bacteria | 145850 |
| 306 | Ga0213872_10000618 | 3300021361 | Bacteria | 26906 |
| 307 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 308 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 309 | Ga0209784_100500 | 3300025224 | Bacteria | 15408 |
| 310 | Ga0209784_101272 | 3300025224 | Bacteria | 3684 |
| 311 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 312 | Ga0209566_100280 | 3300025225 | Bacteria | 47182 |
| 313 | Ga0209566_102291 | 3300025225 | Bacteria | 3702 |
| 314 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 315 | Ga0209674_100070 | 3300025226 | Bacteria | 242214 |
| 316 | Ga0209674_100741 | 3300025226 | Bacteria | 11140 |
| 317 | Ga0209672_100436 | 3300025228 | Bacteria | 23953 |
| 318 | Ga0209672_101988 | 3300025228 | Bacteria | 5711 |
| 319 | Ga0209672_102654 | 3300025228 | Bacteria | 4192 |
| 320 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 321 | Ga0209147_100541 | 3300025229 | Bacteria | 21608 |
| 322 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 323 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 324 | Ga0207427_100468 | 3300025231 | Bacteria | 22112 |
| 325 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 326 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 327 | Ga0209258_100163 | 3300025242 | Bacteria | 149677 |
| 328 | Ga0209258_100903 | 3300025242 | Bacteria | 15270 |
| 329 | Ga0207425_1001500 | 3300025245 | Bacteria | 9683 |
| 330 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 331 | Ga0209646_1000016 | 3300025246 | Bacteria | 501688 |
| 332 | Ga0209646_1000226 | 3300025246 | Bacteria | 60008 |
| 333 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 334 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 335 | Ga0209026_1001650 | 3300025250 | Bacteria | 9455 |
| 336 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 337 | Ga0209677_100106 | 3300025253 | Bacteria | 89125 |
| 338 | Ga0209677_100480 | 3300025253 | Bacteria | 22721 |
| 339 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 340 | Ga0209148_1000051 | 3300025254 | Bacteria | 401000 |
| 341 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 342 | Ga0209759_1000025 | 3300025256 | Bacteria | 317082 |
| 343 | Ga0209759_1000684 | 3300025256 | Bacteria | 30588 |
| 344 | Ga0209759_1000939 | 3300025256 | Bacteria | 20977 |
| 345 | Ga0209759_1001423 | 3300025256 | Bacteria | 13586 |
| 346 | Ga0209759_1002409 | 3300025256 | Bacteria | 8224 |
| 347 | Ga0209759_1019363 | 3300025256 | Bacteria | 1615 |
| 348 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 349 | Ga0209565_1000096 | 3300025263 | Bacteria | 134434 |
| 350 | Ga0209565_1000288 | 3300025263 | Bacteria | 49295 |
| 351 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 352 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 353 | Ga0209673_1000232 | 3300025273 | Bacteria | 108581 |
| 354 | Ga0209673_1000838 | 3300025273 | Bacteria | 40184 |
| 355 | Ga0209673_1004143 | 3300025273 | Bacteria | 7943 |
| 356 | Ga0209673_1006206 | 3300025273 | Bacteria | 5834 |
| 357 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 358 | Ga0209130_1000113 | 3300025284 | Bacteria | 130804 |
| 359 | Ga0209130_1000508 | 3300025284 | Bacteria | 39372 |
| 360 | Ga0209130_1001465 | 3300025284 | Bacteria | 15515 |
| 361 | Ga0209130_1002443 | 3300025284 | Bacteria | 9301 |
| 362 | Ga0209130_1012728 | 3300025284 | Bacteria | 2184 |
| 363 | Ga0209675_1000128 | 3300025291 | Bacteria | 103111 |
| 364 | Ga0209675_1000276 | 3300025291 | Bacteria | 49295 |
| 365 | Ga0209675_1002475 | 3300025291 | Bacteria | 9472 |
| 366 | Ga0209675_1002568 | 3300025291 | Bacteria | 9212 |
| 367 | Ga0209675_1003811 | 3300025291 | Bacteria | 6959 |
| 368 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 369 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 370 | Ga0209676_1000418 | 3300025292 | Bacteria | 75214 |
| 371 | Ga0209676_1000705 | 3300025292 | Bacteria | 46561 |
| 372 | Ga0209676_1003053 | 3300025292 | Bacteria | 10807 |
| 373 | Ga0209025_1000531 | 3300025294 | Bacteria | 72578 |
| 374 | Ga0209025_1001493 | 3300025294 | Bacteria | 30271 |
| 375 | Ga0209025_1003884 | 3300025294 | Bacteria | 13507 |
| 376 | Ga0209025_1006696 | 3300025294 | Bacteria | 8844 |
| 377 | Ga0209025_1014270 | 3300025294 | Bacteria | 4906 |
| 378 | Ga0209025_1016285 | 3300025294 | Bacteria | 4403 |
| 379 | Ga0209025_1020721 | 3300025294 | Bacteria | 3576 |
| 380 | Ga0209025_1053271 | 3300025294 | Bacteria | 1589 |
| 381 | Ga0209564_1000394 | 3300025295 | Bacteria | 78197 |
| 382 | Ga0209564_1000912 | 3300025295 | Bacteria | 38636 |
| 383 | Ga0209564_1001098 | 3300025295 | Bacteria | 32197 |
| 384 | Ga0209564_1009461 | 3300025295 | Bacteria | 4634 |
| 385 | Ga0209564_1021392 | 3300025295 | Bacteria | 2328 |
| 386 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 387 | Ga0209758_1004529 | 3300025297 | Bacteria | 11503 |
| 388 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 389 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 390 | Ga0209050_1000570 | 3300025298 | Bacteria | 59779 |
| 391 | Ga0209050_1000690 | 3300025298 | Bacteria | 50644 |
| 392 | Ga0209050_1002949 | 3300025298 | Bacteria | 13300 |
| 393 | Ga0209050_1016296 | 3300025298 | Bacteria | 3052 |
| 394 | Ga0209050_1028547 | 3300025298 | Bacteria | 1807 |
| 395 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 396 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 397 | Ga0209256_1000577 | 3300025299 | Bacteria | 52302 |
| 398 | Ga0209256_1017307 | 3300025299 | Bacteria | 2402 |
| 399 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 400 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 401 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 402 | Ga0207426_1020654 | 3300025302 | Bacteria | 2286 |
| 403 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 404 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 405 | Ga0209051_1000363 | 3300025303 | Bacteria | 66432 |
| 406 | Ga0209051_1000385 | 3300025303 | Bacteria | 62270 |
| 407 | Ga0209051_1000491 | 3300025303 | Bacteria | 51059 |
| 408 | Ga0209051_1001856 | 3300025303 | Bacteria | 16643 |
| 409 | Ga0209051_1001872 | 3300025303 | Bacteria | 16521 |
| 410 | Ga0209051_1012913 | 3300025303 | Bacteria | 4009 |
| 411 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 412 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 413 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 414 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 415 | Ga0209257_1000502 | 3300025304 | Bacteria | 69204 |
| 416 | Ga0209257_1007175 | 3300025304 | Bacteria | 6843 |
| 417 | Ga0209257_1017587 | 3300025304 | Bacteria | 2805 |
| 418 | Ga0207697_10073410 | 3300025315 | Bacteria | 1436 |
| 419 | Ga0207656_10002382 | 3300025321 | Bacteria | 6320 |
| 420 | Ga0207656_10002699 | 3300025321 | Bacteria | 6018 |
| 421 | Ga0207655_1001588 | 3300025728 | Bacteria | 20387 |
| 422 | Ga0207688_10031734 | 3300025901 | Bacteria | 2918 |
| 423 | Ga0207688_10079934 | 3300025901 | Bacteria | 1866 |
| 424 | Ga0207680_10002745 | 3300025903 | Bacteria | 8233 |
| 425 | Ga0207645_10045934 | 3300025907 | Bacteria | 2790 |
| 426 | Ga0207705_10022746 | 3300025909 | Bacteria | 4471 |
| 427 | Ga0207705_10066011 | 3300025909 | Bacteria | 2617 |
| 428 | Ga0207695_10001193 | 3300025913 | Bacteria | 44667 |
| 429 | Ga0207695_10021707 | 3300025913 | Bacteria | 7317 |
| 430 | Ga0207695_10053129 | 3300025913 | Bacteria | 4239 |
| 431 | Ga0207695_10057592 | 3300025913 | Bacteria | 4036 |
| 432 | Ga0207695_10111600 | 3300025913 | Bacteria | 2713 |
| 433 | Ga0207695_10119697 | 3300025913 | Bacteria | 2603 |
| 434 | Ga0207671_10111753 | 3300025914 | Bacteria | 2079 |
| 435 | Ga0207663_10076611 | 3300025916 | Bacteria | 2174 |
| 436 | Ga0207657_10078012 | 3300025919 | Bacteria | 2791 |
| 437 | Ga0207657_10158475 | 3300025919 | Bacteria | 1839 |
| 438 | Ga0207649_10000573 | 3300025920 | Bacteria | 25163 |
| 439 | Ga0207649_10002026 | 3300025920 | Bacteria | 11523 |
| 440 | Ga0207649_10016787 | 3300025920 | Bacteria | 4139 |
| 441 | Ga0207694_10018078 | 3300025924 | Bacteria | 5329 |
| 442 | Ga0207650_10001127 | 3300025925 | Bacteria | 19637 |
| 443 | Ga0207650_10008883 | 3300025925 | Bacteria | 6865 |
| 444 | Ga0207650_10056820 | 3300025925 | Bacteria | 2909 |
| 445 | Ga0207650_10124999 | 3300025925 | Bacteria | 2007 |
| 446 | Ga0207659_10000725 | 3300025926 | Bacteria | 19531 |
| 447 | Ga0207659_10005217 | 3300025926 | Bacteria | 7864 |
| 448 | Ga0207659_10007325 | 3300025926 | Bacteria | 6781 |
| 449 | Ga0207659_10023175 | 3300025926 | Bacteria | 4141 |
| 450 | Ga0207659_10029587 | 3300025926 | Bacteria | 3735 |
| 451 | Ga0207687_10041114 | 3300025927 | Bacteria | 3173 |
| 452 | Ga0207700_10000189 | 3300025928 | Bacteria | 36770 |
| 453 | Ga0207644_10003511 | 3300025931 | Bacteria | 10148 |
| 454 | Ga0207644_10008443 | 3300025931 | Bacteria | 6740 |
| 455 | Ga0207644_10034969 | 3300025931 | Bacteria | 3518 |
| 456 | Ga0207644_10047418 | 3300025931 | Bacteria | 3066 |
| 457 | Ga0207644_10068715 | 3300025931 | Bacteria | 2585 |
| 458 | Ga0207690_10016369 | 3300025932 | Bacteria | 4508 |
| 459 | Ga0207690_10067507 | 3300025932 | Bacteria | 2453 |
| 460 | Ga0207690_10073921 | 3300025932 | Bacteria | 2359 |
| 461 | Ga0207706_10025633 | 3300025933 | Bacteria | 5282 |
| 462 | Ga0207706_10128246 | 3300025933 | Bacteria | 2231 |
| 463 | Ga0207686_10013089 | 3300025934 | Bacteria | 4581 |
| 464 | Ga0207686_10063141 | 3300025934 | Bacteria | 2354 |
| 465 | Ga0207686_10063988 | 3300025934 | Bacteria | 2341 |
| 466 | Ga0207709_10001604 | 3300025935 | Bacteria | 15408 |
| 467 | Ga0207709_10021990 | 3300025935 | Bacteria | 3614 |
| 468 | Ga0207670_10019227 | 3300025936 | Bacteria | 4168 |
| 469 | Ga0207670_10029754 | 3300025936 | Bacteria | 3482 |
| 470 | Ga0207669_10007934 | 3300025937 | Bacteria | 4952 |
| 471 | Ga0207691_10001444 | 3300025940 | Bacteria | 23682 |
| 472 | Ga0207691_10002459 | 3300025940 | Bacteria | 18118 |
| 473 | Ga0207691_10009240 | 3300025940 | Bacteria | 9460 |
| 474 | Ga0207691_10010513 | 3300025940 | Bacteria | 8880 |
| 475 | Ga0207691_10093396 | 3300025940 | Bacteria | 2694 |
| 476 | Ga0207711_10008783 | 3300025941 | Bacteria | 8450 |
| 477 | Ga0207711_10011843 | 3300025941 | Bacteria | 7247 |
| 478 | Ga0207711_10129756 | 3300025941 | Bacteria | 2259 |
| 479 | Ga0207689_10015681 | 3300025942 | Bacteria | 6416 |
| 480 | Ga0207689_10097636 | 3300025942 | Bacteria | 2413 |
| 481 | Ga0207661_10007156 | 3300025944 | Bacteria | 7926 |
| 482 | Ga0207661_10092462 | 3300025944 | Bacteria | 2522 |
| 483 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 484 | Ga0207679_10001704 | 3300025945 | Bacteria | 13702 |
| 485 | Ga0207679_10007132 | 3300025945 | Bacteria | 7080 |
| 486 | Ga0207667_10004568 | 3300025949 | Bacteria | 16974 |
| 487 | Ga0207667_10009460 | 3300025949 | Bacteria | 11475 |
| 488 | Ga0207667_10061375 | 3300025949 | Bacteria | 3932 |
| 489 | Ga0207651_10002950 | 3300025960 | Bacteria | 8227 |
| 490 | Ga0207651_10004833 | 3300025960 | Bacteria | 6860 |
| 491 | Ga0207640_10017885 | 3300025981 | Bacteria | 4155 |
| 492 | Ga0207640_10018533 | 3300025981 | Bacteria | 4092 |
| 493 | Ga0207640_10027293 | 3300025981 | Bacteria | 3477 |
| 494 | Ga0207640_10086378 | 3300025981 | Bacteria | 2160 |
| 495 | Ga0207658_10025926 | 3300025986 | Bacteria | 4107 |
| 496 | Ga0207658_10052793 | 3300025986 | Bacteria | 3001 |
| 497 | Ga0207677_10003064 | 3300026023 | Bacteria | 8834 |
| 498 | Ga0207677_10008356 | 3300026023 | Bacteria | 5778 |
| 499 | Ga0207677_10026784 | 3300026023 | Bacteria | 3621 |
| 500 | Ga0207677_10030189 | 3300026023 | Bacteria | 3456 |
| 501 | Ga0207703_10001773 | 3300026035 | Bacteria | 19268 |
| 502 | Ga0207703_10012670 | 3300026035 | Bacteria | 6575 |
| 503 | Ga0207678_10000003 | 3300026067 | Bacteria | 282716 |
| 504 | Ga0207708_10067958 | 3300026075 | Bacteria | 2727 |
| 505 | Ga0207702_10000010 | 3300026078 | Bacteria | 292789 |
| 506 | Ga0207702_10000522 | 3300026078 | Bacteria | 43072 |
| 507 | Ga0207702_10036919 | 3300026078 | Bacteria | 4087 |
| 508 | Ga0207702_10099499 | 3300026078 | Bacteria | 2563 |
| 509 | Ga0207702_10107674 | 3300026078 | Bacteria | 2472 |
| 510 | Ga0207702_10118365 | 3300026078 | Bacteria | 2367 |
| 511 | Ga0207641_10019102 | 3300026088 | Bacteria | 5621 |
| 512 | Ga0207641_10036585 | 3300026088 | Bacteria | 4098 |
| 513 | Ga0207641_10162307 | 3300026088 | Bacteria | 2033 |
| 514 | Ga0207641_10190351 | 3300026088 | Bacteria | 1885 |
| 515 | Ga0207641_10222677 | 3300026088 | Bacteria | 1750 |
| 516 | Ga0207648_10019713 | 3300026089 | Bacteria | 6086 |
| 517 | Ga0207648_10024255 | 3300026089 | Bacteria | 5417 |
| 518 | Ga0207648_10067748 | 3300026089 | Bacteria | 3111 |
| 519 | Ga0207648_10075838 | 3300026089 | Bacteria | 2931 |
| 520 | Ga0207648_10160568 | 3300026089 | Bacteria | 1985 |
| 521 | Ga0207676_10001271 | 3300026095 | Bacteria | 18758 |
| 522 | Ga0207676_10012287 | 3300026095 | Bacteria | 6130 |
| 523 | Ga0207676_10020956 | 3300026095 | Bacteria | 4791 |
| 524 | Ga0207676_10035333 | 3300026095 | Bacteria | 3792 |
| 525 | Ga0207674_10023464 | 3300026116 | Bacteria | 6607 |
| 526 | Ga0207674_10079210 | 3300026116 | Bacteria | 3290 |
| 527 | Ga0207674_10107212 | 3300026116 | Bacteria | 2771 |
| 528 | Ga0207674_10232195 | 3300026116 | Bacteria | 1792 |
| 529 | Ga0207675_100018746 | 3300026118 | Bacteria | 6458 |
| 530 | Ga0207675_100065898 | 3300026118 | Bacteria | 3385 |
| 531 | Ga0207675_100079404 | 3300026118 | Bacteria | 3075 |
| 532 | Ga0207675_100193442 | 3300026118 | Bacteria | 1952 |
| 533 | Ga0207675_100267998 | 3300026118 | Bacteria | 1657 |
| 534 | Ga0207683_10000838 | 3300026121 | Bacteria | 28142 |
| 535 | Ga0207683_10005156 | 3300026121 | Bacteria | 11217 |
| 536 | Ga0207683_10006290 | 3300026121 | Bacteria | 10176 |
| 537 | Ga0207683_10015911 | 3300026121 | Bacteria | 6405 |
| 538 | Ga0207683_10037520 | 3300026121 | Bacteria | 4220 |
| 539 | Ga0207683_10039060 | 3300026121 | Bacteria | 4140 |
| 540 | Ga0207683_10089575 | 3300026121 | Bacteria | 2739 |
| 541 | Ga0207683_10129250 | 3300026121 | Bacteria | 2271 |
| 542 | Ga0207698_10001250 | 3300026142 | Bacteria | 14873 |
| 543 | Ga0207698_10009072 | 3300026142 | Bacteria | 6319 |
| 544 | Ga0207698_10019512 | 3300026142 | Bacteria | 4643 |
| 545 | Ga0207698_10052932 | 3300026142 | Bacteria | 3112 |
| 546 | Ga0207698_10195860 | 3300026142 | Bacteria | 1805 |
| 547 | Ga0207428_10001012 | 3300027907 | Bacteria | 31168 |
| 548 | Ga0207428_10012148 | 3300027907 | Bacteria | 7579 |
| 549 | Ga0268264_10137133 | 3300028381 | Bacteria | 2177 |
| 550 | Ga0265337_1032774 | 3300028556 | Bacteria | 1536 |
| 551 | Ga0265323_10003116 | 3300028653 | Bacteria | 7378 |
| 552 | Ga0265323_10008205 | 3300028653 | Bacteria | 4319 |
| 553 | Ga0265336_10000051 | 3300028666 | Bacteria | 114796 |
| 554 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 555 | Ga0307515_10000458 | 3300028794 | Bacteria | 97523 |
| 556 | Ga0307515_10016545 | 3300028794 | Bacteria | 13496 |
| 557 | Ga0307515_10048179 | 3300028794 | Bacteria | 6450 |
| 558 | Ga0307515_10056923 | 3300028794 | Bacteria | 5670 |
| 559 | Ga0307512_10055475 | 3300030522 | Bacteria | 3124 |
| 560 | Ga0265325_10001972 | 3300031241 | Bacteria | 14131 |
| 561 | Ga0265340_10000047 | 3300031247 | Bacteria | 55910 |
| 562 | Ga0265331_10002871 | 3300031250 | Bacteria | 11392 |
| 563 | Ga0265331_10031690 | 3300031250 | Bacteria | 2626 |
| 564 | Ga0307513_10000021 | 3300031456 | Bacteria | 228078 |
| 565 | Ga0307509_10000120 | 3300031507 | Bacteria | 114238 |
| 566 | Ga0307509_10013526 | 3300031507 | Bacteria | 9654 |
| 567 | Ga0307509_10060091 | 3300031507 | Bacteria | 4019 |
| 568 | Ga0307509_10069501 | 3300031507 | Bacteria | 3681 |
| 569 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 570 | Ga0307408_100003007 | 3300031548 | Bacteria | 11658 |
| 571 | Ga0307408_100047082 | 3300031548 | Bacteria | 3086 |
| 572 | Ga0307408_100079883 | 3300031548 | Bacteria | 2442 |
| 573 | Ga0307508_10000163 | 3300031616 | Bacteria | 80086 |
| 574 | Ga0307508_10019292 | 3300031616 | Bacteria | 6200 |
| 575 | Ga0307508_10023931 | 3300031616 | Bacteria | 5543 |
| 576 | Ga0307514_10000828 | 3300031649 | Bacteria | 49982 |
| 577 | Ga0307514_10046625 | 3300031649 | Bacteria | 3386 |
| 578 | Ga0265314_10000007 | 3300031711 | Bacteria | 491737 |
| 579 | Ga0265342_10001861 | 3300031712 | Bacteria | 19067 |
| 580 | Ga0316576_10003935 | 3300031727 | Bacteria | 8816 |
| 581 | Ga0307516_10018571 | 3300031730 | Bacteria | 7222 |
| 582 | Ga0307516_10022115 | 3300031730 | Bacteria | 6534 |
| 583 | Ga0307405_10049640 | 3300031731 | Bacteria | 2594 |
| 584 | Ga0307413_10016958 | 3300031824 | Bacteria | 3781 |
| 585 | Ga0307410_10056048 | 3300031852 | Bacteria | 2678 |
| 586 | Ga0307406_10002339 | 3300031901 | Bacteria | 10300 |
| 587 | Ga0307406_10008992 | 3300031901 | Bacteria | 5587 |
| 588 | Ga0307406_10105266 | 3300031901 | Bacteria | 1930 |
| 589 | Ga0307412_10000135 | 3300031911 | Bacteria | 53519 |
| 590 | Ga0307412_10015988 | 3300031911 | Bacteria | 4459 |
| 591 | Ga0307409_100010337 | 3300031995 | Bacteria | 5795 |
| 592 | Ga0307416_100003363 | 3300032002 | Bacteria | 9368 |
| 593 | Ga0307416_100017961 | 3300032002 | Bacteria | 4968 |
| 594 | Ga0307416_100099633 | 3300032002 | Bacteria | 2524 |
| 595 | Ga0307411_10011035 | 3300032005 | Bacteria | 4852 |
| 596 | Ga0307411_10019119 | 3300032005 | Bacteria | 3948 |
| 597 | Ga0307411_10040848 | 3300032005 | Bacteria | 2946 |
| 598 | Ga0307415_100016744 | 3300032126 | Bacteria | 4378 |
| 599 | Ga0307415_100023469 | 3300032126 | Bacteria | 3830 |
| 600 | Ga0307510_10002394 | 3300033180 | Bacteria | 21269 |
| 601 | Ga0307510_10018033 | 3300033180 | Bacteria | 8317 |
| 602 | Ga0373926_0037748 | 3300035083 | Bacteria | 1719 |
| 603 | Ga0373949_0004987 | 3300035090 | Bacteria | 2994 |
| 604 | Ga0373923_0048720 | 3300035111 | Bacteria | 1770 |
| 605 | Ga0373923_0067250 | 3300035111 | Bacteria | 1532 |
| 606 | Ga0373939_0000139 | 3300035114 | Bacteria | 20747 |
| 607 | Ga0373941_0013544 | 3300035115 | Bacteria | 2158 |
| 608 | Ga0373945_0012903 | 3300035116 | Bacteria | 2783 |
| 609 | Ga0373956_0000193 | 3300035119 | Bacteria | 23411 |
| 610 | Ga0373931_0000908 | 3300035691 | Bacteria | 12513 |
| 611 | Ga0373931_0004912 | 3300035691 | Bacteria | 6148 |
| 612 | Ga0373927_0005732 | 3300035695 | Bacteria | 8531 |
| 613 | Ga0373933_0000364 | 3300035724 | Bacteria | 28986 |
| 614 | Ga0373937_0000182 | 3300036401 | Bacteria | 61628 |
| 615 | Ga0373925_0045523 | 3300037068 | Bacteria | 3260 |
| 616 | Ga0395899_0012470 | 3300037312 | Bacteria | 6511 |
| 617 | Ga0395900_0003483 | 3300037418 | Bacteria | 16983 |
| 618 | Ga0395898_0006685 | 3300037466 | Bacteria | 12296 |
| 619 | Ga0395898_0010478 | 3300037466 | Bacteria | 9690 |
| 620 | Ga0395905_0002802 | 3300037471 | Bacteria | 19102 |
| 621 | Ga0395905_0018172 | 3300037471 | Bacteria | 6674 |
| 622 | Ga0395905_0024518 | 3300037471 | Bacteria | 5692 |
| 623 | Ga0395905_0029244 | 3300037471 | Bacteria | 5193 |
| 624 | Ga0395905_0113031 | 3300037471 | Bacteria | 2551 |
| 625 | Ga0395901_0015357 | 3300038443 | Bacteria | 7793 |
| 626 | Ga0395901_0015454 | 3300038443 | Bacteria | 7773 |
| 627 | Ga0395901_0022158 | 3300038443 | Bacteria | 6509 |
| 628 | Ga0436361_0034352 | 3300039447 | Bacteria | 2194 |
| 629 | Ga0436361_0625540 | 3300039447 | Bacteria | 4196 |
| 630 | Ga0436363_0667407 | 3300039450 | Bacteria | 4068 |
| 631 | Ga0439436_0007418 | 3300041404 | Bacteria | 3375 |
| 632 | Ga0439436_0020373 | 3300041404 | Bacteria | 1975 |
| 633 | Ga0451807_0675626 | 3300041486 | Bacteria | 9142 |
| 634 | Ga0439445_0008291 | 3300042004 | Bacteria | 2429 |
| 635 | Ga0439449_0008125 | 3300042007 | Bacteria | 3988 |
| 636 | Ga0439449_0012578 | 3300042007 | Bacteria | 3183 |
| 637 | Ga0439457_009413 | 3300042014 | Bacteria | 2275 |
| 638 | Ga0450890_000536 | 3300042127 | Bacteria | 5601 |
| 639 | Ga0450891_000192 | 3300042129 | Bacteria | 5988 |
| 640 | Ga0439446_0019780 | 3300042156 | Bacteria | 1894 |
| 641 | Ga0450893_0000214 | 3300042532 | Bacteria | 7709 |
| 642 | Ga0451577_0000742 | 3300042876 | Bacteria | 50207 |
| 643 | Ga0451577_0043187 | 3300042876 | Bacteria | 4038 |
| 644 | Ga0451577_0085905 | 3300042876 | Bacteria | 2807 |
| 645 | Ga0451577_0133455 | 3300042876 | Bacteria | 2228 |
| 646 | Ga0466969_0000001 | 3300044656 | Bacteria | 189617 |
| 647 | Ga0466969_0004528 | 3300044656 | Bacteria | 7398 |
| 648 | Ga0466969_0016894 | 3300044656 | Bacteria | 3815 |
| 649 | Ga0466972_0055407 | 3300044658 | Bacteria | 1907 |
| 650 | Ga0466965_0004669 | 3300044683 | Bacteria | 6109 |
| 651 | Ga0466966_0005235 | 3300044684 | Bacteria | 8527 |
| 652 | Ga0466966_0006418 | 3300044684 | Bacteria | 7777 |
| 653 | Ga0466961_0011024 | 3300044693 | Bacteria | 5776 |
| 654 | Ga0466963_0008073 | 3300044694 | Bacteria | 6301 |
| 655 | Ga0466964_0003328 | 3300044706 | Bacteria | 5858 |
| 656 | Ga0466964_0004632 | 3300044706 | Bacteria | 5086 |
| 657 | Ga0466964_0028165 | 3300044706 | Bacteria | 2211 |
| 658 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 659 | Ga0453684_0009901 | 3300044712 | Bacteria | 16457 |
| 660 | Ga0466971_0004295 | 3300044719 | Bacteria | 6142 |
| 661 | Ga0466970_0004172 | 3300044765 | Bacteria | 7108 |
| 662 | Ga0466957_0014724 | 3300044842 | Bacteria | 4557 |
| 663 | Ga0466957_0062297 | 3300044842 | Bacteria | 2290 |
| 664 | Ga0466959_0000063 | 3300045049 | Bacteria | 75428 |
| 665 | Ga0466959_0006014 | 3300045049 | Bacteria | 8376 |
| 666 | Ga0466959_0026775 | 3300045049 | Bacteria | 4276 |
| 667 | Ga0451576_0013881 | 3300045051 | Bacteria | 8997 |
| 668 | Ga0451576_0044822 | 3300045051 | Bacteria | 4660 |
| 669 | Ga0451576_0136973 | 3300045051 | Bacteria | 2553 |
| 670 | Ga0466958_0004695 | 3300045836 | Bacteria | 7252 |
| 671 | Ga0466958_0017953 | 3300045836 | Bacteria | 4100 |
| 672 | Ga0466958_0018095 | 3300045836 | Bacteria | 4083 |
| 673 | Ga0495617_012554 | 3300046452 | Bacteria | 2888 |
| 674 | Ga0495617_038624 | 3300046452 | Bacteria | 1596 |
| 675 | Ga0495592_0002422 | 3300046454 | Bacteria | 13147 |
| 676 | Ga0495590_0010273 | 3300046457 | Bacteria | 3526 |
| 677 | Ga0495629_0011897 | 3300046459 | Bacteria | 6309 |
| 678 | Ga0495638_0002153 | 3300046460 | Bacteria | 16525 |
| 679 | Ga0495638_0061966 | 3300046460 | Bacteria | 2310 |
| 680 | Ga0495651_0000027 | 3300046462 | Bacteria | 107496 |
| 681 | Ga0495580_0021078 | 3300046472 | Bacteria | 4813 |
| 682 | Ga0495580_0028185 | 3300046472 | Bacteria | 4084 |
| 683 | Ga0495582_0011400 | 3300046473 | Bacteria | 4897 |
| 684 | Ga0495605_0001486 | 3300046474 | Bacteria | 15297 |
| 685 | Ga0495639_0004066 | 3300046475 | Bacteria | 6270 |
| 686 | Ga0495584_0000621 | 3300046491 | Bacteria | 23734 |
| 687 | Ga0495585_0007084 | 3300046492 | Bacteria | 6891 |
| 688 | Ga0495585_0056295 | 3300046492 | Bacteria | 2172 |
| 689 | Ga0495585_0059195 | 3300046492 | Bacteria | 2111 |
| 690 | Ga0495594_0002498 | 3300046499 | Bacteria | 9578 |
| 691 | Ga0495583_0000016 | 3300046506 | Bacteria | 312691 |
| 692 | Ga0495606_0002620 | 3300046507 | Bacteria | 20518 |
| 693 | Ga0495616_0004257 | 3300046513 | Bacteria | 9046 |
| 694 | Ga0495616_0005761 | 3300046513 | Bacteria | 7576 |
| 695 | Ga0495616_0027002 | 3300046513 | Bacteria | 3049 |
| 696 | Ga0495628_0005560 | 3300046516 | Bacteria | 11034 |
| 697 | Ga0495628_0094618 | 3300046516 | Bacteria | 2309 |
| 698 | Ga0495637_0045719 | 3300046520 | Bacteria | 1855 |
| 699 | Ga0495637_0050812 | 3300046520 | Bacteria | 1738 |
| 700 | Ga0495643_0003120 | 3300046522 | Bacteria | 12380 |
| 701 | Ga0495648_0000593 | 3300046524 | Bacteria | 38760 |
| 702 | Ga0495666_0064639 | 3300046526 | Bacteria | 1746 |
| 703 | Ga0495652_0036854 | 3300046529 | Bacteria | 4247 |
| 704 | Ga0495652_0071658 | 3300046529 | Bacteria | 2891 |
| 705 | Ga0495665_0003964 | 3300046531 | Bacteria | 7996 |
| 706 | Ga0495586_0090949 | 3300046535 | Bacteria | 1686 |
| 707 | Ga0495587_0006273 | 3300046536 | Bacteria | 7760 |
| 708 | Ga0495597_0004154 | 3300046542 | Bacteria | 8032 |
| 709 | Ga0495597_0015616 | 3300046542 | Bacteria | 3592 |
| 710 | Ga0495645_0002395 | 3300046543 | Bacteria | 12721 |
| 711 | Ga0495622_0005439 | 3300046557 | Bacteria | 5910 |
| 712 | Ga0495633_0002301 | 3300046558 | Bacteria | 13619 |
| 713 | Ga0495633_0015720 | 3300046558 | Bacteria | 3922 |
| 714 | Ga0495656_0000110 | 3300046615 | Bacteria | 32732 |
| 715 | Ga0495668_0044647 | 3300046616 | Bacteria | 2463 |
| 716 | Ga0495634_0019399 | 3300046642 | Bacteria | 4832 |
| 717 | Ga0495611_0008728 | 3300046648 | Bacteria | 4286 |
| 718 | Ga0495625_0002383 | 3300046660 | Bacteria | 20428 |
| 719 | Ga0495625_0010249 | 3300046660 | Bacteria | 7771 |
| 720 | Ga0495625_0080003 | 3300046660 | Bacteria | 2277 |
| 721 | Ga0495635_0030188 | 3300046663 | Bacteria | 3767 |
| 722 | Ga0495659_0007216 | 3300046664 | Bacteria | 3519 |
| 723 | Ga0495661_0002005 | 3300046665 | Bacteria | 16054 |
| 724 | Ga0495599_0000531 | 3300046678 | Bacteria | 21912 |
| 725 | Ga0495599_0022849 | 3300046678 | Bacteria | 3906 |
| 726 | Ga0495599_0140589 | 3300046678 | Bacteria | 1498 |
| 727 | Ga0495623_0016524 | 3300046679 | Bacteria | 4768 |
| 728 | Ga0495647_0011450 | 3300046681 | Bacteria | 3040 |
| 729 | Ga0495658_0001699 | 3300046683 | Bacteria | 11444 |
| 730 | Ga0495669_0025706 | 3300046684 | Bacteria | 2569 |
| 731 | Ga0495670_0002770 | 3300046691 | Bacteria | 8667 |
| 732 | Ga0495670_0005224 | 3300046691 | Bacteria | 6392 |
| 733 | Ga0495671_0080841 | 3300046692 | Bacteria | 1592 |
| 734 | Ga0495671_0111269 | 3300046692 | Bacteria | 1337 |
| 735 | Ga0495581_0008234 | 3300047315 | Bacteria | 6042 |
| 736 | Ga0495636_0000920 | 3300047318 | Bacteria | 10942 |
| 737 | Ga0495672_0012407 | 3300047320 | Bacteria | 5948 |
| 738 | Ga0495676_0012265 | 3300047321 | Bacteria | 7722 |
| 739 | Ga0495676_0016453 | 3300047321 | Bacteria | 6564 |
| 740 | Ga0495683_0006098 | 3300047323 | Bacteria | 6608 |
| 741 | Ga0495687_000138 | 3300047443 | Bacteria | 110840 |
| 742 | Ga0495687_006782 | 3300047443 | Bacteria | 6925 |
| 743 | Ga0495687_025727 | 3300047443 | Bacteria | 2777 |
| 744 | Ga0495677_0003212 | 3300047445 | Bacteria | 6372 |
| 745 | Ga0495685_000219 | 3300047447 | Bacteria | 19447 |
| 746 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 747 | Ga0495684_0038078 | 3300047471 | Bacteria | 3688 |
| 748 | Ga0495686_0006352 | 3300047472 | Bacteria | 9067 |
| 749 | Ga0495593_0000759 | 3300047673 | Bacteria | 18716 |
| 750 | Ga0495593_0011141 | 3300047673 | Bacteria | 5171 |
| 751 | Ga0496100_0018668 | 3300048903 | Bacteria | 4119 |
| 752 | Ga0496101_0061878 | 3300048904 | Bacteria | 2720 |
| 753 | Ga0496101_0232980 | 3300048904 | Bacteria | 1432 |
| 754 | Ga0496102_0071667 | 3300048905 | Bacteria | 3182 |
| 755 | Ga0496102_0072781 | 3300048905 | Bacteria | 3159 |
| 756 | Ga0496104_0040730 | 3300048907 | Bacteria | 4355 |
| 757 | Ga0496105_0062478 | 3300048908 | Bacteria | 3074 |
| 758 | Ga0496106_0023204 | 3300048909 | Bacteria | 4609 |
| 759 | Ga0496107_0137097 | 3300048910 | Bacteria | 1808 |
| 760 | Ga0496108_0040990 | 3300048911 | Bacteria | 3863 |
| 761 | Ga0496108_0087964 | 3300048911 | Bacteria | 2639 |
| 762 | Ga0496109_0024792 | 3300048912 | Bacteria | 5336 |
| 763 | Ga0496109_0027408 | 3300048912 | Bacteria | 5086 |
| 764 | Ga0496110_0004858 | 3300048913 | Bacteria | 10483 |
| 765 | Ga0496110_0009425 | 3300048913 | Bacteria | 7908 |
| 766 | Ga0496111_0032942 | 3300048914 | Bacteria | 3695 |
| 767 | Ga0496111_0053081 | 3300048914 | Bacteria | 2928 |
| 768 | Ga0496111_0086850 | 3300048914 | Bacteria | 2289 |
| 769 | Ga0496112_0050038 | 3300048915 | Bacteria | 4096 |
| 770 | Ga0496113_0146119 | 3300048916 | Bacteria | 1863 |
| 771 | Ga0496115_0027971 | 3300048918 | Bacteria | 4415 |
| 772 | Ga0496115_0066235 | 3300048918 | Bacteria | 2919 |
| 773 | Ga0496116_0010521 | 3300048919 | Bacteria | 7738 |
| 774 | Ga0496117_0025555 | 3300048920 | Bacteria | 4640 |
| 775 | Ga0496119_0035106 | 3300048922 | Bacteria | 3290 |
| 776 | Ga0496121_0000314 | 3300048924 | Bacteria | 100909 |
| 777 | Ga0496121_0072459 | 3300048924 | Bacteria | 2765 |
| 778 | Ga0496122_0000046 | 3300048925 | Bacteria | 274640 |
| 779 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 780 | Ga0496123_0000082 | 3300048926 | Bacteria | 188909 |
| 781 | Ga0496123_0001126 | 3300048926 | Bacteria | 39890 |
| 782 | Ga0496123_0022919 | 3300048926 | Bacteria | 4796 |
| 783 | Ga0496124_0000038 | 3300048927 | Bacteria | 312485 |
| 784 | Ga0496124_0057503 | 3300048927 | Bacteria | 3276 |
| 785 | Ga0496125_0000028 | 3300048928 | Bacteria | 387222 |
| 786 | Ga0496125_0000532 | 3300048928 | Bacteria | 65618 |
| 787 | Ga0496125_0079036 | 3300048928 | Bacteria | 2525 |
| 788 | Ga0495682_0002647 | 3300049460 | Bacteria | 8374 |
| 789 | Ga0501034_0006242 | 3300049571 | Bacteria | 12827 |
| 790 | Ga0501041_0172858 | 3300049577 | Bacteria | 1352 |
| 791 | Ga0501042_0143664 | 3300049578 | Bacteria | 1721 |
| 792 | Ga0501043_0156886 | 3300049579 | Bacteria | 1780 |
| 793 | Ga0501047_0023913 | 3300049581 | Bacteria | 5866 |
| 794 | Ga0501068_0067902 | 3300049584 | Bacteria | 2173 |
| 795 | Ga0501069_0001500 | 3300049585 | Bacteria | 11533 |
| 796 | Ga0501070_0003950 | 3300049586 | Bacteria | 12768 |
| 797 | Ga0501072_0110293 | 3300049588 | Bacteria | 2190 |
| 798 | Ga0501073_0000374 | 3300049589 | Bacteria | 30124 |
| 799 | Ga0501073_0009188 | 3300049589 | Bacteria | 7290 |
| 800 | Ga0501073_0019817 | 3300049589 | Bacteria | 4854 |
| 801 | Ga0501074_0000125 | 3300049590 | Bacteria | 39203 |
| 802 | Ga0501076_0025005 | 3300049592 | Bacteria | 4619 |
| 803 | Ga0501198_000005 | 3300049649 | Bacteria | 156657 |
| 804 | Ga0501222_000003 | 3300049662 | Bacteria | 157406 |
| 805 | Ga0501079_0013497 | 3300049741 | Bacteria | 6229 |
| 806 | Ga0501080_0001248 | 3300049742 | Bacteria | 21187 |
| 807 | Ga0501080_0007975 | 3300049742 | Bacteria | 9595 |
| 808 | Ga0501080_0039560 | 3300049742 | Bacteria | 4401 |
| 809 | Ga0501083_0007469 | 3300049744 | Bacteria | 7746 |
| 810 | Ga0501266_001164 | 3300049763 | Bacteria | 3377 |
| 811 | Ga0501035_0067904 | 3300049822 | Bacteria | 3162 |
| 812 | Ga0501035_0095951 | 3300049822 | Bacteria | 2606 |
| 813 | nmdc:mga03683_20354_c1 | 3300050489 | Bacteria | 2545 |
| 814 | nmdc:mga03683_22410_c1 | 3300050489 | Bacteria | 2449 |
| 815 | nmdc:mga00v17_10232_c1 | 3300050491 | Bacteria | 5114 |
| 816 | nmdc:mga00v17_48905_c1 | 3300050491 | Bacteria | 2563 |
| 817 | nmdc:mga0k408_1565_c1 | 3300050493 | Bacteria | 12364 |
| 818 | nmdc:mga0k408_26727_c1 | 3300050493 | Bacteria | 3274 |
| 819 | nmdc:mga0k408_4867_c1 | 3300050493 | Bacteria | 7123 |
| 820 | nmdc:mga0k408_6461_c1 | 3300050493 | Bacteria | 6248 |
| 821 | nmdc:mga0k408_6553_c1 | 3300050493 | Bacteria | 6203 |
| 822 | nmdc:mga0k408_76088_c1 | 3300050493 | Bacteria | 1962 |
| 823 | nmdc:mga06z11_50874_c1 | 3300050494 | Bacteria | 2119 |
| 824 | nmdc:mga07m45_18826_c1 | 3300050496 | Bacteria | 3734 |
| 825 | nmdc:mga07m45_19735_c1 | 3300050496 | Bacteria | 3654 |
| 826 | nmdc:mga07m45_202_c1 | 3300050496 | Bacteria | 23538 |
| 827 | nmdc:mga07m45_21064_c1 | 3300050496 | Bacteria | 3547 |
| 828 | nmdc:mga07m45_2832_c1 | 3300050496 | Bacteria | 8203 |
| 829 | nmdc:mga07m45_43302_c1 | 3300050496 | Bacteria | 2524 |
| 830 | nmdc:mga07m45_61657_c1 | 3300050496 | Bacteria | 2125 |
| 831 | nmdc:mga07m45_716_c1 | 3300050496 | Bacteria | 14102 |
| 832 | nmdc:mga07m45_8065_c1 | 3300050496 | Bacteria | 5399 |
| 833 | nmdc:mga05p37_109213_c1 | 3300050507 | Bacteria | 3403 |
| 834 | nmdc:mga0qj67_172497_c1 | 3300050509 | Bacteria | 1756 |
| 835 | nmdc:mga0qj67_61514_c1 | 3300050509 | Bacteria | 2981 |
| 836 | nmdc:mga06r32_704_c1 | 3300050510 | Bacteria | 29199 |
| 837 | nmdc:mga08y16_59229_c1 | 3300050511 | Bacteria | 4001 |
| 838 | nmdc:mga08y16_7529_c1 | 3300050511 | Bacteria | 11403 |
| 839 | nmdc:mga0n895_13563_c1 | 3300050512 | Bacteria | 7361 |
| 840 | nmdc:mga0rr50_11608_c1 | 3300050513 | Bacteria | 5651 |
| 841 | nmdc:mga0rr50_119039_c1 | 3300050513 | Bacteria | 2099 |
| 842 | nmdc:mga0rr50_33844_c1 | 3300050513 | Bacteria | 3654 |
| 843 | nmdc:mga0rr50_7922_c1 | 3300050513 | Bacteria | 6590 |
| 844 | nmdc:mga08x19_118322_c1 | 3300050514 | Bacteria | 1773 |
| 845 | nmdc:mga08x19_9403_c1 | 3300050514 | Bacteria | 5853 |
| 846 | nmdc:mga0a205_95540_c1 | 3300050515 | Bacteria | 2871 |
| 847 | Ga0495601_0000822 | 3300053077 | Bacteria | 16815 |
| 848 | Ga0500610_0000344 | 3300053079 | Bacteria | 14067 |
| 849 | Ga0500610_0020666 | 3300053079 | Bacteria | 3217 |
| 850 | Ga0500635_0000145 | 3300053080 | Bacteria | 40070 |
| 851 | Ga0500651_0000353 | 3300053093 | Bacteria | 25788 |
| 852 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 853 | Ga0500562_004134 | 3300053108 | Bacteria | 3662 |
| 854 | Ga0500569_000840 | 3300053109 | Bacteria | 5448 |
| 855 | Ga0500572_001770 | 3300053111 | Bacteria | 5559 |
| 856 | Ga0500614_003737 | 3300053123 | Bacteria | 3259 |
| 857 | Ga0500652_035527 | 3300053131 | Bacteria | 1980 |
| 858 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 859 | Ga0500568_0005309 | 3300053139 | Bacteria | 6691 |
| 860 | Ga0500600_0030483 | 3300053149 | Bacteria | 3174 |
| 861 | Ga0500603_000040 | 3300053150 | Bacteria | 30803 |
| 862 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 863 | Ga0500636_0034879 | 3300053177 | Bacteria | 2978 |
| 864 | Ga0500637_0024809 | 3300053178 | Bacteria | 3288 |
| 865 | Ga0500645_000274 | 3300053730 | Bacteria | 36869 |
| 866 | Ga0500645_003458 | 3300053730 | Bacteria | 6402 |
| 867 | Ga0587072_001478 | 3300059643 | Bacteria | 2920 |
| 868 | Ga0466962_0008617 | 3300061719 | Bacteria | 4888 |
| 869 | 2511245553 | 2511231002 | Bacteria | 5042903 |
| 870 | 2513227406 | 2513020051 | Bacteria | 6053213 |
| 871 | 2513874577 | 2513237139 | Bacteria | 8737671 |
| 872 | 2513894527 | 2513237141 | Bacteria | 8496279 |
| 873 | 2524610238 | 2524023250 | Bacteria | 5457705 |
| 874 | 2548498292 | 2547132374 | Bacteria | 5530232 |
| 875 | 2548849106 | 2547132512 | Bacteria | 3416496 |
| 876 | 2599446114 | 2599185178 | Bacteria | 5365746 |
| 877 | 2599624514 | 2599185214 | Bacteria | 8209958 |
| 878 | 2599672624 | 2599185226 | Bacteria | 8233575 |
| 879 | 2599683624 | 2599185227 | Bacteria | 8246414 |
| 880 | 2599694233 | 2599185229 | Bacteria | 8216126 |
| 881 | 2643745913 | 2643221544 | Bacteria | 5886209 |
| 882 | 2643789322 | 2643221554 | Bacteria | 6603920 |
| 883 | 2643862684 | 2643221569 | Bacteria | 6064337 |
| 884 | 2643980310 | 2643221594 | Bacteria | 5811388 |
| 885 | 2644062964 | 2643221609 | Bacteria | 6756331 |
| 886 | 2644070647 | 2643221611 | Bacteria | 6820941 |
| 887 | 2644121910 | 2643221621 | Bacteria | 6212786 |
| 888 | 2644163167 | 2643221628 | Bacteria | 5745828 |
| 889 | 2644220868 | 2643221639 | Bacteria | 6649903 |
| 890 | 2644259689 | 2643221646 | Bacteria | 6433402 |
| 891 | 2644287379 | 2643221651 | Bacteria | 4798932 |
| 892 | 2644304754 | 2643221654 | Bacteria | 5273570 |
| 893 | 2644328078 | 2643221658 | Bacteria | 6064537 |
| 894 | 2644338114 | 2643221660 | Bacteria | 4208257 |
| 895 | 2644398613 | 2643221672 | Bacteria | 6322190 |
| 896 | 2644648826 | 2643221717 | Bacteria | 5676132 |
| 897 | 2738720186 | 2738541277 | Bacteria | 7458140 |
| 898 | 2738881730 | 2738541307 | Bacteria | 8606193 |
| 899 | 2739057284 | 2738541337 | Bacteria | 6183410 |
| 900 | 2739243723 | 2738543012 | Bacteria | 7115078 |
| 901 | 2739279385 | 2738543019 | Bacteria | 7459457 |
| 902 | 2774870257 | 2773857925 | Bacteria | 6472445 |
| 903 | 2805916573 | 2802429603 | Bacteria | 8777136 |
| 904 | 2809032376 | 2808606395 | Bacteria | 6020352 |
| 905 | 2816472553 | 2816332133 | Bacteria | 7249298 |
| 906 | 2819595927 | 2818991446 | Bacteria | 7757362 |
| 907 | 2831266924 | 2831265667 | Bacteria | 7184833 |
| 908 | 2838056983 | 2838054893 | Bacteria | 7451788 |
| 909 | 2842678798 | 2842677519 | Bacteria | 5615038 |
| 910 | 2842720292 | 2842718218 | Bacteria | 4560148 |
| 911 | 2842735547 | 2842733646 | Bacteria | 5716726 |
| 912 | 2842751360 | 2842747753 | Bacteria | 5578255 |
| 913 | 2857542486 | 2857537821 | Bacteria | 5248181 |
| 914 | 2857544781 | 2857542790 | Bacteria | 5326616 |
| 915 | 2884299549 | 2884298095 | Bacteria | 3823049 |
| 916 | 2885192848 | 2885192300 | Bacteria | 5882526 |
| 917 | 2885199021 | 2885198086 | Bacteria | 7212419 |
| 918 | 2885212716 | 2885211737 | Bacteria | 7212420 |
| 919 | 2885266755 | 2885266251 | Bacteria | 4796748 |
| 920 | 2899925275 | 2899924645 | Bacteria | 7487985 |
| 921 | 2904456432 | 2904449895 | Bacteria | 6927402 |
| 922 | 2904460705 | 2904456579 | Bacteria | 6819253 |
| 923 | 2904480318 | 2904479285 | Bacteria | 5073931 |
| 924 | 2904548380 | 2904541872 | Bacteria | 8915136 |
| 925 | 2919464427 | 2919462493 | Bacteria | 5817112 |
| 926 | 2919480809 | 2919476304 | Bacteria | 5888696 |
| 927 | 2928038602 | 2928037797 | Bacteria | 7273642 |
| 928 | 2928045793 | 2928044640 | Bacteria | 7271509 |
| 929 | 2928053410 | 2928051484 | Bacteria | 7773759 |
| 930 | 2928067015 | 2928064002 | Bacteria | 7419480 |
| 931 | 2928071086 | 2928070936 | Bacteria | 8062541 |
| 932 | 2928084972 | 2928084124 | Bacteria | 7159212 |
| 933 | 2928119752 | 2928115317 | Bacteria | 6477646 |
| 934 | 2929163773 | 2929160207 | Bacteria | 9075316 |
| 935 | 2929524915 | 2929520902 | Bacteria | 6765052 |
| 936 | 2945912432 | 2945909444 | Bacteria | 7065066 |
| 937 | 2945948342 | 2945945610 | Bacteria | 5951079 |
| 938 | 2945977017 | 2945972063 | Bacteria | 6086495 |
| 939 | 2945985250 | 2945984333 | Bacteria | 7358892 |
| 940 | 2954771993 | 2954767861 | Bacteria | 5535784 |
| 941 | 2974322718 | 2974320154 | Bacteria | 4571377 |
| 942 | 8006930500 | 8006926726 | Bacteria | 6749210 |
| 943 | Ga0207648_10246668 | |||
| 944 | JGI24741J21665_1000804 | |||
| 945 | JGI24740J21852_10000278 | |||
| 946 | JGI24740J21852_10001064 | |||
| 947 | JGI25155J39150_1000008 | |||
| 948 | JGI25156J39149_1000002 | |||
| 949 | JGI25156J39149_1012444 | |||
| 950 | JGI25156J39149_1012868 | |||
| 951 | JGI25154J39366_1000010 | |||
| 952 | JGI25154J39366_1000110 | |||
| 953 | JGI25154J39366_1003035 | |||
| 954 | JGI25157J39369_1000001 | |||
| 955 | JGI25157J39369_1000015 | |||
| 956 | JGI25150J39212_1003709 | |||
| 957 | JGI25159J45721_1001031 | |||
| 958 | JGI25159J45721_1003729 | |||
| 959 | JGI25151J46595_10007117 | |||
| 960 | JGI25160J50197_1000301 | |||
| 961 | JGI25161J50226_1000043 | |||
| 962 | JGI25161J50226_1004540 | |||
| 963 | Ga0055538_1002482 | |||
| 964 | Ga0055538_1002934 | |||
| 965 | Ga0055539_1000075 | |||
| 966 | Ga0055539_1000170 | |||
| 967 | Ga0055539_1001228 | |||
| 968 | Ga0055533_1000010 | |||
| 969 | Ga0055533_1001222 | |||
| 970 | Ga0055533_1002231 | |||
| 971 | Ga0055533_1002410 | |||
| 972 | Ga0055532_1000056 | |||
| 973 | Ga0055525_1000363 | |||
| 974 | Ga0055525_1001192 | |||
| 975 | Ga0055535_1000013 | |||
| 976 | Ga0055535_1000263 | |||
| 977 | Ga0055542_1000004 | |||
| 978 | Ga0055542_1001053 | |||
| 979 | Ga0055529_1000074 | |||
| 980 | Ga0055529_1000303 | |||
| 981 | Ga0055526_1004895 | |||
| 982 | Ga0055537_1000479 | |||
| 983 | Ga0055537_1001694 | |||
| 984 | Ga0055524_1000130 | |||
| 985 | Ga0055536_1004820 | |||
| 986 | Ga0055536_1005488 | |||
| 987 | Ga0055536_1008676 | |||
| 988 | Ga0055534_1001079 | |||
| 989 | Ga0055534_1001759 | |||
| 990 | Ga0055528_1000145 | |||
| 991 | Ga0055528_1003313 | |||
| 992 | Ga0055530_10000265 | |||
| 993 | Ga0055530_10007868 | |||
| 994 | Ga0055530_10013640 | |||
| 995 | Ga0055530_10016000 | |||
| 996 | Ga0055540_1000079 | |||
| 997 | Ga0055540_1004516 | |||
| 998 | Ga0055540_1005170 | |||
| 999 | Ga0055531_10002186 | |||
| 1000 | Ga0055531_10006273 | |||
| 1001 | Ga0055541_1000278 | |||
| 1002 | Ga0055541_1002512 | |||
| 1003 | Ga0055543_1000805 | |||
| 1004 | Ga0065714_10004198 | |||
| 1005 | Ga0070676_10003870 | |||
| 1006 | Ga0070676_10056245 | |||
| 1007 | Ga0070683_100003533 | |||
| 1008 | Ga0070683_100119340 | |||
| 1009 | Ga0070690_100019559 | |||
| 1010 | Ga0070690_100067862 | |||
| 1011 | Ga0070670_100003950 | |||
| 1012 | Ga0070670_100004715 | |||
| 1013 | Ga0070670_100014050 | |||
| 1014 | Ga0070670_100149804 | |||
| 1015 | Ga0068869_100017109 | |||
| 1016 | Ga0068869_100058068 | |||
| 1017 | Ga0068869_100101671 | |||
| 1018 | Ga0070666_10003561 | |||
| 1019 | Ga0070666_10062188 | |||
| 1020 | Ga0070680_100006104 | |||
| 1021 | Ga0068868_100001107 | |||
| 1022 | Ga0068868_100002281 | |||
| 1023 | Ga0068868_100012489 | |||
| 1024 | Ga0068868_100068762 | |||
| 1025 | Ga0070660_100008902 | |||
| 1026 | Ga0070660_100071336 | |||
| 1027 | Ga0070689_100017673 | |||
| 1028 | Ga0070661_100000154 | |||
| 1029 | Ga0070661_100005559 | |||
| 1030 | Ga0070668_100062585 | |||
| 1031 | Ga0070669_100038621 | |||
| 1032 | Ga0070669_100175811 | |||
| 1033 | Ga0070675_100002327 | |||
| 1034 | Ga0070675_100055711 | |||
| 1035 | Ga0070675_100068410 | |||
| 1036 | Ga0070675_100079092 | |||
| 1037 | Ga0070675_100217010 | |||
| 1038 | Ga0070671_100003169 | |||
| 1039 | Ga0070671_100006639 | |||
| 1040 | Ga0070674_100012531 | |||
| 1041 | Ga0070674_100094518 | |||
| 1042 | Ga0070673_100004435 | |||
| 1043 | Ga0070673_100007098 | |||
| 1044 | Ga0070673_100141301 | |||
| 1045 | Ga0070688_100008223 | |||
| 1046 | Ga0070688_100011876 | |||
| 1047 | Ga0070659_100072608 | |||
| 1048 | Ga0070667_100002446 | |||
| 1049 | Ga0070667_100045319 | |||
| 1050 | Ga0070667_100049466 | |||
| 1051 | Ga0070667_100057059 | |||
| 1052 | Ga0070713_100000260 | |||
| 1053 | Ga0070701_10000785 | |||
| 1054 | Ga0070711_100049030 | |||
| 1055 | Ga0070700_100005781 | |||
| 1056 | Ga0070663_100000002 | |||
| 1057 | Ga0070663_100043557 | |||
| 1058 | Ga0070678_100002072 | |||
| 1059 | Ga0070678_100004119 | |||
| 1060 | Ga0070678_100123478 | |||
| 1061 | Ga0070662_100162058 | |||
| 1062 | Ga0070681_10060581 | |||
| 1063 | Ga0068867_100004890 | |||
| 1064 | Ga0068867_100008662 | |||
| 1065 | Ga0068867_100021092 | |||
| 1066 | Ga0068867_100026104 | |||
| 1067 | Ga0068867_100084636 | |||
| 1068 | Ga0070698_100192809 | |||
| 1069 | Ga0070679_100008378 | |||
| 1070 | Ga0070684_100047479 | |||
| 1071 | Ga0070684_100144926 | |||
| 1072 | Ga0068853_100119887 | |||
| 1073 | Ga0070672_100001173 | |||
| 1074 | Ga0070672_100011477 | |||
| 1075 | Ga0070672_100021015 | |||
| 1076 | Ga0070672_100109306 | |||
| 1077 | Ga0070696_100112285 | |||
| 1078 | Ga0070696_100161684 | |||
| 1079 | Ga0070693_100001943 | |||
| 1080 | Ga0070693_100080148 | |||
| 1081 | Ga0070704_100032829 | |||
| 1082 | Ga0068855_100008864 | |||
| 1083 | Ga0068855_100023596 | |||
| 1084 | Ga0068855_100032986 | |||
| 1085 | Ga0068855_100211745 | |||
| 1086 | Ga0070664_100000004 | |||
| 1087 | Ga0070664_100001898 | |||
| 1088 | Ga0070664_100021981 | |||
| 1089 | Ga0070664_100024552 | |||
| 1090 | Ga0070664_100075463 | |||
| 1091 | Ga0068857_100011891 | |||
| 1092 | Ga0068857_100114094 | |||
| 1093 | Ga0068854_100000007 | |||
| 1094 | Ga0068854_100019412 | |||
| 1095 | Ga0068854_100046118 | |||
| 1096 | Ga0068854_100049539 | |||
| 1097 | Ga0068856_100000105 | |||
| 1098 | Ga0068856_100003075 | |||
| 1099 | Ga0068856_100045672 | |||
| 1100 | Ga0068856_100062489 | |||
| 1101 | Ga0070702_100026225 | |||
| 1102 | Ga0068852_100000657 | |||
| 1103 | Ga0068852_100001399 | |||
| 1104 | Ga0068852_100046435 | |||
| 1105 | Ga0068852_100071851 | |||
| 1106 | Ga0068852_100086172 | |||
| 1107 | Ga0068852_100220107 | |||
| 1108 | Ga0068859_100040590 | |||
| 1109 | Ga0068859_100103867 | |||
| 1110 | Ga0068859_100215420 | |||
| 1111 | Ga0068864_100002769 | |||
| 1112 | Ga0068864_100014646 | |||
| 1113 | Ga0068861_100009167 | |||
| 1114 | Ga0068851_10002400 | |||
| 1115 | Ga0068851_10004032 | |||
| 1116 | Ga0068851_10013011 | |||
| 1117 | Ga0068851_10014932 | |||
| 1118 | Ga0068863_100038522 | |||
| 1119 | Ga0068863_100082128 | |||
| 1120 | Ga0068863_100091842 | |||
| 1121 | Ga0068858_100002093 | |||
| 1122 | Ga0068858_100002948 | |||
| 1123 | Ga0068858_100006154 | |||
| 1124 | Ga0068858_100024262 | |||
| 1125 | Ga0068860_100147079 | |||
| 1126 | Ga0081455_10072235 | |||
| 1127 | Ga0081540_1025348 | |||
| 1128 | Ga0081540_1028320 | |||
| 1129 | Ga0075365_10006297 | |||
| 1130 | Ga0075363_100008202 | |||
| 1131 | Ga0075363_100027756 | |||
| 1132 | Ga0075364_10043684 | |||
| 1133 | Ga0075432_10008307 | |||
| 1134 | Ga0075362_10005224 | |||
| 1135 | Ga0075362_10013155 | |||
| 1136 | Ga0075362_10024609 | |||
| 1137 | Ga0075367_10038654 | |||
| 1138 | Ga0075366_10002236 | |||
| 1139 | Ga0075366_10015544 | |||
| 1140 | Ga0075366_10026976 | |||
| 1141 | Ga0075366_10141961 | |||
| 1142 | Ga0097621_100003706 | |||
| 1143 | Ga0097621_100043803 | |||
| 1144 | Ga0075370_10001173 | |||
| 1145 | Ga0075370_10003518 | |||
| 1146 | Ga0075370_10006457 | |||
| 1147 | Ga0075370_10017583 | |||
| 1148 | Ga0075370_10038206 | |||
| 1149 | Ga0075370_10038706 | |||
| 1150 | Ga0075370_10047214 | |||
| 1151 | Ga0075370_10067516 | |||
| 1152 | Ga0075370_10109081 | |||
| 1153 | Ga0068871_100007836 | |||
| 1154 | Ga0068871_100010284 | |||
| 1155 | Ga0068871_100041229 | |||
| 1156 | Ga0068871_100142682 | |||
| 1157 | Ga0075428_100007264 | |||
| 1158 | Ga0075428_100027967 | |||
| 1159 | Ga0075428_100126167 | |||
| 1160 | Ga0075431_100017842 | |||
| 1161 | Ga0075433_10056526 | |||
| 1162 | Ga0075434_100017636 | |||
| 1163 | Ga0075434_100108235 | |||
| 1164 | Ga0068865_100023267 | |||
| 1165 | Ga0068865_100077489 | |||
| 1166 | Ga0075436_100002487 | |||
| 1167 | Ga0097620_100040590 | |||
| 1168 | Ga0097620_100103873 | |||
| 1169 | Ga0097620_100215428 | |||
| 1170 | Ga0099826_10013779 | |||
| 1171 | Ga0075435_100009943 | |||
| 1172 | Ga0075435_100106905 | |||
| 1173 | Ga0099794_10007301 | |||
| 1174 | Ga0105244_10013167 | |||
| 1175 | Ga0105240_10008549 | |||
| 1176 | Ga0105240_10013136 | |||
| 1177 | Ga0105240_10027970 | |||
| 1178 | Ga0105240_10047106 | |||
| 1179 | Ga0105240_10056972 | |||
| 1180 | Ga0105240_10072570 | |||
| 1181 | Ga0105240_10278239 | |||
| 1182 | Ga0111539_10003794 | |||
| 1183 | Ga0111539_10076735 | |||
| 1184 | Ga0105245_10015781 | |||
| 1185 | Ga0105245_10029552 | |||
| 1186 | Ga0114129_10000191 | |||
| 1187 | Ga0105243_10001633 | |||
| 1188 | Ga0105243_10094247 | |||
| 1189 | Ga0105243_10114106 | |||
| 1190 | Ga0105243_10175915 | |||
| 1191 | Ga0105241_10029165 | |||
| 1192 | Ga0105242_10011209 | |||
| 1193 | Ga0105242_10014042 | |||
| 1194 | Ga0105242_10018794 | |||
| 1195 | Ga0105242_10095363 | |||
| 1196 | Ga0105248_10035562 | |||
| 1197 | Ga0105248_10061334 | |||
| 1198 | Ga0105248_10231613 | |||
| 1199 | Ga0105237_10011535 | |||
| 1200 | Ga0105238_10094296 | |||
| 1201 | Ga0105238_10122429 | |||
| 1202 | Ga0105249_10286037 | |||
| 1203 | Ga0105239_10064425 | |||
| 1204 | Ga0105246_10095577 | |||
| 1205 | Ga0157326_1001558 | |||
| 1206 | Ga0157373_10010719 | |||
| 1207 | Ga0157371_10000223 | |||
| 1208 | Ga0157371_10027203 | |||
| 1209 | Ga0157370_10000074 | |||
| 1210 | Ga0157369_10001333 | |||
| 1211 | Ga0157369_10002601 | |||
| 1212 | Ga0157369_10042171 | |||
| 1213 | Ga0157369_10044657 | |||
| 1214 | Ga0157369_10124864 | |||
| 1215 | Ga0157374_10027309 | |||
| 1216 | Ga0157374_10087099 | |||
| 1217 | Ga0157374_10106087 | |||
| 1218 | Ga0157378_10104692 | |||
| 1219 | Ga0163162_10028421 | |||
| 1220 | Ga0163162_10057090 | |||
| 1221 | Ga0163162_10181338 | |||
| 1222 | Ga0157372_10000085 | |||
| 1223 | Ga0157372_10003798 | |||
| 1224 | Ga0157372_10189877 | |||
| 1225 | Ga0157372_10215889 | |||
| 1226 | Ga0157375_10017231 | |||
| 1227 | Ga0157375_10070595 | |||
| 1228 | Ga0157375_10306790 | |||
| 1229 | Ga0163163_10008501 | |||
| 1230 | Ga0157380_10084084 | |||
| 1231 | Ga0182008_10003393 | |||
| 1232 | Ga0182008_10005698 | |||
| 1233 | Ga0157377_10002089 | |||
| 1234 | Ga0157377_10013626 | |||
| 1235 | Ga0157379_10034664 | |||
| 1236 | Ga0157379_10043161 | |||
| 1237 | Ga0157379_10248816 | |||
| 1238 | Ga0157376_10122217 | |||
| 1239 | Ga0182006_1000867 | |||
| 1240 | Ga0182006_1003465 | |||
| 1241 | Ga0182007_10006348 | |||
| 1242 | Ga0182007_10027387 | |||
| 1243 | Ga0183362_10001 | |||
| 1244 | Ga0163161_10001379 | |||
| 1245 | Ga0163161_10004878 | |||
| 1246 | Ga0154015_1416575 | |||
| 1247 | Ga0213872_10000029 | |||
| 1248 | Ga0213872_10000618 | |||
| 1249 | Ga0209435_100001 | |||
| 1250 | Ga0209784_100008 | |||
| 1251 | Ga0209784_100500 | |||
| 1252 | Ga0209784_101272 | |||
| 1253 | Ga0209566_100006 | |||
| 1254 | Ga0209566_100280 | |||
| 1255 | Ga0209566_102291 | |||
| 1256 | Ga0209674_100003 | |||
| 1257 | Ga0209674_100070 | |||
| 1258 | Ga0209674_100741 | |||
| 1259 | Ga0209672_100436 | |||
| 1260 | Ga0209672_101988 | |||
| 1261 | Ga0209672_102654 | |||
| 1262 | Ga0209147_100005 | |||
| 1263 | Ga0209147_100541 | |||
| 1264 | Ga0209563_100010 | |||
| 1265 | Ga0209563_100016 | |||
| 1266 | Ga0207427_100468 | |||
| 1267 | Ga0209258_100007 | |||
| 1268 | Ga0209258_100022 | |||
| 1269 | Ga0209258_100163 | |||
| 1270 | Ga0209258_100903 | |||
| 1271 | Ga0207425_1001500 | |||
| 1272 | Ga0209646_1000001 | |||
| 1273 | Ga0209646_1000016 | |||
| 1274 | Ga0209646_1000226 | |||
| 1275 | Ga0209026_1000001 | |||
| 1276 | Ga0209026_1000021 | |||
| 1277 | Ga0209026_1001650 | |||
| 1278 | Ga0209677_100008 | |||
| 1279 | Ga0209677_100106 | |||
| 1280 | Ga0209677_100480 | |||
| 1281 | Ga0209148_1000034 | |||
| 1282 | Ga0209148_1000051 | |||
| 1283 | Ga0209759_1000001 | |||
| 1284 | Ga0209759_1000025 | |||
| 1285 | Ga0209759_1000684 | |||
| 1286 | Ga0209759_1000939 | |||
| 1287 | Ga0209759_1001423 | |||
| 1288 | Ga0209759_1002409 | |||
| 1289 | Ga0209759_1019363 | |||
| 1290 | Ga0209129_1000023 | |||
| 1291 | Ga0209565_1000096 | |||
| 1292 | Ga0209565_1000288 | |||
| 1293 | Ga0209455_1000011 | |||
| 1294 | Ga0209455_1000059 | |||
| 1295 | Ga0209673_1000232 | |||
| 1296 | Ga0209673_1000838 | |||
| 1297 | Ga0209673_1004143 | |||
| 1298 | Ga0209673_1006206 | |||
| 1299 | Ga0209130_1000041 | |||
| 1300 | Ga0209130_1000113 | |||
| 1301 | Ga0209130_1000508 | |||
| 1302 | Ga0209130_1001465 | |||
| 1303 | Ga0209130_1002443 | |||
| 1304 | Ga0209130_1012728 | |||
| 1305 | Ga0209675_1000128 | |||
| 1306 | Ga0209675_1000276 | |||
| 1307 | Ga0209675_1002475 | |||
| 1308 | Ga0209675_1002568 | |||
| 1309 | Ga0209675_1003811 | |||
| 1310 | Ga0209676_1000005 | |||
| 1311 | Ga0209676_1000054 | |||
| 1312 | Ga0209676_1000418 | |||
| 1313 | Ga0209676_1000705 | |||
| 1314 | Ga0209676_1003053 | |||
| 1315 | Ga0209025_1000531 | |||
| 1316 | Ga0209025_1001493 | |||
| 1317 | Ga0209025_1003884 | |||
| 1318 | Ga0209025_1006696 | |||
| 1319 | Ga0209025_1014270 | |||
| 1320 | Ga0209025_1016285 | |||
| 1321 | Ga0209025_1020721 | |||
| 1322 | Ga0209025_1053271 | |||
| 1323 | Ga0209564_1000394 | |||
| 1324 | Ga0209564_1000912 | |||
| 1325 | Ga0209564_1001098 | |||
| 1326 | Ga0209564_1009461 | |||
| 1327 | Ga0209564_1021392 | |||
| 1328 | Ga0209758_1000064 | |||
| 1329 | Ga0209758_1004529 | |||
| 1330 | Ga0209050_1000007 | |||
| 1331 | Ga0209050_1000066 | |||
| 1332 | Ga0209050_1000570 | |||
| 1333 | Ga0209050_1000690 | |||
| 1334 | Ga0209050_1002949 | |||
| 1335 | Ga0209050_1016296 | |||
| 1336 | Ga0209050_1028547 | |||
| 1337 | Ga0209256_1000003 | |||
| 1338 | Ga0209256_1000020 | |||
| 1339 | Ga0209256_1000577 | |||
| 1340 | Ga0209256_1017307 | |||
| 1341 | Ga0207426_1000001 | |||
| 1342 | Ga0207426_1000031 | |||
| 1343 | Ga0207426_1000061 | |||
| 1344 | Ga0207426_1020654 | |||
| 1345 | Ga0209051_1000009 | |||
| 1346 | Ga0209051_1000044 | |||
| 1347 | Ga0209051_1000363 | |||
| 1348 | Ga0209051_1000385 | |||
| 1349 | Ga0209051_1000491 | |||
| 1350 | Ga0209051_1001856 | |||
| 1351 | Ga0209051_1001872 | |||
| 1352 | Ga0209051_1012913 | |||
| 1353 | Ga0209257_1000011 | |||
| 1354 | Ga0209257_1000032 | |||
| 1355 | Ga0209257_1000055 | |||
| 1356 | Ga0209257_1000082 | |||
| 1357 | Ga0209257_1000502 | |||
| 1358 | Ga0209257_1007175 | |||
| 1359 | Ga0209257_1017587 | |||
| 1360 | Ga0207697_10073410 | |||
| 1361 | Ga0207656_10002382 | |||
| 1362 | Ga0207656_10002699 | |||
| 1363 | Ga0207655_1001588 | |||
| 1364 | Ga0207688_10031734 | |||
| 1365 | Ga0207688_10079934 | |||
| 1366 | Ga0207680_10002745 | |||
| 1367 | Ga0207645_10045934 | |||
| 1368 | Ga0207705_10022746 | |||
| 1369 | Ga0207705_10066011 | |||
| 1370 | Ga0207695_10001193 | |||
| 1371 | Ga0207695_10021707 | |||
| 1372 | Ga0207695_10053129 | |||
| 1373 | Ga0207695_10057592 | |||
| 1374 | Ga0207695_10111600 | |||
| 1375 | Ga0207695_10119697 | |||
| 1376 | Ga0207671_10111753 | |||
| 1377 | Ga0207663_10076611 | |||
| 1378 | Ga0207657_10078012 | |||
| 1379 | Ga0207657_10158475 | |||
| 1380 | Ga0207649_10000573 | |||
| 1381 | Ga0207649_10002026 | |||
| 1382 | Ga0207649_10016787 | |||
| 1383 | Ga0207694_10018078 | |||
| 1384 | Ga0207650_10001127 | |||
| 1385 | Ga0207650_10008883 | |||
| 1386 | Ga0207650_10056820 | |||
| 1387 | Ga0207650_10124999 | |||
| 1388 | Ga0207659_10000725 | |||
| 1389 | Ga0207659_10005217 | |||
| 1390 | Ga0207659_10007325 | |||
| 1391 | Ga0207659_10023175 | |||
| 1392 | Ga0207659_10029587 | |||
| 1393 | Ga0207687_10041114 | |||
| 1394 | Ga0207700_10000189 | |||
| 1395 | Ga0207644_10003511 | |||
| 1396 | Ga0207644_10008443 | |||
| 1397 | Ga0207644_10034969 | |||
| 1398 | Ga0207644_10047418 | |||
| 1399 | Ga0207644_10068715 | |||
| 1400 | Ga0207690_10016369 | |||
| 1401 | Ga0207690_10067507 | |||
| 1402 | Ga0207690_10073921 | |||
| 1403 | Ga0207706_10025633 | |||
| 1404 | Ga0207706_10128246 | |||
| 1405 | Ga0207686_10013089 | |||
| 1406 | Ga0207686_10063141 | |||
| 1407 | Ga0207686_10063988 | |||
| 1408 | Ga0207709_10001604 | |||
| 1409 | Ga0207709_10021990 | |||
| 1410 | Ga0207670_10019227 | |||
| 1411 | Ga0207670_10029754 | |||
| 1412 | Ga0207669_10007934 | |||
| 1413 | Ga0207691_10001444 | |||
| 1414 | Ga0207691_10002459 | |||
| 1415 | Ga0207691_10009240 | |||
| 1416 | Ga0207691_10010513 | |||
| 1417 | Ga0207691_10093396 | |||
| 1418 | Ga0207711_10008783 | |||
| 1419 | Ga0207711_10011843 | |||
| 1420 | Ga0207711_10129756 | |||
| 1421 | Ga0207689_10015681 | |||
| 1422 | Ga0207689_10097636 | |||
| 1423 | Ga0207661_10007156 | |||
| 1424 | Ga0207661_10092462 | |||
| 1425 | Ga0207679_10000002 | |||
| 1426 | Ga0207679_10001704 | |||
| 1427 | Ga0207679_10007132 | |||
| 1428 | Ga0207667_10004568 | |||
| 1429 | Ga0207667_10009460 | |||
| 1430 | Ga0207667_10061375 | |||
| 1431 | Ga0207651_10002950 | |||
| 1432 | Ga0207651_10004833 | |||
| 1433 | Ga0207640_10017885 | |||
| 1434 | Ga0207640_10018533 | |||
| 1435 | Ga0207640_10027293 | |||
| 1436 | Ga0207640_10086378 | |||
| 1437 | Ga0207658_10025926 | |||
| 1438 | Ga0207658_10052793 | |||
| 1439 | Ga0207677_10003064 | |||
| 1440 | Ga0207677_10008356 | |||
| 1441 | Ga0207677_10026784 | |||
| 1442 | Ga0207677_10030189 | |||
| 1443 | Ga0207703_10001773 | |||
| 1444 | Ga0207703_10012670 | |||
| 1445 | Ga0207678_10000003 | |||
| 1446 | Ga0207708_10067958 | |||
| 1447 | Ga0207702_10000010 | |||
| 1448 | Ga0207702_10000522 | |||
| 1449 | Ga0207702_10036919 | |||
| 1450 | Ga0207702_10099499 | |||
| 1451 | Ga0207702_10107674 | |||
| 1452 | Ga0207702_10118365 | |||
| 1453 | Ga0207641_10019102 | |||
| 1454 | Ga0207641_10036585 | |||
| 1455 | Ga0207641_10162307 | |||
| 1456 | Ga0207641_10190351 | |||
| 1457 | Ga0207641_10222677 | |||
| 1458 | Ga0207648_10019713 | |||
| 1459 | Ga0207648_10024255 | |||
| 1460 | Ga0207648_10067748 | |||
| 1461 | Ga0207648_10075838 | |||
| 1462 | Ga0207648_10160568 | |||
| 1463 | Ga0207676_10001271 | |||
| 1464 | Ga0207676_10012287 | |||
| 1465 | Ga0207676_10020956 | |||
| 1466 | Ga0207676_10035333 | |||
| 1467 | Ga0207674_10023464 | |||
| 1468 | Ga0207674_10079210 | |||
| 1469 | Ga0207674_10107212 | |||
| 1470 | Ga0207674_10232195 | |||
| 1471 | Ga0207675_100018746 | |||
| 1472 | Ga0207675_100065898 | |||
| 1473 | Ga0207675_100079404 | |||
| 1474 | Ga0207675_100193442 | |||
| 1475 | Ga0207675_100267998 | |||
| 1476 | Ga0207683_10000838 | |||
| 1477 | Ga0207683_10005156 | |||
| 1478 | Ga0207683_10006290 | |||
| 1479 | Ga0207683_10015911 | |||
| 1480 | Ga0207683_10037520 | |||
| 1481 | Ga0207683_10039060 | |||
| 1482 | Ga0207683_10089575 | |||
| 1483 | Ga0207683_10129250 | |||
| 1484 | Ga0207698_10001250 | |||
| 1485 | Ga0207698_10009072 | |||
| 1486 | Ga0207698_10019512 | |||
| 1487 | Ga0207698_10052932 | |||
| 1488 | Ga0207698_10195860 | |||
| 1489 | Ga0207428_10001012 | |||
| 1490 | Ga0207428_10012148 | |||
| 1491 | Ga0268264_10137133 | |||
| 1492 | Ga0265337_1032774 | |||
| 1493 | Ga0265323_10003116 | |||
| 1494 | Ga0265323_10008205 | |||
| 1495 | Ga0265336_10000051 | |||
| 1496 | Ga0307515_10000028 | |||
| 1497 | Ga0307515_10000458 | |||
| 1498 | Ga0307515_10016545 | |||
| 1499 | Ga0307515_10048179 | |||
| 1500 | Ga0307515_10056923 | |||
| 1501 | Ga0307512_10055475 | |||
| 1502 | Ga0265325_10001972 | |||
| 1503 | Ga0265340_10000047 | |||
| 1504 | Ga0265331_10002871 | |||
| 1505 | Ga0265331_10031690 | |||
| 1506 | Ga0307513_10000021 | |||
| 1507 | Ga0307509_10000120 | |||
| 1508 | Ga0307509_10013526 | |||
| 1509 | Ga0307509_10060091 | |||
| 1510 | Ga0307509_10069501 | |||
| 1511 | Ga0307408_100000046 | |||
| 1512 | Ga0307408_100003007 | |||
| 1513 | Ga0307408_100047082 | |||
| 1514 | Ga0307408_100079883 | |||
| 1515 | Ga0307508_10000163 | |||
| 1516 | Ga0307508_10019292 | |||
| 1517 | Ga0307508_10023931 | |||
| 1518 | Ga0307514_10000828 | |||
| 1519 | Ga0307514_10046625 | |||
| 1520 | Ga0265314_10000007 | |||
| 1521 | Ga0265342_10001861 | |||
| 1522 | Ga0316576_10003935 | |||
| 1523 | Ga0307516_10018571 | |||
| 1524 | Ga0307516_10022115 | |||
| 1525 | Ga0307405_10049640 | |||
| 1526 | Ga0307413_10016958 | |||
| 1527 | Ga0307410_10056048 | |||
| 1528 | Ga0307406_10002339 | |||
| 1529 | Ga0307406_10008992 | |||
| 1530 | Ga0307406_10105266 | |||
| 1531 | Ga0307412_10000135 | |||
| 1532 | Ga0307412_10015988 | |||
| 1533 | Ga0307409_100010337 | |||
| 1534 | Ga0307416_100003363 | |||
| 1535 | Ga0307416_100017961 | |||
| 1536 | Ga0307416_100099633 | |||
| 1537 | Ga0307411_10011035 | |||
| 1538 | Ga0307411_10019119 | |||
| 1539 | Ga0307411_10040848 | |||
| 1540 | Ga0307415_100016744 | |||
| 1541 | Ga0307415_100023469 | |||
| 1542 | Ga0307510_10002394 | |||
| 1543 | Ga0307510_10018033 | |||
| 1544 | Ga0373926_0037748 | |||
| 1545 | Ga0373949_0004987 | |||
| 1546 | Ga0373923_0048720 | |||
| 1547 | Ga0373923_0067250 | |||
| 1548 | Ga0373939_0000139 | |||
| 1549 | Ga0373941_0013544 | |||
| 1550 | Ga0373945_0012903 | |||
| 1551 | Ga0373956_0000193 | |||
| 1552 | Ga0373931_0000908 | |||
| 1553 | Ga0373931_0004912 | |||
| 1554 | Ga0373927_0005732 | |||
| 1555 | Ga0373933_0000364 | |||
| 1556 | Ga0373937_0000182 | |||
| 1557 | Ga0373925_0045523 | |||
| 1558 | Ga0395899_0012470 | |||
| 1559 | Ga0395900_0003483 | |||
| 1560 | Ga0395898_0006685 | |||
| 1561 | Ga0395898_0010478 | |||
| 1562 | Ga0395905_0002802 | |||
| 1563 | Ga0395905_0018172 | |||
| 1564 | Ga0395905_0024518 | |||
| 1565 | Ga0395905_0029244 | |||
| 1566 | Ga0395905_0113031 | |||
| 1567 | Ga0395901_0015357 | |||
| 1568 | Ga0395901_0015454 | |||
| 1569 | Ga0395901_0022158 | |||
| 1570 | Ga0436361_0034352 | |||
| 1571 | Ga0436361_0625540 | |||
| 1572 | Ga0436363_0667407 | |||
| 1573 | Ga0439436_0007418 | |||
| 1574 | Ga0439436_0020373 | |||
| 1575 | Ga0451807_0675626 | |||
| 1576 | Ga0439445_0008291 | |||
| 1577 | Ga0439449_0008125 | |||
| 1578 | Ga0439449_0012578 | |||
| 1579 | Ga0439457_009413 | |||
| 1580 | Ga0450890_000536 | |||
| 1581 | Ga0450891_000192 | |||
| 1582 | Ga0439446_0019780 | |||
| 1583 | Ga0450893_0000214 | |||
| 1584 | Ga0451577_0000742 | |||
| 1585 | Ga0451577_0043187 | |||
| 1586 | Ga0451577_0085905 | |||
| 1587 | Ga0451577_0133455 | |||
| 1588 | Ga0466969_0000001 | |||
| 1589 | Ga0466969_0004528 | |||
| 1590 | Ga0466969_0016894 | |||
| 1591 | Ga0466972_0055407 | |||
| 1592 | Ga0466965_0004669 | |||
| 1593 | Ga0466966_0005235 | |||
| 1594 | Ga0466966_0006418 | |||
| 1595 | Ga0466961_0011024 | |||
| 1596 | Ga0466963_0008073 | |||
| 1597 | Ga0466964_0003328 | |||
| 1598 | Ga0466964_0004632 | |||
| 1599 | Ga0466964_0028165 | |||
| 1600 | Ga0453684_0000065 | |||
| 1601 | Ga0453684_0009901 | |||
| 1602 | Ga0466971_0004295 | |||
| 1603 | Ga0466970_0004172 | |||
| 1604 | Ga0466957_0014724 | |||
| 1605 | Ga0466957_0062297 | |||
| 1606 | Ga0466959_0000063 | |||
| 1607 | Ga0466959_0006014 | |||
| 1608 | Ga0466959_0026775 | |||
| 1609 | Ga0451576_0013881 | |||
| 1610 | Ga0451576_0044822 | |||
| 1611 | Ga0451576_0136973 | |||
| 1612 | Ga0466958_0004695 | |||
| 1613 | Ga0466958_0017953 | |||
| 1614 | Ga0466958_0018095 | |||
| 1615 | Ga0495617_012554 | |||
| 1616 | Ga0495617_038624 | |||
| 1617 | Ga0495592_0002422 | |||
| 1618 | Ga0495590_0010273 | |||
| 1619 | Ga0495629_0011897 | |||
| 1620 | Ga0495638_0002153 | |||
| 1621 | Ga0495638_0061966 | |||
| 1622 | Ga0495651_0000027 | |||
| 1623 | Ga0495580_0021078 | |||
| 1624 | Ga0495580_0028185 | |||
| 1625 | Ga0495582_0011400 | |||
| 1626 | Ga0495605_0001486 | |||
| 1627 | Ga0495639_0004066 | |||
| 1628 | Ga0495584_0000621 | |||
| 1629 | Ga0495585_0007084 | |||
| 1630 | Ga0495585_0056295 | |||
| 1631 | Ga0495585_0059195 | |||
| 1632 | Ga0495594_0002498 | |||
| 1633 | Ga0495583_0000016 | |||
| 1634 | Ga0495606_0002620 | |||
| 1635 | Ga0495616_0004257 | |||
| 1636 | Ga0495616_0005761 | |||
| 1637 | Ga0495616_0027002 | |||
| 1638 | Ga0495628_0005560 | |||
| 1639 | Ga0495628_0094618 | |||
| 1640 | Ga0495637_0045719 | |||
| 1641 | Ga0495637_0050812 | |||
| 1642 | Ga0495643_0003120 | |||
| 1643 | Ga0495648_0000593 | |||
| 1644 | Ga0495666_0064639 | |||
| 1645 | Ga0495652_0036854 | |||
| 1646 | Ga0495652_0071658 | |||
| 1647 | Ga0495665_0003964 | |||
| 1648 | Ga0495586_0090949 | |||
| 1649 | Ga0495587_0006273 | |||
| 1650 | Ga0495597_0004154 | |||
| 1651 | Ga0495597_0015616 | |||
| 1652 | Ga0495645_0002395 | |||
| 1653 | Ga0495622_0005439 | |||
| 1654 | Ga0495633_0002301 | |||
| 1655 | Ga0495633_0015720 | |||
| 1656 | Ga0495656_0000110 | |||
| 1657 | Ga0495668_0044647 | |||
| 1658 | Ga0495634_0019399 | |||
| 1659 | Ga0495611_0008728 | |||
| 1660 | Ga0495625_0002383 | |||
| 1661 | Ga0495625_0010249 | |||
| 1662 | Ga0495625_0080003 | |||
| 1663 | Ga0495635_0030188 | |||
| 1664 | Ga0495659_0007216 | |||
| 1665 | Ga0495661_0002005 | |||
| 1666 | Ga0495599_0000531 | |||
| 1667 | Ga0495599_0022849 | |||
| 1668 | Ga0495599_0140589 | |||
| 1669 | Ga0495623_0016524 | |||
| 1670 | Ga0495647_0011450 | |||
| 1671 | Ga0495658_0001699 | |||
| 1672 | Ga0495669_0025706 | |||
| 1673 | Ga0495670_0002770 | |||
| 1674 | Ga0495670_0005224 | |||
| 1675 | Ga0495671_0080841 | |||
| 1676 | Ga0495671_0111269 | |||
| 1677 | Ga0495581_0008234 | |||
| 1678 | Ga0495636_0000920 | |||
| 1679 | Ga0495672_0012407 | |||
| 1680 | Ga0495676_0012265 | |||
| 1681 | Ga0495676_0016453 | |||
| 1682 | Ga0495683_0006098 | |||
| 1683 | Ga0495687_000138 | |||
| 1684 | Ga0495687_006782 | |||
| 1685 | Ga0495687_025727 | |||
| 1686 | Ga0495677_0003212 | |||
| 1687 | Ga0495685_000219 | |||
| 1688 | Ga0495673_0000060 | |||
| 1689 | Ga0495684_0038078 | |||
| 1690 | Ga0495686_0006352 | |||
| 1691 | Ga0495593_0000759 | |||
| 1692 | Ga0495593_0011141 | |||
| 1693 | Ga0496100_0018668 | |||
| 1694 | Ga0496101_0061878 | |||
| 1695 | Ga0496101_0232980 | |||
| 1696 | Ga0496102_0071667 | |||
| 1697 | Ga0496102_0072781 | |||
| 1698 | Ga0496104_0040730 | |||
| 1699 | Ga0496105_0062478 | |||
| 1700 | Ga0496106_0023204 | |||
| 1701 | Ga0496107_0137097 | |||
| 1702 | Ga0496108_0040990 | |||
| 1703 | Ga0496108_0087964 | |||
| 1704 | Ga0496109_0024792 | |||
| 1705 | Ga0496109_0027408 | |||
| 1706 | Ga0496110_0004858 | |||
| 1707 | Ga0496110_0009425 | |||
| 1708 | Ga0496111_0032942 | |||
| 1709 | Ga0496111_0053081 | |||
| 1710 | Ga0496111_0086850 | |||
| 1711 | Ga0496112_0050038 | |||
| 1712 | Ga0496113_0146119 | |||
| 1713 | Ga0496115_0027971 | |||
| 1714 | Ga0496115_0066235 | |||
| 1715 | Ga0496116_0010521 | |||
| 1716 | Ga0496117_0025555 | |||
| 1717 | Ga0496119_0035106 | |||
| 1718 | Ga0496121_0000314 | |||
| 1719 | Ga0496121_0072459 | |||
| 1720 | Ga0496122_0000046 | |||
| 1721 | Ga0496122_0000217 | |||
| 1722 | Ga0496123_0000082 | |||
| 1723 | Ga0496123_0001126 | |||
| 1724 | Ga0496123_0022919 | |||
| 1725 | Ga0496124_0000038 | |||
| 1726 | Ga0496124_0057503 | |||
| 1727 | Ga0496125_0000028 | |||
| 1728 | Ga0496125_0000532 | |||
| 1729 | Ga0496125_0079036 | |||
| 1730 | Ga0495682_0002647 | |||
| 1731 | Ga0501034_0006242 | |||
| 1732 | Ga0501041_0172858 | |||
| 1733 | Ga0501042_0143664 | |||
| 1734 | Ga0501043_0156886 | |||
| 1735 | Ga0501047_0023913 | |||
| 1736 | Ga0501068_0067902 | |||
| 1737 | Ga0501069_0001500 | |||
| 1738 | Ga0501070_0003950 | |||
| 1739 | Ga0501072_0110293 | |||
| 1740 | Ga0501073_0000374 | |||
| 1741 | Ga0501073_0009188 | |||
| 1742 | Ga0501073_0019817 | |||
| 1743 | Ga0501074_0000125 | |||
| 1744 | Ga0501076_0025005 | |||
| 1745 | Ga0501198_000005 | |||
| 1746 | Ga0501222_000003 | |||
| 1747 | Ga0501079_0013497 | |||
| 1748 | Ga0501080_0001248 | |||
| 1749 | Ga0501080_0007975 | |||
| 1750 | Ga0501080_0039560 | |||
| 1751 | Ga0501083_0007469 | |||
| 1752 | Ga0501266_001164 | |||
| 1753 | Ga0501035_0067904 | |||
| 1754 | Ga0501035_0095951 | |||
| 1755 | nmdc:mga03683_20354_c1 | |||
| 1756 | nmdc:mga03683_22410_c1 | |||
| 1757 | nmdc:mga00v17_10232_c1 | |||
| 1758 | nmdc:mga00v17_48905_c1 | |||
| 1759 | nmdc:mga0k408_1565_c1 | |||
| 1760 | nmdc:mga0k408_26727_c1 | |||
| 1761 | nmdc:mga0k408_4867_c1 | |||
| 1762 | nmdc:mga0k408_6461_c1 | |||
| 1763 | nmdc:mga0k408_6553_c1 | |||
| 1764 | nmdc:mga0k408_76088_c1 | |||
| 1765 | nmdc:mga06z11_50874_c1 | |||
| 1766 | nmdc:mga07m45_18826_c1 | |||
| 1767 | nmdc:mga07m45_19735_c1 | |||
| 1768 | nmdc:mga07m45_202_c1 | |||
| 1769 | nmdc:mga07m45_21064_c1 | |||
| 1770 | nmdc:mga07m45_2832_c1 | |||
| 1771 | nmdc:mga07m45_43302_c1 | |||
| 1772 | nmdc:mga07m45_61657_c1 | |||
| 1773 | nmdc:mga07m45_716_c1 | |||
| 1774 | nmdc:mga07m45_8065_c1 | |||
| 1775 | nmdc:mga05p37_109213_c1 | |||
| 1776 | nmdc:mga0qj67_172497_c1 | |||
| 1777 | nmdc:mga0qj67_61514_c1 | |||
| 1778 | nmdc:mga06r32_704_c1 | |||
| 1779 | nmdc:mga08y16_59229_c1 | |||
| 1780 | nmdc:mga08y16_7529_c1 | |||
| 1781 | nmdc:mga0n895_13563_c1 | |||
| 1782 | nmdc:mga0rr50_11608_c1 | |||
| 1783 | nmdc:mga0rr50_119039_c1 | |||
| 1784 | nmdc:mga0rr50_33844_c1 | |||
| 1785 | nmdc:mga0rr50_7922_c1 | |||
| 1786 | nmdc:mga08x19_118322_c1 | |||
| 1787 | nmdc:mga08x19_9403_c1 | |||
| 1788 | nmdc:mga0a205_95540_c1 | |||
| 1789 | Ga0495601_0000822 | |||
| 1790 | Ga0500610_0000344 | |||
| 1791 | Ga0500610_0020666 | |||
| 1792 | Ga0500635_0000145 | |||
| 1793 | Ga0500651_0000353 | |||
| 1794 | Ga0500566_0000008 | |||
| 1795 | Ga0500562_004134 | |||
| 1796 | Ga0500569_000840 | |||
| 1797 | Ga0500572_001770 | |||
| 1798 | Ga0500614_003737 | |||
| 1799 | Ga0500652_035527 | |||
| 1800 | Ga0500559_0000011 | |||
| 1801 | Ga0500568_0005309 | |||
| 1802 | Ga0500600_0030483 | |||
| 1803 | Ga0500603_000040 | |||
| 1804 | Ga0500639_000010 | |||
| 1805 | Ga0500636_0034879 | |||
| 1806 | Ga0500637_0024809 | |||
| 1807 | Ga0500645_000274 | |||
| 1808 | Ga0500645_003458 | |||
| 1809 | Ga0587072_001478 | |||
| 1810 | Ga0466962_0008617 | |||
| 1811 | 2511245553 | |||
| 1812 | 2513227406 | |||
| 1813 | 2513874577 | |||
| 1814 | 2513894527 | |||
| 1815 | 2524610238 | |||
| 1816 | 2548498292 | |||
| 1817 | 2548849106 | |||
| 1818 | 2599446114 | |||
| 1819 | 2599624514 | |||
| 1820 | 2599672624 | |||
| 1821 | 2599683624 | |||
| 1822 | 2599694233 | |||
| 1823 | 2643745913 | |||
| 1824 | 2643789322 | |||
| 1825 | 2643862684 | |||
| 1826 | 2643980310 | |||
| 1827 | 2644062964 | |||
| 1828 | 2644070647 | |||
| 1829 | 2644121910 | |||
| 1830 | 2644163167 | |||
| 1831 | 2644220868 | |||
| 1832 | 2644259689 | |||
| 1833 | 2644287379 | |||
| 1834 | 2644304754 | |||
| 1835 | 2644328078 | |||
| 1836 | 2644338114 | |||
| 1837 | 2644398613 | |||
| 1838 | 2644648826 | |||
| 1839 | 2738720186 | |||
| 1840 | 2738881730 | |||
| 1841 | 2739057284 | |||
| 1842 | 2739243723 | |||
| 1843 | 2739279385 | |||
| 1844 | 2774870257 | |||
| 1845 | 2805916573 | |||
| 1846 | 2809032376 | |||
| 1847 | 2816472553 | |||
| 1848 | 2819595927 | |||
| 1849 | 2831266924 | |||
| 1850 | 2838056983 | |||
| 1851 | 2842678798 | |||
| 1852 | 2842720292 | |||
| 1853 | 2842735547 | |||
| 1854 | 2842751360 | |||
| 1855 | 2857542486 | |||
| 1856 | 2857544781 | |||
| 1857 | 2884299549 | |||
| 1858 | 2885192848 | |||
| 1859 | 2885199021 | |||
| 1860 | 2885212716 | |||
| 1861 | 2885266755 | |||
| 1862 | 2899925275 | |||
| 1863 | 2904456432 | |||
| 1864 | 2904460705 | |||
| 1865 | 2904480318 | |||
| 1866 | 2904548380 | |||
| 1867 | 2919464427 | |||
| 1868 | 2919480809 | |||
| 1869 | 2928038602 | |||
| 1870 | 2928045793 | |||
| 1871 | 2928053410 | |||
| 1872 | 2928067015 | |||
| 1873 | 2928071086 | |||
| 1874 | 2928084972 | |||
| 1875 | 2928119752 | |||
| 1876 | 2929163773 | |||
| 1877 | 2929524915 | |||
| 1878 | 2945912432 | |||
| 1879 | 2945948342 | |||
| 1880 | 2945977017 | |||
| 1881 | 2945985250 | |||
| 1882 | 2954771993 | |||
| 1883 | 2974322718 | |||
| 1884 | 8006930500 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tv2-assembly1.cif.gz_A | structure of a class ii fumarate hydratase from burkholderia pseudomallei | 0.9808 | 4 | 460 |
| 6os7-assembly1.cif.gz_A-2 | e. coli fumarase mutant - r126a | 0.9807 | 2 | 460 |
| 6nz9-assembly1.cif.gz_B | crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution | 0.9806 | 2 | 460 |
| 6nz9-assembly1.cif.gz_A-2 | crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution | 0.9803 | 2 | 460 |
| 6nzc-assembly1.cif.gz_B-2 | crystal structure of e. coli fumarase c n326a variant with closed ss loop at 1.40 angstrom resolution | 0.98 | 2 | 460 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fuoB03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 1.006 | 408 | 456 | 1.10.40.30 |
| 3tv2A03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 1.003 | 408 | 460 | 1.10.40.30 |
| 5uppB03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 1.001 | 408 | 458 | 1.10.40.30 |
| 3e04D03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 1.001 | 408 | 458 | 1.10.40.30 |
| 5uppA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 1 | 408 | 458 | 1.10.40.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447KZK2-F1-model_v4 | fumarate hydratase (EC 4.2.1.2) | 0.9948 | 3 | 224 |
GO:0004333
GO:0006099 GO:0006106 GO:0006108 |
| AF-A0A383EM57-F1-model_v4 | Fumarate lyase N-terminal domain-containing protein | 0.9899 | 4 | 112 |
GO:0005829
GO:0006531 GO:0008797 |
| AF-A0A828RS23-F1-model_v4 | deleted | 0.9859 | 1 | 207 |
|
| AF-A0A128FKB9-F1-model_v4 | Fumarate hydratase class II (EC 4.2.1.2) | 0.985 | 3 | 164 |
GO:0004333
GO:0006106 |
| AF-A0A0U1SEZ2-F1-model_v4 | fumarate hydratase (EC 4.2.1.2) | 0.9836 | 3 | 212 |
GO:0004333
GO:0005739 GO:0006099 GO:0006106 GO:0006108 |