F486368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 321 | 1880 | 348 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0004429|Ga0495650_0004429_3548_4762 |
| Length | 404 |
| Sequence | MLPVIIATELLQGYFLILYRSLVHYKKNAHQRGASGNYFIMRADPLNRLTMTSSPSRFGAISEAAVDLAARNLRDTLAIAIEHRAPQAALIVYDTQTDLNRALTEAYRRAAPDAQFIDFDATTPELILATFERMQAGDLVVLVQSTSFRMDAYRIRIELFKRGLKVIEHVHLSRMPDEQGLHYIDSLAYDPAYYRGVGHALKARIDSAQRGVVDSGDGAQLVFASPFESAKLNIGDYSGMNNIGGQFPLGEVFTEARDLEAVSGRARIFVFGDTKFLVNRPETPITIIVDKGRVVGTENSTPEFENMLSIIREHEGEVWLRELGFGMNRAFSRERMVDDIGTYERMCGIHLSLGAKHGVYTKPQLKRKDARYHIDVFAVTEGVYLDEQRVYRNGAWEIDNLPRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 64 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 65 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 112 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 117 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 118 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 142 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 143 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 277 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 282 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 285 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 288 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 289 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 290 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 291 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 292 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 293 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 294 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 295 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 296 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 297 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 298 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 299 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 300 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 301 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 302 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 303 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 304 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 305 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 306 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 307 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 308 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 309 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 310 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 311 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 312 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 313 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 314 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 315 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 316 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 317 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 318 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 319 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 320 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 321 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.28 |
| Metatranscriptomes | 0 |
| Isolates | 3.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.53 |
| Nodule | 0.42 |
| Rhizoplane | 2.87 |
| Rhizosphere | 75.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495650_0004429 | 3300046471 | Bacteria | 9620 |
| 2 | JGI25155J39150_1000076 | 3300002704 | Bacteria | 59158 |
| 3 | JGI25155J39150_1000101 | 3300002704 | Bacteria | 45881 |
| 4 | JGI25156J39149_1000032 | 3300002705 | Bacteria | 118609 |
| 5 | JGI25162J39368_1000025 | 3300002737 | Bacteria | 228879 |
| 6 | JGI25162J39368_1000263 | 3300002737 | Bacteria | 50433 |
| 7 | JGI25162J39368_1004561 | 3300002737 | Bacteria | 3153 |
| 8 | JGI25154J39366_1000095 | 3300002738 | Bacteria | 79187 |
| 9 | JGI25154J39366_1000123 | 3300002738 | Bacteria | 61878 |
| 10 | JGI25158J39367_1000321 | 3300002739 | Bacteria | 10616 |
| 11 | JGI25158J39367_1000929 | 3300002739 | Bacteria | 5435 |
| 12 | JGI25157J39369_1000388 | 3300002741 | Bacteria | 30373 |
| 13 | JGI25152J39213_1000031 | 3300002773 | Bacteria | 96812 |
| 14 | JGI25152J39213_1008059 | 3300002773 | Bacteria | 2654 |
| 15 | JGI25150J39212_1000470 | 3300002774 | Bacteria | 17597 |
| 16 | JGI25150J39212_1001102 | 3300002774 | Bacteria | 8144 |
| 17 | JGI25159J45721_1000552 | 3300002987 | Bacteria | 16976 |
| 18 | JGI25165J46597_1000054 | 3300003214 | Bacteria | 228891 |
| 19 | rootL2_10010806 | 3300003322 | Bacteria | 12609 |
| 20 | rootL2_10022331 | 3300003322 | Bacteria | 8575 |
| 21 | rootL2_10120913 | 3300003322 | Bacteria | 3506 |
| 22 | rootH1_10216592 | 3300003323 | Bacteria | 11634 |
| 23 | JGI25160J50197_1001448 | 3300003354 | Bacteria | 11859 |
| 24 | JGI25161J50226_1000465 | 3300003374 | Bacteria | 18592 |
| 25 | JGI25161J50226_1002791 | 3300003374 | Bacteria | 4297 |
| 26 | Ga0055538_1000026 | 3300003751 | Bacteria | 228891 |
| 27 | Ga0055539_1000033 | 3300003752 | Bacteria | 228891 |
| 28 | Ga0055533_1000044 | 3300003756 | Bacteria | 228891 |
| 29 | Ga0055532_1000083 | 3300003758 | Bacteria | 118609 |
| 30 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 31 | Ga0055525_1000052 | 3300003759 | Bacteria | 228891 |
| 32 | Ga0055529_1000545 | 3300003763 | Bacteria | 32103 |
| 33 | Ga0055526_1000020 | 3300003771 | Bacteria | 188230 |
| 34 | Ga0055526_1000031 | 3300003771 | Bacteria | 143136 |
| 35 | Ga0055526_1000908 | 3300003771 | Bacteria | 22003 |
| 36 | Ga0055526_1004472 | 3300003771 | Bacteria | 8383 |
| 37 | Ga0055537_1000071 | 3300003773 | Bacteria | 73402 |
| 38 | Ga0055537_1004385 | 3300003773 | Bacteria | 4044 |
| 39 | Ga0055537_1007058 | 3300003773 | Bacteria | 2762 |
| 40 | Ga0055537_1008471 | 3300003773 | Bacteria | 2371 |
| 41 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 42 | Ga0055524_1000560 | 3300003775 | Bacteria | 27934 |
| 43 | Ga0055524_1001529 | 3300003775 | Bacteria | 13077 |
| 44 | Ga0055524_1005186 | 3300003775 | Bacteria | 5868 |
| 45 | Ga0055534_1000452 | 3300003784 | Bacteria | 23968 |
| 46 | Ga0055534_1000864 | 3300003784 | Bacteria | 13883 |
| 47 | Ga0055534_1004846 | 3300003784 | Bacteria | 3766 |
| 48 | Ga0055528_1000537 | 3300003790 | Bacteria | 29135 |
| 49 | Ga0055528_1017213 | 3300003790 | Bacteria | 2516 |
| 50 | Ga0055530_10001313 | 3300003791 | Bacteria | 18696 |
| 51 | Ga0055530_10001696 | 3300003791 | Bacteria | 15599 |
| 52 | Ga0055530_10004892 | 3300003791 | Bacteria | 6661 |
| 53 | Ga0055531_10003437 | 3300003794 | Bacteria | 10103 |
| 54 | Ga0055541_1000069 | 3300003841 | Bacteria | 94648 |
| 55 | Ga0055543_1000222 | 3300004625 | Bacteria | 45583 |
| 56 | Ga0065165_1000710 | 3300005262 | Bacteria | 47150 |
| 57 | Ga0065165_1000754 | 3300005262 | Bacteria | 44059 |
| 58 | Ga0065165_1002020 | 3300005262 | Bacteria | 18897 |
| 59 | Ga0065165_1015133 | 3300005262 | Bacteria | 2957 |
| 60 | Ga0070658_10006027 | 3300005327 | Bacteria | 9838 |
| 61 | Ga0070666_10001066 | 3300005335 | Bacteria | 16749 |
| 62 | Ga0070680_100418778 | 3300005336 | Bacteria | 1143 |
| 63 | Ga0070682_100055362 | 3300005337 | Bacteria | 2491 |
| 64 | Ga0070689_100000042 | 3300005340 | Bacteria | 79383 |
| 65 | Ga0070688_100007002 | 3300005365 | Bacteria | 6061 |
| 66 | Ga0070672_100003675 | 3300005543 | Bacteria | 9971 |
| 67 | Ga0068855_100000016 | 3300005563 | Bacteria | 222591 |
| 68 | Ga0068855_100015153 | 3300005563 | Bacteria | 9284 |
| 69 | Ga0068855_100056433 | 3300005563 | Bacteria | 4608 |
| 70 | Ga0068855_100121150 | 3300005563 | Bacteria | 2994 |
| 71 | Ga0068855_100217134 | 3300005563 | Bacteria | 2146 |
| 72 | Ga0070664_100133740 | 3300005564 | Bacteria | 2179 |
| 73 | Ga0068857_100113744 | 3300005577 | Bacteria | 2434 |
| 74 | Ga0068854_100245784 | 3300005578 | Bacteria | 1427 |
| 75 | Ga0068856_100197863 | 3300005614 | Bacteria | 2024 |
| 76 | Ga0075365_10073780 | 3300006038 | Bacteria | 2300 |
| 77 | Ga0075362_10061128 | 3300006177 | Bacteria | 1704 |
| 78 | Ga0075434_100421232 | 3300006871 | Bacteria | 1356 |
| 79 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 80 | Ga0105244_10004609 | 3300009036 | Bacteria | 9436 |
| 81 | Ga0105240_10000952 | 3300009093 | Bacteria | 51588 |
| 82 | Ga0105240_10001988 | 3300009093 | Bacteria | 33782 |
| 83 | Ga0105240_10008537 | 3300009093 | Bacteria | 14639 |
| 84 | Ga0105245_10000332 | 3300009098 | Bacteria | 44503 |
| 85 | Ga0105243_10010095 | 3300009148 | Bacteria | 7182 |
| 86 | Ga0105241_10033948 | 3300009174 | Bacteria | 3832 |
| 87 | Ga0105248_10612817 | 3300009177 | Bacteria | 1228 |
| 88 | Ga0105237_10000050 | 3300009545 | Bacteria | 160580 |
| 89 | Ga0105237_10234803 | 3300009545 | Bacteria | 1835 |
| 90 | Ga0105238_10011438 | 3300009551 | Bacteria | 8938 |
| 91 | Ga0105238_10026479 | 3300009551 | Bacteria | 5913 |
| 92 | Ga0105239_10014685 | 3300010375 | Bacteria | 8685 |
| 93 | Ga0157373_10025853 | 3300013100 | Bacteria | 4243 |
| 94 | Ga0157373_10041267 | 3300013100 | Bacteria | 3301 |
| 95 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 96 | Ga0157376_10098876 | 3300014969 | Bacteria | 2544 |
| 97 | Ga0157376_10128880 | 3300014969 | Bacteria | 2255 |
| 98 | Ga0182006_1000014 | 3300015261 | Bacteria | 340159 |
| 99 | Ga0182006_1000044 | 3300015261 | Bacteria | 197442 |
| 100 | Ga0182006_1003369 | 3300015261 | Bacteria | 8209 |
| 101 | Ga0182007_10000011 | 3300015262 | Bacteria | 264045 |
| 102 | Ga0182007_10001225 | 3300015262 | Bacteria | 13942 |
| 103 | Ga0182005_1000014 | 3300015265 | Bacteria | 389763 |
| 104 | Ga0182005_1000018 | 3300015265 | Bacteria | 324307 |
| 105 | Ga0182005_1000540 | 3300015265 | Bacteria | 19079 |
| 106 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 107 | Ga0213872_10000269 | 3300021361 | Bacteria | 44994 |
| 108 | Ga0213872_10000485 | 3300021361 | Bacteria | 31868 |
| 109 | Ga0213875_10070975 | 3300021388 | Bacteria | 1626 |
| 110 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 111 | Ga0209435_100072 | 3300025206 | Bacteria | 60184 |
| 112 | Ga0209436_100375 | 3300025208 | Bacteria | 20163 |
| 113 | Ga0209436_101106 | 3300025208 | Bacteria | 10036 |
| 114 | Ga0209436_111218 | 3300025208 | Bacteria | 1588 |
| 115 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 116 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 117 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 118 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 119 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 120 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 121 | Ga0207427_100721 | 3300025231 | Bacteria | 15423 |
| 122 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 123 | Ga0209437_100317 | 3300025233 | Bacteria | 63136 |
| 124 | Ga0209437_105114 | 3300025233 | Bacteria | 2252 |
| 125 | Ga0209258_100542 | 3300025242 | Bacteria | 34693 |
| 126 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 127 | Ga0207425_1000060 | 3300025245 | Bacteria | 139031 |
| 128 | Ga0207425_1000587 | 3300025245 | Bacteria | 21270 |
| 129 | Ga0207425_1000620 | 3300025245 | Bacteria | 20287 |
| 130 | Ga0209646_1000021 | 3300025246 | Bacteria | 461083 |
| 131 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 132 | Ga0209646_1000117 | 3300025246 | Bacteria | 150025 |
| 133 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 134 | Ga0209026_1001718 | 3300025250 | Bacteria | 9125 |
| 135 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 136 | Ga0209148_1001432 | 3300025254 | Bacteria | 12171 |
| 137 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 138 | Ga0209759_1000324 | 3300025256 | Bacteria | 63074 |
| 139 | Ga0209129_1000093 | 3300025258 | Bacteria | 173163 |
| 140 | Ga0209129_1004595 | 3300025258 | Bacteria | 5300 |
| 141 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 142 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 143 | Ga0209565_1001517 | 3300025263 | Bacteria | 10059 |
| 144 | Ga0209565_1001525 | 3300025263 | Bacteria | 9991 |
| 145 | Ga0209565_1001608 | 3300025263 | Bacteria | 9549 |
| 146 | Ga0209565_1002784 | 3300025263 | Bacteria | 6056 |
| 147 | Ga0209565_1004583 | 3300025263 | Bacteria | 4172 |
| 148 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 149 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 150 | Ga0209130_1000044 | 3300025284 | Bacteria | 241110 |
| 151 | Ga0209130_1000474 | 3300025284 | Bacteria | 41406 |
| 152 | Ga0209130_1002300 | 3300025284 | Bacteria | 9802 |
| 153 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 154 | Ga0209675_1013731 | 3300025291 | Bacteria | 2510 |
| 155 | Ga0209025_1003213 | 3300025294 | Bacteria | 15832 |
| 156 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 157 | Ga0209564_1000064 | 3300025295 | Bacteria | 316431 |
| 158 | Ga0209564_1000134 | 3300025295 | Bacteria | 188346 |
| 159 | Ga0209564_1003660 | 3300025295 | Bacteria | 10166 |
| 160 | Ga0209564_1022596 | 3300025295 | Bacteria | 2216 |
| 161 | Ga0209758_1000055 | 3300025297 | Bacteria | 336183 |
| 162 | Ga0209050_1000085 | 3300025298 | Bacteria | 263219 |
| 163 | Ga0209050_1000092 | 3300025298 | Bacteria | 252702 |
| 164 | Ga0209050_1000465 | 3300025298 | Bacteria | 71894 |
| 165 | Ga0209050_1000552 | 3300025298 | Bacteria | 61721 |
| 166 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 167 | Ga0209256_1000080 | 3300025299 | Bacteria | 224592 |
| 168 | Ga0209256_1002537 | 3300025299 | Bacteria | 14619 |
| 169 | Ga0207426_1002592 | 3300025302 | Bacteria | 11226 |
| 170 | Ga0207426_1036384 | 3300025302 | Bacteria | 1565 |
| 171 | Ga0209051_1024832 | 3300025303 | Bacteria | 2455 |
| 172 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 173 | Ga0209257_1002123 | 3300025304 | Bacteria | 20708 |
| 174 | Ga0207680_10015242 | 3300025903 | Bacteria | 4006 |
| 175 | Ga0207705_10005294 | 3300025909 | Bacteria | 9653 |
| 176 | Ga0207705_10012419 | 3300025909 | Bacteria | 6154 |
| 177 | Ga0207705_10292566 | 3300025909 | Bacteria | 1248 |
| 178 | Ga0207695_10000896 | 3300025913 | Bacteria | 53929 |
| 179 | Ga0207695_10007805 | 3300025913 | Bacteria | 13543 |
| 180 | Ga0207695_10009905 | 3300025913 | Bacteria | 11712 |
| 181 | Ga0207671_10000498 | 3300025914 | Bacteria | 53330 |
| 182 | Ga0207657_10020139 | 3300025919 | Bacteria | 6312 |
| 183 | Ga0207652_10001329 | 3300025921 | Bacteria | 21947 |
| 184 | Ga0207652_10063648 | 3300025921 | Bacteria | 3190 |
| 185 | Ga0207694_10170095 | 3300025924 | Bacteria | 1764 |
| 186 | Ga0207687_10001406 | 3300025927 | Bacteria | 16426 |
| 187 | Ga0207670_10000058 | 3300025936 | Bacteria | 79241 |
| 188 | Ga0207691_10001913 | 3300025940 | Bacteria | 20336 |
| 189 | Ga0207667_10000206 | 3300025949 | Bacteria | 83657 |
| 190 | Ga0207667_10014671 | 3300025949 | Bacteria | 8921 |
| 191 | Ga0207667_10131487 | 3300025949 | Bacteria | 2578 |
| 192 | Ga0207678_10125945 | 3300026067 | Bacteria | 2185 |
| 193 | Ga0207702_10262766 | 3300026078 | Bacteria | 1626 |
| 194 | Ga0207648_10261934 | 3300026089 | Bacteria | 1543 |
| 195 | Ga0207674_10060727 | 3300026116 | Bacteria | 3822 |
| 196 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 197 | Ga0265334_10012951 | 3300028573 | Bacteria | 3499 |
| 198 | Ga0265334_10074724 | 3300028573 | Bacteria | 1257 |
| 199 | Ga0265318_10000068 | 3300028577 | Bacteria | 101168 |
| 200 | Ga0265318_10000128 | 3300028577 | Bacteria | 69731 |
| 201 | Ga0265318_10011384 | 3300028577 | Bacteria | 3832 |
| 202 | Ga0265338_10000560 | 3300028800 | Bacteria | 65231 |
| 203 | Ga0265324_10037833 | 3300029957 | Bacteria | 1676 |
| 204 | Ga0316177_1137694 | 3300030731 | Bacteria | 6716 |
| 205 | Ga0316182_1150583 | 3300030745 | Bacteria | 2108 |
| 206 | Ga0265330_10000031 | 3300031235 | Bacteria | 132487 |
| 207 | Ga0265330_10000064 | 3300031235 | Bacteria | 93262 |
| 208 | Ga0265332_10000135 | 3300031238 | Bacteria | 60723 |
| 209 | Ga0265332_10004292 | 3300031238 | Bacteria | 6726 |
| 210 | Ga0265328_10002328 | 3300031239 | Bacteria | 8567 |
| 211 | Ga0265328_10021506 | 3300031239 | Bacteria | 2460 |
| 212 | Ga0265328_10043212 | 3300031239 | Unclassified | 1658 |
| 213 | Ga0265320_10000028 | 3300031240 | Bacteria | 160699 |
| 214 | Ga0265320_10005243 | 3300031240 | Bacteria | 8355 |
| 215 | Ga0265329_10005947 | 3300031242 | Bacteria | 4886 |
| 216 | Ga0265339_10069269 | 3300031249 | Bacteria | 1883 |
| 217 | Ga0265331_10000023 | 3300031250 | Bacteria | 236483 |
| 218 | Ga0265331_10001382 | 3300031250 | Bacteria | 17843 |
| 219 | Ga0265331_10004725 | 3300031250 | Bacteria | 8428 |
| 220 | Ga0265327_10000077 | 3300031251 | Bacteria | 211850 |
| 221 | Ga0265327_10022547 | 3300031251 | Bacteria | 3758 |
| 222 | Ga0265316_10000898 | 3300031344 | Bacteria | 32585 |
| 223 | Ga0307408_100000094 | 3300031548 | Bacteria | 97519 |
| 224 | Ga0307408_100001672 | 3300031548 | Bacteria | 16328 |
| 225 | Ga0307408_100002920 | 3300031548 | Bacteria | 11845 |
| 226 | Ga0265313_10000126 | 3300031595 | Bacteria | 76903 |
| 227 | Ga0265313_10014039 | 3300031595 | Bacteria | 4767 |
| 228 | Ga0265313_10018286 | 3300031595 | Bacteria | 3942 |
| 229 | Ga0265314_10000176 | 3300031711 | Bacteria | 94482 |
| 230 | Ga0265314_10001620 | 3300031711 | Bacteria | 24671 |
| 231 | Ga0265342_10002741 | 3300031712 | Bacteria | 14988 |
| 232 | Ga0265342_10020905 | 3300031712 | Bacteria | 4186 |
| 233 | Ga0307518_10012873 | 3300031838 | Bacteria | 5972 |
| 234 | Ga0307414_10064118 | 3300032004 | Bacteria | 2614 |
| 235 | Ga0395899_0000141 | 3300037312 | Bacteria | 109773 |
| 236 | Ga0395899_0005393 | 3300037312 | Bacteria | 9936 |
| 237 | Ga0395899_0011729 | 3300037312 | Bacteria | 6708 |
| 238 | Ga0395899_0025446 | 3300037312 | Bacteria | 4468 |
| 239 | Ga0395899_0042408 | 3300037312 | Bacteria | 3396 |
| 240 | Ga0395900_0012739 | 3300037418 | Bacteria | 8594 |
| 241 | Ga0395900_0020227 | 3300037418 | Bacteria | 6792 |
| 242 | Ga0395900_0021953 | 3300037418 | Bacteria | 6526 |
| 243 | Ga0395900_0035468 | 3300037418 | Bacteria | 5137 |
| 244 | Ga0395900_0047375 | 3300037418 | Bacteria | 4425 |
| 245 | Ga0395900_0098175 | 3300037418 | Bacteria | 3009 |
| 246 | Ga0395900_0104040 | 3300037418 | Bacteria | 2916 |
| 247 | Ga0395900_0173691 | 3300037418 | Bacteria | 2192 |
| 248 | Ga0395900_0420440 | 3300037418 | Bacteria | 1297 |
| 249 | Ga0395898_0038830 | 3300037466 | Bacteria | 4715 |
| 250 | Ga0395898_0097514 | 3300037466 | Bacteria | 2823 |
| 251 | Ga0395898_0289478 | 3300037466 | Bacteria | 1562 |
| 252 | Ga0395905_0050893 | 3300037471 | Bacteria | 3880 |
| 253 | Ga0395905_0071359 | 3300037471 | Bacteria | 3256 |
| 254 | Ga0395905_0107996 | 3300037471 | Bacteria | 2612 |
| 255 | Ga0395905_0116577 | 3300037471 | Bacteria | 2510 |
| 256 | Ga0395905_0117288 | 3300037471 | Bacteria | 2501 |
| 257 | Ga0395905_0121927 | 3300037471 | Bacteria | 2451 |
| 258 | Ga0436364_1136587 | 3300037853 | Bacteria | 7948 |
| 259 | Ga0395901_0000331 | 3300038443 | Bacteria | 58263 |
| 260 | Ga0395901_0000963 | 3300038443 | Bacteria | 31334 |
| 261 | Ga0395901_0110024 | 3300038443 | Bacteria | 2892 |
| 262 | Ga0395901_0179634 | 3300038443 | Bacteria | 2219 |
| 263 | Ga0436361_0152693 | 3300039447 | Bacteria | 2901 |
| 264 | Ga0436361_0325950 | 3300039447 | Bacteria | 85005 |
| 265 | Ga0436361_0390486 | 3300039447 | Bacteria | 18264 |
| 266 | Ga0436361_0462569 | 3300039447 | Bacteria | 5834 |
| 267 | Ga0436361_0495861 | 3300039447 | Bacteria | 3183 |
| 268 | Ga0436361_0875769 | 3300039447 | Bacteria | 32444 |
| 269 | Ga0451807_2471212 | 3300041486 | Bacteria | 1824 |
| 270 | Ga0451843_1196518 | 3300041509 | Bacteria | 2109 |
| 271 | Ga0439450_008783 | 3300042008 | Bacteria | 1895 |
| 272 | Ga0450904_000388 | 3300042139 | Bacteria | 9121 |
| 273 | Ga0451577_0013684 | 3300042876 | Bacteria | 7582 |
| 274 | Ga0451577_0227430 | 3300042876 | Bacteria | 1686 |
| 275 | Ga0466972_0004731 | 3300044658 | Bacteria | 6815 |
| 276 | Ga0466972_0065196 | 3300044658 | Bacteria | 1743 |
| 277 | Ga0466965_0010919 | 3300044683 | Bacteria | 4247 |
| 278 | Ga0466965_0110601 | 3300044683 | Bacteria | 1411 |
| 279 | Ga0466966_0002083 | 3300044684 | Bacteria | 12980 |
| 280 | Ga0466966_0022529 | 3300044684 | Bacteria | 4132 |
| 281 | Ga0466966_0059914 | 3300044684 | Bacteria | 2403 |
| 282 | Ga0466961_0077714 | 3300044693 | Bacteria | 2102 |
| 283 | Ga0466963_0046763 | 3300044694 | Bacteria | 2854 |
| 284 | Ga0466964_0000224 | 3300044706 | Bacteria | 16209 |
| 285 | Ga0466964_0000583 | 3300044706 | Bacteria | 11528 |
| 286 | Ga0453684_0011532 | 3300044712 | Bacteria | 14786 |
| 287 | Ga0466970_0031031 | 3300044765 | Bacteria | 2821 |
| 288 | Ga0466957_0007577 | 3300044842 | Bacteria | 6134 |
| 289 | Ga0466957_0015010 | 3300044842 | Bacteria | 4518 |
| 290 | Ga0466957_0017385 | 3300044842 | Bacteria | 4210 |
| 291 | Ga0451576_0001926 | 3300045051 | Bacteria | 33249 |
| 292 | Ga0451576_0004769 | 3300045051 | Bacteria | 17384 |
| 293 | Ga0466958_0004216 | 3300045836 | Bacteria | 7560 |
| 294 | Ga0466958_0140263 | 3300045836 | Bacteria | 1521 |
| 295 | Ga0466967_0023470 | 3300045976 | Bacteria | 5055 |
| 296 | Ga0466967_0069170 | 3300045976 | Bacteria | 3154 |
| 297 | Ga0466967_0522966 | 3300045976 | Bacteria | 1166 |
| 298 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 299 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 300 | Ga0495617_000396 | 3300046452 | Bacteria | 24153 |
| 301 | Ga0495617_000529 | 3300046452 | Bacteria | 19810 |
| 302 | Ga0495617_007951 | 3300046452 | Bacteria | 3665 |
| 303 | Ga0495617_017772 | 3300046452 | Bacteria | 2403 |
| 304 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 305 | Ga0495627_000111 | 3300046453 | Bacteria | 101652 |
| 306 | Ga0495603_0014816 | 3300046455 | Bacteria | 4715 |
| 307 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 308 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 309 | Ga0495590_0000352 | 3300046457 | Bacteria | 23781 |
| 310 | Ga0495590_0007832 | 3300046457 | Bacteria | 4098 |
| 311 | Ga0495590_0028580 | 3300046457 | Bacteria | 1955 |
| 312 | Ga0495590_0043940 | 3300046457 | Bacteria | 1558 |
| 313 | Ga0495591_000062 | 3300046458 | Bacteria | 124615 |
| 314 | Ga0495629_0011465 | 3300046459 | Bacteria | 6440 |
| 315 | Ga0495629_0023319 | 3300046459 | Bacteria | 4410 |
| 316 | Ga0495638_0000023 | 3300046460 | Bacteria | 363063 |
| 317 | Ga0495638_0002863 | 3300046460 | Bacteria | 13812 |
| 318 | Ga0495638_0003777 | 3300046460 | Bacteria | 11768 |
| 319 | Ga0495638_0004044 | 3300046460 | Bacteria | 11250 |
| 320 | Ga0495638_0122770 | 3300046460 | Bacteria | 1533 |
| 321 | Ga0495651_0162472 | 3300046462 | Bacteria | 1598 |
| 322 | Ga0495653_0000073 | 3300046463 | Bacteria | 84617 |
| 323 | Ga0495653_0018376 | 3300046463 | Bacteria | 5679 |
| 324 | Ga0495653_0056866 | 3300046463 | Bacteria | 2980 |
| 325 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 326 | Ga0495650_0000124 | 3300046471 | Bacteria | 180310 |
| 327 | Ga0495650_0000169 | 3300046471 | Bacteria | 145238 |
| 328 | Ga0495650_0000177 | 3300046471 | Bacteria | 139376 |
| 329 | Ga0495650_0000538 | 3300046471 | Bacteria | 54090 |
| 330 | Ga0495650_0001900 | 3300046471 | Bacteria | 18530 |
| 331 | Ga0495650_0002395 | 3300046471 | Bacteria | 15319 |
| 332 | Ga0495650_0005538 | 3300046471 | Bacteria | 8156 |
| 333 | Ga0495650_0016593 | 3300046471 | Bacteria | 3724 |
| 334 | Ga0495580_0027622 | 3300046472 | Bacteria | 4127 |
| 335 | Ga0495605_0000063 | 3300046474 | Bacteria | 140789 |
| 336 | Ga0495605_0000092 | 3300046474 | Bacteria | 115315 |
| 337 | Ga0495605_0000174 | 3300046474 | Bacteria | 81340 |
| 338 | Ga0495605_0001450 | 3300046474 | Bacteria | 15527 |
| 339 | Ga0495605_0004480 | 3300046474 | Bacteria | 8188 |
| 340 | Ga0495605_0004907 | 3300046474 | Bacteria | 7817 |
| 341 | Ga0495605_0021101 | 3300046474 | Bacteria | 3454 |
| 342 | Ga0495605_0024848 | 3300046474 | Bacteria | 3129 |
| 343 | Ga0495605_0025747 | 3300046474 | Bacteria | 3063 |
| 344 | Ga0495605_0080571 | 3300046474 | Bacteria | 1524 |
| 345 | Ga0495605_0105521 | 3300046474 | Bacteria | 1290 |
| 346 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 347 | Ga0495584_0000211 | 3300046491 | Bacteria | 41947 |
| 348 | Ga0495584_0000456 | 3300046491 | Bacteria | 28211 |
| 349 | Ga0495584_0000756 | 3300046491 | Bacteria | 21379 |
| 350 | Ga0495584_0000788 | 3300046491 | Bacteria | 20907 |
| 351 | Ga0495584_0002654 | 3300046491 | Bacteria | 10065 |
| 352 | Ga0495584_0008327 | 3300046491 | Bacteria | 5369 |
| 353 | Ga0495584_0021307 | 3300046491 | Bacteria | 3293 |
| 354 | Ga0495584_0034256 | 3300046491 | Bacteria | 2569 |
| 355 | Ga0495584_0042915 | 3300046491 | Bacteria | 2283 |
| 356 | Ga0495584_0092040 | 3300046491 | Bacteria | 1529 |
| 357 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 358 | Ga0495585_0000190 | 3300046492 | Bacteria | 65291 |
| 359 | Ga0495585_0000196 | 3300046492 | Bacteria | 62748 |
| 360 | Ga0495585_0000336 | 3300046492 | Bacteria | 45683 |
| 361 | Ga0495585_0000564 | 3300046492 | Bacteria | 35032 |
| 362 | Ga0495585_0002186 | 3300046492 | Bacteria | 14199 |
| 363 | Ga0495585_0004665 | 3300046492 | Bacteria | 8839 |
| 364 | Ga0495585_0004904 | 3300046492 | Bacteria | 8571 |
| 365 | Ga0495585_0009103 | 3300046492 | Bacteria | 5980 |
| 366 | Ga0495585_0043150 | 3300046492 | Bacteria | 2523 |
| 367 | Ga0495585_0043206 | 3300046492 | Bacteria | 2521 |
| 368 | Ga0495585_0046506 | 3300046492 | Bacteria | 2420 |
| 369 | Ga0495585_0059966 | 3300046492 | Bacteria | 2095 |
| 370 | Ga0495585_0066836 | 3300046492 | Bacteria | 1967 |
| 371 | Ga0495585_0068283 | 3300046492 | Bacteria | 1942 |
| 372 | Ga0495585_0088561 | 3300046492 | Bacteria | 1669 |
| 373 | Ga0495585_0098985 | 3300046492 | Bacteria | 1561 |
| 374 | Ga0495585_0099507 | 3300046492 | Bacteria | 1556 |
| 375 | Ga0495585_0127585 | 3300046492 | Bacteria | 1341 |
| 376 | Ga0495585_0163771 | 3300046492 | Bacteria | 1152 |
| 377 | Ga0495594_0001314 | 3300046499 | Bacteria | 12942 |
| 378 | Ga0495594_0003923 | 3300046499 | Bacteria | 7649 |
| 379 | Ga0495594_0013780 | 3300046499 | Bacteria | 4225 |
| 380 | Ga0495594_0040131 | 3300046499 | Bacteria | 2560 |
| 381 | Ga0495594_0053204 | 3300046499 | Bacteria | 2229 |
| 382 | Ga0495596_0000130 | 3300046500 | Bacteria | 51970 |
| 383 | Ga0495596_0000217 | 3300046500 | Bacteria | 39881 |
| 384 | Ga0495596_0000867 | 3300046500 | Bacteria | 18208 |
| 385 | Ga0495596_0001456 | 3300046500 | Bacteria | 13558 |
| 386 | Ga0495596_0001704 | 3300046500 | Bacteria | 12372 |
| 387 | Ga0495596_0002425 | 3300046500 | Bacteria | 10051 |
| 388 | Ga0495596_0004552 | 3300046500 | Bacteria | 6739 |
| 389 | Ga0495596_0007723 | 3300046500 | Bacteria | 4833 |
| 390 | Ga0495596_0011882 | 3300046500 | Bacteria | 3739 |
| 391 | Ga0495596_0017520 | 3300046500 | Bacteria | 2963 |
| 392 | Ga0495596_0021422 | 3300046500 | Bacteria | 2638 |
| 393 | Ga0495596_0023080 | 3300046500 | Bacteria | 2526 |
| 394 | Ga0495596_0024209 | 3300046500 | Bacteria | 2460 |
| 395 | Ga0495607_0000380 | 3300046501 | Bacteria | 45619 |
| 396 | Ga0495607_0000692 | 3300046501 | Bacteria | 32509 |
| 397 | Ga0495607_0000740 | 3300046501 | Bacteria | 31315 |
| 398 | Ga0495607_0000852 | 3300046501 | Bacteria | 28754 |
| 399 | Ga0495607_0002892 | 3300046501 | Bacteria | 13562 |
| 400 | Ga0495607_0003619 | 3300046501 | Bacteria | 11732 |
| 401 | Ga0495607_0009387 | 3300046501 | Bacteria | 6624 |
| 402 | Ga0495607_0015473 | 3300046501 | Bacteria | 4943 |
| 403 | Ga0495607_0023548 | 3300046501 | Bacteria | 3853 |
| 404 | Ga0495607_0026552 | 3300046501 | Bacteria | 3592 |
| 405 | Ga0495607_0036460 | 3300046501 | Bacteria | 2962 |
| 406 | Ga0495607_0091085 | 3300046501 | Bacteria | 1652 |
| 407 | Ga0495607_0141846 | 3300046501 | Bacteria | 1238 |
| 408 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 409 | Ga0495583_0000084 | 3300046506 | Bacteria | 165375 |
| 410 | Ga0495583_0000088 | 3300046506 | Bacteria | 164073 |
| 411 | Ga0495583_0000299 | 3300046506 | Bacteria | 78832 |
| 412 | Ga0495583_0000404 | 3300046506 | Bacteria | 65523 |
| 413 | Ga0495583_0001506 | 3300046506 | Bacteria | 23173 |
| 414 | Ga0495583_0001938 | 3300046506 | Bacteria | 19127 |
| 415 | Ga0495583_0002237 | 3300046506 | Bacteria | 17042 |
| 416 | Ga0495583_0003192 | 3300046506 | Bacteria | 12858 |
| 417 | Ga0495583_0005086 | 3300046506 | Bacteria | 9072 |
| 418 | Ga0495583_0006758 | 3300046506 | Bacteria | 7415 |
| 419 | Ga0495583_0007931 | 3300046506 | Bacteria | 6573 |
| 420 | Ga0495583_0023098 | 3300046506 | Bacteria | 3153 |
| 421 | Ga0495583_0039154 | 3300046506 | Bacteria | 2235 |
| 422 | Ga0495606_0000043 | 3300046507 | Bacteria | 214367 |
| 423 | Ga0495606_0000146 | 3300046507 | Bacteria | 122515 |
| 424 | Ga0495606_0000184 | 3300046507 | Bacteria | 110347 |
| 425 | Ga0495606_0000291 | 3300046507 | Bacteria | 86832 |
| 426 | Ga0495606_0002377 | 3300046507 | Bacteria | 22071 |
| 427 | Ga0495606_0002573 | 3300046507 | Bacteria | 20774 |
| 428 | Ga0495606_0011650 | 3300046507 | Bacteria | 7144 |
| 429 | Ga0495606_0017285 | 3300046507 | Bacteria | 5461 |
| 430 | Ga0495606_0018541 | 3300046507 | Bacteria | 5213 |
| 431 | Ga0495606_0027053 | 3300046507 | Bacteria | 4073 |
| 432 | Ga0495606_0034750 | 3300046507 | Bacteria | 3456 |
| 433 | Ga0495606_0075850 | 3300046507 | Bacteria | 2103 |
| 434 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 435 | Ga0495610_0000423 | 3300046512 | Bacteria | 43492 |
| 436 | Ga0495610_0011356 | 3300046512 | Bacteria | 5453 |
| 437 | Ga0495610_0022485 | 3300046512 | Bacteria | 3448 |
| 438 | Ga0495610_0022621 | 3300046512 | Bacteria | 3434 |
| 439 | Ga0495610_0033555 | 3300046512 | Bacteria | 2652 |
| 440 | Ga0495616_0000081 | 3300046513 | Bacteria | 80720 |
| 441 | Ga0495616_0000111 | 3300046513 | Bacteria | 71395 |
| 442 | Ga0495616_0000419 | 3300046513 | Bacteria | 32725 |
| 443 | Ga0495616_0001731 | 3300046513 | Bacteria | 14869 |
| 444 | Ga0495616_0004007 | 3300046513 | Bacteria | 9364 |
| 445 | Ga0495616_0008370 | 3300046513 | Bacteria | 6134 |
| 446 | Ga0495616_0016401 | 3300046513 | Bacteria | 4101 |
| 447 | Ga0495616_0018067 | 3300046513 | Bacteria | 3880 |
| 448 | Ga0495616_0040790 | 3300046513 | Bacteria | 2370 |
| 449 | Ga0495616_0062010 | 3300046513 | Bacteria | 1832 |
| 450 | Ga0495616_0062332 | 3300046513 | Bacteria | 1826 |
| 451 | Ga0495620_0011666 | 3300046515 | Bacteria | 4574 |
| 452 | Ga0495628_0003636 | 3300046516 | Bacteria | 13766 |
| 453 | Ga0495631_0000226 | 3300046518 | Bacteria | 38540 |
| 454 | Ga0495631_0003086 | 3300046518 | Bacteria | 9183 |
| 455 | Ga0495631_0005356 | 3300046518 | Bacteria | 6729 |
| 456 | Ga0495631_0006563 | 3300046518 | Bacteria | 5992 |
| 457 | Ga0495631_0014389 | 3300046518 | Bacteria | 3819 |
| 458 | Ga0495631_0020636 | 3300046518 | Bacteria | 3076 |
| 459 | Ga0495631_0023008 | 3300046518 | Bacteria | 2893 |
| 460 | Ga0495631_0035430 | 3300046518 | Bacteria | 2232 |
| 461 | Ga0495631_0061083 | 3300046518 | Bacteria | 1635 |
| 462 | Ga0495631_0089976 | 3300046518 | Bacteria | 1321 |
| 463 | Ga0495632_0000068 | 3300046519 | Bacteria | 108872 |
| 464 | Ga0495632_0000154 | 3300046519 | Bacteria | 70836 |
| 465 | Ga0495632_0001164 | 3300046519 | Bacteria | 22365 |
| 466 | Ga0495632_0002784 | 3300046519 | Bacteria | 12967 |
| 467 | Ga0495632_0007068 | 3300046519 | Bacteria | 7112 |
| 468 | Ga0495632_0017573 | 3300046519 | Bacteria | 3943 |
| 469 | Ga0495632_0039196 | 3300046519 | Bacteria | 2393 |
| 470 | Ga0495637_0000019 | 3300046520 | Bacteria | 185953 |
| 471 | Ga0495637_0000498 | 3300046520 | Bacteria | 28461 |
| 472 | Ga0495637_0004630 | 3300046520 | Bacteria | 7103 |
| 473 | Ga0495637_0008473 | 3300046520 | Bacteria | 5047 |
| 474 | Ga0495643_0000196 | 3300046522 | Bacteria | 95989 |
| 475 | Ga0495643_0000211 | 3300046522 | Bacteria | 89358 |
| 476 | Ga0495643_0000213 | 3300046522 | Bacteria | 89236 |
| 477 | Ga0495643_0000227 | 3300046522 | Bacteria | 85333 |
| 478 | Ga0495643_0005455 | 3300046522 | Bacteria | 8601 |
| 479 | Ga0495643_0011286 | 3300046522 | Bacteria | 5452 |
| 480 | Ga0495643_0015987 | 3300046522 | Bacteria | 4418 |
| 481 | Ga0495643_0020435 | 3300046522 | Bacteria | 3816 |
| 482 | Ga0495643_0023710 | 3300046522 | Bacteria | 3485 |
| 483 | Ga0495643_0030220 | 3300046522 | Bacteria | 3027 |
| 484 | Ga0495643_0041735 | 3300046522 | Bacteria | 2501 |
| 485 | Ga0495643_0041937 | 3300046522 | Bacteria | 2494 |
| 486 | Ga0495643_0062653 | 3300046522 | Bacteria | 1968 |
| 487 | Ga0495644_0003468 | 3300046523 | Bacteria | 6237 |
| 488 | Ga0495644_0006241 | 3300046523 | Bacteria | 4629 |
| 489 | Ga0495644_0007236 | 3300046523 | Bacteria | 4291 |
| 490 | Ga0495644_0007335 | 3300046523 | Bacteria | 4259 |
| 491 | Ga0495644_0008045 | 3300046523 | Bacteria | 4056 |
| 492 | Ga0495644_0013446 | 3300046523 | Bacteria | 3139 |
| 493 | Ga0495644_0017425 | 3300046523 | Bacteria | 2746 |
| 494 | Ga0495644_0019045 | 3300046523 | Bacteria | 2619 |
| 495 | Ga0495644_0039470 | 3300046523 | Bacteria | 1780 |
| 496 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 497 | Ga0495648_0000084 | 3300046524 | Bacteria | 120611 |
| 498 | Ga0495648_0000367 | 3300046524 | Bacteria | 49778 |
| 499 | Ga0495648_0000497 | 3300046524 | Bacteria | 42400 |
| 500 | Ga0495648_0003856 | 3300046524 | Bacteria | 13004 |
| 501 | Ga0495648_0005495 | 3300046524 | Bacteria | 10512 |
| 502 | Ga0495648_0006062 | 3300046524 | Bacteria | 9921 |
| 503 | Ga0495648_0007441 | 3300046524 | Bacteria | 8760 |
| 504 | Ga0495648_0009255 | 3300046524 | Bacteria | 7657 |
| 505 | Ga0495648_0010304 | 3300046524 | Bacteria | 7131 |
| 506 | Ga0495648_0039206 | 3300046524 | Bacteria | 3017 |
| 507 | Ga0495648_0042819 | 3300046524 | Bacteria | 2845 |
| 508 | Ga0495648_0076078 | 3300046524 | Bacteria | 1928 |
| 509 | Ga0495663_0002462 | 3300046525 | Bacteria | 5566 |
| 510 | Ga0495663_0007538 | 3300046525 | Bacteria | 3010 |
| 511 | Ga0495666_0001962 | 3300046526 | Bacteria | 10142 |
| 512 | Ga0495666_0007127 | 3300046526 | Bacteria | 5617 |
| 513 | Ga0495666_0025001 | 3300046526 | Bacteria | 2950 |
| 514 | Ga0495642_0000133 | 3300046528 | Bacteria | 42946 |
| 515 | Ga0495642_0000535 | 3300046528 | Bacteria | 19288 |
| 516 | Ga0495642_0000635 | 3300046528 | Bacteria | 17592 |
| 517 | Ga0495642_0002841 | 3300046528 | Bacteria | 6911 |
| 518 | Ga0495642_0007136 | 3300046528 | Bacteria | 4287 |
| 519 | Ga0495642_0011435 | 3300046528 | Bacteria | 3410 |
| 520 | Ga0495642_0013023 | 3300046528 | Bacteria | 3211 |
| 521 | Ga0495642_0013331 | 3300046528 | Bacteria | 3178 |
| 522 | Ga0495642_0015740 | 3300046528 | Bacteria | 2944 |
| 523 | Ga0495642_0015935 | 3300046528 | Bacteria | 2926 |
| 524 | Ga0495642_0019968 | 3300046528 | Bacteria | 2628 |
| 525 | Ga0495642_0028281 | 3300046528 | Bacteria | 2233 |
| 526 | Ga0495642_0034113 | 3300046528 | Bacteria | 2048 |
| 527 | Ga0495642_0073602 | 3300046528 | Bacteria | 1431 |
| 528 | Ga0495652_0003589 | 3300046529 | Bacteria | 15219 |
| 529 | Ga0495652_0005611 | 3300046529 | Bacteria | 11771 |
| 530 | Ga0495652_0013202 | 3300046529 | Bacteria | 7436 |
| 531 | Ga0495652_0051204 | 3300046529 | Bacteria | 3528 |
| 532 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 533 | Ga0495654_0002324 | 3300046530 | Bacteria | 12288 |
| 534 | Ga0495654_0005959 | 3300046530 | Bacteria | 7004 |
| 535 | Ga0495654_0015326 | 3300046530 | Bacteria | 4072 |
| 536 | Ga0495654_0024513 | 3300046530 | Bacteria | 3115 |
| 537 | Ga0495654_0026219 | 3300046530 | Bacteria | 2999 |
| 538 | Ga0495665_0039174 | 3300046531 | Bacteria | 2524 |
| 539 | Ga0495665_0061154 | 3300046531 | Bacteria | 1988 |
| 540 | Ga0495665_0158407 | 3300046531 | Bacteria | 1180 |
| 541 | Ga0495586_0021137 | 3300046535 | Bacteria | 3467 |
| 542 | Ga0495586_0026641 | 3300046535 | Bacteria | 3093 |
| 543 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 544 | Ga0495609_0000363 | 3300046538 | Bacteria | 38970 |
| 545 | Ga0495609_0000518 | 3300046538 | Bacteria | 31072 |
| 546 | Ga0495609_0001137 | 3300046538 | Bacteria | 18406 |
| 547 | Ga0495609_0001775 | 3300046538 | Bacteria | 13852 |
| 548 | Ga0495609_0002348 | 3300046538 | Bacteria | 11678 |
| 549 | Ga0495609_0002975 | 3300046538 | Bacteria | 10007 |
| 550 | Ga0495609_0005685 | 3300046538 | Bacteria | 6492 |
| 551 | Ga0495609_0008340 | 3300046538 | Bacteria | 5077 |
| 552 | Ga0495609_0010339 | 3300046538 | Bacteria | 4480 |
| 553 | Ga0495609_0010893 | 3300046538 | Bacteria | 4343 |
| 554 | Ga0495609_0029535 | 3300046538 | Bacteria | 2496 |
| 555 | Ga0495609_0032758 | 3300046538 | Bacteria | 2360 |
| 556 | Ga0495609_0054690 | 3300046538 | Bacteria | 1772 |
| 557 | Ga0495609_0065662 | 3300046538 | Bacteria | 1599 |
| 558 | Ga0495597_0000022 | 3300046542 | Bacteria | 150986 |
| 559 | Ga0495597_0000063 | 3300046542 | Bacteria | 91471 |
| 560 | Ga0495597_0001267 | 3300046542 | Bacteria | 18621 |
| 561 | Ga0495597_0001274 | 3300046542 | Bacteria | 18578 |
| 562 | Ga0495597_0001432 | 3300046542 | Bacteria | 17158 |
| 563 | Ga0495597_0002036 | 3300046542 | Bacteria | 13530 |
| 564 | Ga0495597_0002456 | 3300046542 | Bacteria | 11723 |
| 565 | Ga0495597_0002765 | 3300046542 | Bacteria | 10806 |
| 566 | Ga0495597_0002948 | 3300046542 | Bacteria | 10326 |
| 567 | Ga0495597_0022799 | 3300046542 | Bacteria | 2900 |
| 568 | Ga0495597_0028854 | 3300046542 | Bacteria | 2536 |
| 569 | Ga0495597_0072189 | 3300046542 | Bacteria | 1485 |
| 570 | Ga0495645_0002586 | 3300046543 | Bacteria | 12301 |
| 571 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 572 | Ga0495622_0000074 | 3300046557 | Bacteria | 87846 |
| 573 | Ga0495622_0013694 | 3300046557 | Bacteria | 3760 |
| 574 | Ga0495622_0029272 | 3300046557 | Bacteria | 2573 |
| 575 | Ga0495622_0048462 | 3300046557 | Bacteria | 1974 |
| 576 | Ga0495633_0000113 | 3300046558 | Bacteria | 109307 |
| 577 | Ga0495633_0000421 | 3300046558 | Bacteria | 44029 |
| 578 | Ga0495633_0001242 | 3300046558 | Bacteria | 20380 |
| 579 | Ga0495633_0001263 | 3300046558 | Bacteria | 20159 |
| 580 | Ga0495633_0001832 | 3300046558 | Bacteria | 15619 |
| 581 | Ga0495633_0002519 | 3300046558 | Bacteria | 12882 |
| 582 | Ga0495633_0003469 | 3300046558 | Bacteria | 10482 |
| 583 | Ga0495633_0007240 | 3300046558 | Bacteria | 6420 |
| 584 | Ga0495633_0015981 | 3300046558 | Bacteria | 3882 |
| 585 | Ga0495633_0022590 | 3300046558 | Bacteria | 3127 |
| 586 | Ga0495633_0028353 | 3300046558 | Bacteria | 2729 |
| 587 | Ga0495633_0031970 | 3300046558 | Bacteria | 2545 |
| 588 | Ga0495656_0012612 | 3300046615 | Bacteria | 3124 |
| 589 | Ga0495656_0062731 | 3300046615 | Bacteria | 1626 |
| 590 | Ga0495668_0000051 | 3300046616 | Bacteria | 214532 |
| 591 | Ga0495668_0000139 | 3300046616 | Bacteria | 109589 |
| 592 | Ga0495668_0000589 | 3300046616 | Bacteria | 44174 |
| 593 | Ga0495668_0000617 | 3300046616 | Bacteria | 43027 |
| 594 | Ga0495668_0001450 | 3300046616 | Bacteria | 22883 |
| 595 | Ga0495668_0002601 | 3300046616 | Bacteria | 14626 |
| 596 | Ga0495668_0002799 | 3300046616 | Bacteria | 13882 |
| 597 | Ga0495668_0003830 | 3300046616 | Bacteria | 11013 |
| 598 | Ga0495668_0004085 | 3300046616 | Bacteria | 10578 |
| 599 | Ga0495668_0005502 | 3300046616 | Bacteria | 8548 |
| 600 | Ga0495668_0008922 | 3300046616 | Bacteria | 6201 |
| 601 | Ga0495668_0017919 | 3300046616 | Bacteria | 4101 |
| 602 | Ga0495668_0029948 | 3300046616 | Bacteria | 3074 |
| 603 | Ga0495668_0094424 | 3300046616 | Bacteria | 1637 |
| 604 | Ga0495668_0096414 | 3300046616 | Bacteria | 1618 |
| 605 | Ga0495634_0001242 | 3300046642 | Bacteria | 23453 |
| 606 | Ga0495611_0000227 | 3300046648 | Bacteria | 39262 |
| 607 | Ga0495611_0000625 | 3300046648 | Bacteria | 20376 |
| 608 | Ga0495611_0001871 | 3300046648 | Bacteria | 10034 |
| 609 | Ga0495611_0002481 | 3300046648 | Bacteria | 8411 |
| 610 | Ga0495611_0006810 | 3300046648 | Bacteria | 4855 |
| 611 | Ga0495611_0011083 | 3300046648 | Bacteria | 3818 |
| 612 | Ga0495611_0031061 | 3300046648 | Bacteria | 2349 |
| 613 | Ga0495611_0050875 | 3300046648 | Bacteria | 1866 |
| 614 | Ga0495611_0072071 | 3300046648 | Bacteria | 1580 |
| 615 | Ga0495625_0000073 | 3300046660 | Bacteria | 165197 |
| 616 | Ga0495625_0000176 | 3300046660 | Bacteria | 99062 |
| 617 | Ga0495625_0002486 | 3300046660 | Bacteria | 19870 |
| 618 | Ga0495625_0005549 | 3300046660 | Bacteria | 11455 |
| 619 | Ga0495625_0016330 | 3300046660 | Bacteria | 5846 |
| 620 | Ga0495625_0036211 | 3300046660 | Bacteria | 3629 |
| 621 | Ga0495625_0123871 | 3300046660 | Bacteria | 1756 |
| 622 | Ga0495625_0178238 | 3300046660 | Bacteria | 1415 |
| 623 | Ga0495625_0237649 | 3300046660 | Bacteria | 1187 |
| 624 | Ga0495635_0024837 | 3300046663 | Bacteria | 4175 |
| 625 | Ga0495635_0188722 | 3300046663 | Bacteria | 1400 |
| 626 | Ga0495635_0280017 | 3300046663 | Bacteria | 1120 |
| 627 | Ga0495659_0000004 | 3300046664 | Bacteria | 143914 |
| 628 | Ga0495659_0001570 | 3300046664 | Bacteria | 7682 |
| 629 | Ga0495659_0002496 | 3300046664 | Bacteria | 5937 |
| 630 | Ga0495659_0016971 | 3300046664 | Bacteria | 2407 |
| 631 | Ga0495659_0105855 | 3300046664 | Bacteria | 1094 |
| 632 | Ga0495661_0000183 | 3300046665 | Bacteria | 72020 |
| 633 | Ga0495661_0000377 | 3300046665 | Bacteria | 48123 |
| 634 | Ga0495661_0001998 | 3300046665 | Bacteria | 16090 |
| 635 | Ga0495661_0003109 | 3300046665 | Bacteria | 12453 |
| 636 | Ga0495661_0003914 | 3300046665 | Bacteria | 10872 |
| 637 | Ga0495661_0007957 | 3300046665 | Bacteria | 7361 |
| 638 | Ga0495661_0009209 | 3300046665 | Bacteria | 6785 |
| 639 | Ga0495661_0012052 | 3300046665 | Bacteria | 5849 |
| 640 | Ga0495661_0016410 | 3300046665 | Bacteria | 4908 |
| 641 | Ga0495661_0017343 | 3300046665 | Bacteria | 4756 |
| 642 | Ga0495661_0020699 | 3300046665 | Bacteria | 4291 |
| 643 | Ga0495661_0024828 | 3300046665 | Bacteria | 3878 |
| 644 | Ga0495661_0050921 | 3300046665 | Bacteria | 2503 |
| 645 | Ga0495661_0069543 | 3300046665 | Bacteria | 2062 |
| 646 | Ga0495661_0083973 | 3300046665 | Bacteria | 1829 |
| 647 | Ga0495661_0087602 | 3300046665 | Bacteria | 1779 |
| 648 | Ga0495588_0000127 | 3300046674 | Bacteria | 125854 |
| 649 | Ga0495588_0002680 | 3300046674 | Bacteria | 7624 |
| 650 | Ga0495588_0009512 | 3300046674 | Bacteria | 4495 |
| 651 | Ga0495588_0022869 | 3300046674 | Bacteria | 3091 |
| 652 | Ga0495588_0024895 | 3300046674 | Bacteria | 2977 |
| 653 | Ga0495588_0028437 | 3300046674 | Bacteria | 2797 |
| 654 | Ga0495657_0137111 | 3300046675 | Bacteria | 1528 |
| 655 | Ga0495599_0065791 | 3300046678 | Bacteria | 2264 |
| 656 | Ga0495623_0008074 | 3300046679 | Bacteria | 6841 |
| 657 | Ga0495623_0008515 | 3300046679 | Bacteria | 6662 |
| 658 | Ga0495623_0056344 | 3300046679 | Bacteria | 2475 |
| 659 | Ga0495646_0054272 | 3300046680 | Bacteria | 2411 |
| 660 | Ga0495646_0102857 | 3300046680 | Bacteria | 1635 |
| 661 | Ga0495669_0000036 | 3300046684 | Bacteria | 95830 |
| 662 | Ga0495669_0000544 | 3300046684 | Bacteria | 16875 |
| 663 | Ga0495669_0000786 | 3300046684 | Bacteria | 13553 |
| 664 | Ga0495669_0002017 | 3300046684 | Bacteria | 8325 |
| 665 | Ga0495613_0023563 | 3300046689 | Bacteria | 4587 |
| 666 | Ga0495624_0025298 | 3300046690 | Bacteria | 3898 |
| 667 | Ga0495624_0028123 | 3300046690 | Bacteria | 3676 |
| 668 | Ga0495624_0076557 | 3300046690 | Bacteria | 2076 |
| 669 | Ga0495670_0000490 | 3300046691 | Bacteria | 18748 |
| 670 | Ga0495670_0001576 | 3300046691 | Bacteria | 11137 |
| 671 | Ga0495670_0038493 | 3300046691 | Bacteria | 2384 |
| 672 | Ga0495670_0041618 | 3300046691 | Bacteria | 2292 |
| 673 | Ga0495671_0000067 | 3300046692 | Bacteria | 103441 |
| 674 | Ga0495671_0000213 | 3300046692 | Bacteria | 50627 |
| 675 | Ga0495671_0004992 | 3300046692 | Bacteria | 7818 |
| 676 | Ga0495671_0009872 | 3300046692 | Bacteria | 5310 |
| 677 | Ga0495671_0020398 | 3300046692 | Bacteria | 3493 |
| 678 | Ga0495671_0021118 | 3300046692 | Bacteria | 3424 |
| 679 | Ga0495671_0059770 | 3300046692 | Bacteria | 1883 |
| 680 | Ga0495649_0000281 | 3300046694 | Bacteria | 44878 |
| 681 | Ga0495649_0000597 | 3300046694 | Bacteria | 30098 |
| 682 | Ga0495649_0005172 | 3300046694 | Bacteria | 8362 |
| 683 | Ga0495649_0006243 | 3300046694 | Bacteria | 7430 |
| 684 | Ga0495649_0012961 | 3300046694 | Bacteria | 4826 |
| 685 | Ga0495649_0060689 | 3300046694 | Bacteria | 2034 |
| 686 | Ga0495589_0000079 | 3300046794 | Bacteria | 89713 |
| 687 | Ga0495589_0000083 | 3300046794 | Bacteria | 87058 |
| 688 | Ga0495589_0001488 | 3300046794 | Bacteria | 13479 |
| 689 | Ga0495589_0009391 | 3300046794 | Bacteria | 5087 |
| 690 | Ga0495589_0013735 | 3300046794 | Bacteria | 4176 |
| 691 | Ga0495589_0020895 | 3300046794 | Bacteria | 3346 |
| 692 | Ga0495600_0039199 | 3300046809 | Bacteria | 3085 |
| 693 | Ga0495600_0065389 | 3300046809 | Bacteria | 2377 |
| 694 | Ga0495660_0000081 | 3300046810 | Bacteria | 101754 |
| 695 | Ga0495660_0000264 | 3300046810 | Bacteria | 49401 |
| 696 | Ga0495660_0000625 | 3300046810 | Bacteria | 27722 |
| 697 | Ga0495660_0000784 | 3300046810 | Bacteria | 23793 |
| 698 | Ga0495660_0002107 | 3300046810 | Bacteria | 12875 |
| 699 | Ga0495660_0004430 | 3300046810 | Bacteria | 8494 |
| 700 | Ga0495660_0039769 | 3300046810 | Bacteria | 2610 |
| 701 | Ga0495660_0058308 | 3300046810 | Bacteria | 2080 |
| 702 | Ga0495581_0020353 | 3300047315 | Bacteria | 3851 |
| 703 | Ga0495581_0051260 | 3300047315 | Bacteria | 2383 |
| 704 | Ga0495604_0010541 | 3300047317 | Bacteria | 7328 |
| 705 | Ga0495604_0012089 | 3300047317 | Bacteria | 6864 |
| 706 | Ga0495604_0031295 | 3300047317 | Bacteria | 4221 |
| 707 | Ga0495604_0039134 | 3300047317 | Bacteria | 3728 |
| 708 | Ga0495636_0003707 | 3300047318 | Bacteria | 5942 |
| 709 | Ga0495636_0005753 | 3300047318 | Bacteria | 4859 |
| 710 | Ga0495636_0010723 | 3300047318 | Bacteria | 3622 |
| 711 | Ga0495636_0020142 | 3300047318 | Bacteria | 2686 |
| 712 | Ga0495674_0004551 | 3300047319 | Bacteria | 13341 |
| 713 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 714 | Ga0495672_0000045 | 3300047320 | Bacteria | 255145 |
| 715 | Ga0495672_0000132 | 3300047320 | Bacteria | 111537 |
| 716 | Ga0495672_0000168 | 3300047320 | Bacteria | 95544 |
| 717 | Ga0495672_0000182 | 3300047320 | Bacteria | 91245 |
| 718 | Ga0495672_0000705 | 3300047320 | Bacteria | 36728 |
| 719 | Ga0495672_0002916 | 3300047320 | Bacteria | 15128 |
| 720 | Ga0495672_0003713 | 3300047320 | Bacteria | 12874 |
| 721 | Ga0495672_0005367 | 3300047320 | Bacteria | 10192 |
| 722 | Ga0495672_0013932 | 3300047320 | Bacteria | 5527 |
| 723 | Ga0495672_0023172 | 3300047320 | Bacteria | 4024 |
| 724 | Ga0495672_0028266 | 3300047320 | Bacteria | 3550 |
| 725 | Ga0495672_0084352 | 3300047320 | Bacteria | 1762 |
| 726 | Ga0495676_0000014 | 3300047321 | Bacteria | 203356 |
| 727 | Ga0495676_0014944 | 3300047321 | Bacteria | 6931 |
| 728 | Ga0495676_0019137 | 3300047321 | Bacteria | 6027 |
| 729 | Ga0495676_0027281 | 3300047321 | Bacteria | 4899 |
| 730 | Ga0495680_0115458 | 3300047322 | Bacteria | 1986 |
| 731 | Ga0495683_0000159 | 3300047323 | Bacteria | 66298 |
| 732 | Ga0495683_0002317 | 3300047323 | Bacteria | 11579 |
| 733 | Ga0495683_0003896 | 3300047323 | Bacteria | 8585 |
| 734 | Ga0495683_0004758 | 3300047323 | Bacteria | 7627 |
| 735 | Ga0495683_0008042 | 3300047323 | Bacteria | 5661 |
| 736 | Ga0495683_0016126 | 3300047323 | Bacteria | 3880 |
| 737 | Ga0495683_0042916 | 3300047323 | Bacteria | 2279 |
| 738 | Ga0495683_0061811 | 3300047323 | Bacteria | 1854 |
| 739 | Ga0495683_0071040 | 3300047323 | Bacteria | 1708 |
| 740 | Ga0495687_000049 | 3300047443 | Bacteria | 205432 |
| 741 | Ga0495687_000075 | 3300047443 | Bacteria | 152218 |
| 742 | Ga0495687_000133 | 3300047443 | Bacteria | 113757 |
| 743 | Ga0495687_000197 | 3300047443 | Bacteria | 86694 |
| 744 | Ga0495687_000199 | 3300047443 | Bacteria | 86090 |
| 745 | Ga0495687_000701 | 3300047443 | Bacteria | 37406 |
| 746 | Ga0495687_001964 | 3300047443 | Bacteria | 17562 |
| 747 | Ga0495687_002227 | 3300047443 | Bacteria | 16014 |
| 748 | Ga0495687_003980 | 3300047443 | Bacteria | 10297 |
| 749 | Ga0495675_0002901 | 3300047444 | Bacteria | 10296 |
| 750 | Ga0495675_0007616 | 3300047444 | Bacteria | 6675 |
| 751 | Ga0495677_0000030 | 3300047445 | Bacteria | 87817 |
| 752 | Ga0495677_0000138 | 3300047445 | Bacteria | 34784 |
| 753 | Ga0495677_0004097 | 3300047445 | Bacteria | 5629 |
| 754 | Ga0495677_0007122 | 3300047445 | Bacteria | 4187 |
| 755 | Ga0495677_0008702 | 3300047445 | Bacteria | 3765 |
| 756 | Ga0495677_0012319 | 3300047445 | Bacteria | 3119 |
| 757 | Ga0495677_0012818 | 3300047445 | Bacteria | 3056 |
| 758 | Ga0495677_0041321 | 3300047445 | Bacteria | 1687 |
| 759 | Ga0495677_0063404 | 3300047445 | Bacteria | 1372 |
| 760 | Ga0495679_001504 | 3300047446 | Bacteria | 13174 |
| 761 | Ga0495679_003064 | 3300047446 | Bacteria | 8209 |
| 762 | Ga0495679_004802 | 3300047446 | Bacteria | 6117 |
| 763 | Ga0495679_018850 | 3300047446 | Bacteria | 2439 |
| 764 | Ga0495679_032568 | 3300047446 | Bacteria | 1670 |
| 765 | Ga0495679_032594 | 3300047446 | Bacteria | 1669 |
| 766 | Ga0495685_000010 | 3300047447 | Bacteria | 84950 |
| 767 | Ga0495685_002335 | 3300047447 | Bacteria | 5927 |
| 768 | Ga0495685_011659 | 3300047447 | Bacteria | 2970 |
| 769 | Ga0495685_016354 | 3300047447 | Bacteria | 2533 |
| 770 | Ga0495685_031599 | 3300047447 | Bacteria | 1819 |
| 771 | Ga0495685_033199 | 3300047447 | Bacteria | 1773 |
| 772 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 773 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 774 | Ga0495673_0015116 | 3300047469 | Bacteria | 3988 |
| 775 | Ga0495681_0000057 | 3300047470 | Bacteria | 103340 |
| 776 | Ga0495681_0001545 | 3300047470 | Bacteria | 17177 |
| 777 | Ga0495681_0004162 | 3300047470 | Bacteria | 9942 |
| 778 | Ga0495681_0008290 | 3300047470 | Bacteria | 6526 |
| 779 | Ga0495681_0008796 | 3300047470 | Bacteria | 6287 |
| 780 | Ga0495681_0010749 | 3300047470 | Bacteria | 5515 |
| 781 | Ga0495681_0049560 | 3300047470 | Bacteria | 1984 |
| 782 | Ga0495686_0000400 | 3300047472 | Bacteria | 68842 |
| 783 | Ga0495686_0000455 | 3300047472 | Bacteria | 61537 |
| 784 | Ga0495686_0004730 | 3300047472 | Bacteria | 11022 |
| 785 | Ga0495686_0013129 | 3300047472 | Bacteria | 5765 |
| 786 | Ga0495686_0020754 | 3300047472 | Bacteria | 4378 |
| 787 | Ga0495686_0048916 | 3300047472 | Bacteria | 2663 |
| 788 | Ga0495686_0080210 | 3300047472 | Bacteria | 1995 |
| 789 | Ga0495593_0019789 | 3300047673 | Bacteria | 3771 |
| 790 | Ga0495593_0035580 | 3300047673 | Bacteria | 2703 |
| 791 | Ga0495602_0001440 | 3300048088 | Bacteria | 23620 |
| 792 | Ga0495602_0025548 | 3300048088 | Bacteria | 5715 |
| 793 | Ga0495614_0011463 | 3300048089 | Bacteria | 3901 |
| 794 | Ga0495615_0001527 | 3300048090 | Bacteria | 3473 |
| 795 | Ga0495626_0000102 | 3300048091 | Bacteria | 110315 |
| 796 | Ga0495626_0000111 | 3300048091 | Bacteria | 105401 |
| 797 | Ga0495626_0001501 | 3300048091 | Bacteria | 18401 |
| 798 | Ga0495626_0001547 | 3300048091 | Bacteria | 18065 |
| 799 | Ga0495626_0002427 | 3300048091 | Bacteria | 12938 |
| 800 | Ga0495626_0005287 | 3300048091 | Bacteria | 7621 |
| 801 | Ga0495626_0013969 | 3300048091 | Bacteria | 4156 |
| 802 | Ga0495626_0016819 | 3300048091 | Bacteria | 3707 |
| 803 | Ga0495626_0016980 | 3300048091 | Bacteria | 3685 |
| 804 | Ga0495626_0016999 | 3300048091 | Bacteria | 3681 |
| 805 | Ga0495626_0040021 | 3300048091 | Bacteria | 2215 |
| 806 | Ga0495626_0061097 | 3300048091 | Bacteria | 1715 |
| 807 | Ga0496100_0109550 | 3300048903 | Bacteria | 1916 |
| 808 | Ga0496101_0067851 | 3300048904 | Bacteria | 2605 |
| 809 | Ga0496102_0000088 | 3300048905 | Bacteria | 129762 |
| 810 | Ga0496102_0000159 | 3300048905 | Bacteria | 91043 |
| 811 | Ga0496102_0020050 | 3300048905 | Bacteria | 5901 |
| 812 | Ga0496102_0022714 | 3300048905 | Bacteria | 5559 |
| 813 | Ga0496102_0093907 | 3300048905 | Bacteria | 2779 |
| 814 | Ga0496102_0134780 | 3300048905 | Bacteria | 2313 |
| 815 | Ga0496103_0000904 | 3300048906 | Bacteria | 21298 |
| 816 | Ga0496103_0050564 | 3300048906 | Bacteria | 2571 |
| 817 | Ga0496103_0116139 | 3300048906 | Bacteria | 1702 |
| 818 | Ga0496104_0330407 | 3300048907 | Bacteria | 1438 |
| 819 | Ga0496105_0186607 | 3300048908 | Bacteria | 1697 |
| 820 | Ga0496106_0002714 | 3300048909 | Bacteria | 13113 |
| 821 | Ga0496107_0043352 | 3300048910 | Bacteria | 3232 |
| 822 | Ga0496109_0006947 | 3300048912 | Bacteria | 9555 |
| 823 | Ga0496111_0030066 | 3300048914 | Bacteria | 3862 |
| 824 | Ga0496113_0000552 | 3300048916 | Bacteria | 18562 |
| 825 | Ga0496113_0038592 | 3300048916 | Bacteria | 3512 |
| 826 | Ga0496113_0114812 | 3300048916 | Bacteria | 2100 |
| 827 | Ga0496114_0022332 | 3300048917 | Bacteria | 5156 |
| 828 | Ga0496114_0079916 | 3300048917 | Bacteria | 2761 |
| 829 | Ga0496115_0015844 | 3300048918 | Bacteria | 5725 |
| 830 | Ga0496115_0036967 | 3300048918 | Bacteria | 3868 |
| 831 | Ga0496115_0041646 | 3300048918 | Bacteria | 3656 |
| 832 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 833 | Ga0496116_0005797 | 3300048919 | Bacteria | 11347 |
| 834 | Ga0496116_0015162 | 3300048919 | Bacteria | 6110 |
| 835 | Ga0496116_0065845 | 3300048919 | Bacteria | 2322 |
| 836 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 837 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 838 | Ga0496121_0000029 | 3300048924 | Bacteria | 430303 |
| 839 | Ga0496121_0003166 | 3300048924 | Bacteria | 23725 |
| 840 | Ga0496121_0032323 | 3300048924 | Bacteria | 4759 |
| 841 | Ga0496121_0037463 | 3300048924 | Bacteria | 4307 |
| 842 | Ga0496121_0104595 | 3300048924 | Bacteria | 2175 |
| 843 | Ga0496122_0000134 | 3300048925 | Bacteria | 171080 |
| 844 | Ga0496122_0000169 | 3300048925 | Bacteria | 155380 |
| 845 | Ga0496122_0001178 | 3300048925 | Bacteria | 44704 |
| 846 | Ga0496122_0002235 | 3300048925 | Bacteria | 28137 |
| 847 | Ga0496123_0000198 | 3300048926 | Bacteria | 122508 |
| 848 | Ga0496123_0000583 | 3300048926 | Bacteria | 62248 |
| 849 | Ga0496123_0008917 | 3300048926 | Bacteria | 9118 |
| 850 | Ga0496123_0027069 | 3300048926 | Bacteria | 4279 |
| 851 | Ga0496123_0117539 | 3300048926 | Bacteria | 1503 |
| 852 | Ga0496124_0002261 | 3300048927 | Bacteria | 25562 |
| 853 | Ga0496124_0025174 | 3300048927 | Bacteria | 5395 |
| 854 | Ga0496124_0028866 | 3300048927 | Bacteria | 4954 |
| 855 | Ga0496124_0043903 | 3300048927 | Bacteria | 3839 |
| 856 | Ga0496124_0046734 | 3300048927 | Bacteria | 3705 |
| 857 | Ga0496124_0070676 | 3300048927 | Bacteria | 2895 |
| 858 | Ga0496124_0089330 | 3300048927 | Bacteria | 2516 |
| 859 | Ga0496124_0159023 | 3300048927 | Bacteria | 1763 |
| 860 | Ga0496125_0000433 | 3300048928 | Bacteria | 76686 |
| 861 | Ga0496125_0000605 | 3300048928 | Bacteria | 61001 |
| 862 | Ga0496125_0008347 | 3300048928 | Bacteria | 10864 |
| 863 | Ga0496125_0037113 | 3300048928 | Bacteria | 4241 |
| 864 | Ga0496125_0040188 | 3300048928 | Bacteria | 4015 |
| 865 | Ga0496125_0188030 | 3300048928 | Bacteria | 1367 |
| 866 | Ga0496126_0262316 | 3300048929 | Bacteria | 1436 |
| 867 | Ga0495678_000042 | 3300049459 | Bacteria | 174125 |
| 868 | Ga0495678_000070 | 3300049459 | Bacteria | 131437 |
| 869 | Ga0495678_000105 | 3300049459 | Bacteria | 103599 |
| 870 | Ga0495678_000147 | 3300049459 | Bacteria | 85326 |
| 871 | Ga0495678_000363 | 3300049459 | Bacteria | 46320 |
| 872 | Ga0495678_001845 | 3300049459 | Bacteria | 15498 |
| 873 | Ga0495678_002051 | 3300049459 | Bacteria | 14409 |
| 874 | Ga0495678_006491 | 3300049459 | Bacteria | 6219 |
| 875 | Ga0495678_007503 | 3300049459 | Bacteria | 5639 |
| 876 | Ga0495682_0000116 | 3300049460 | Bacteria | 69250 |
| 877 | Ga0495682_0000126 | 3300049460 | Bacteria | 66245 |
| 878 | Ga0495682_0002583 | 3300049460 | Bacteria | 8507 |
| 879 | Ga0495682_0007570 | 3300049460 | Bacteria | 4311 |
| 880 | Ga0495682_0013718 | 3300049460 | Bacteria | 3080 |
| 881 | Ga0501034_0142807 | 3300049571 | Bacteria | 2373 |
| 882 | Ga0501046_0000027 | 3300049580 | Bacteria | 197037 |
| 883 | Ga0501227_005620 | 3300049665 | Bacteria | 2683 |
| 884 | Ga0501269_000295 | 3300049766 | Bacteria | 13600 |
| 885 | Ga0501279_002231 | 3300049775 | Bacteria | 2552 |
| 886 | Ga0501279_002611 | 3300049775 | Bacteria | 2356 |
| 887 | Ga0501035_0001519 | 3300049822 | Bacteria | 23703 |
| 888 | Ga0501044_0162943 | 3300049823 | Bacteria | 2205 |
| 889 | nmdc:mga0yw44_68789_c1 | 3300050492 | Bacteria | 2191 |
| 890 | nmdc:mga07m45_99065_c1 | 3300050496 | Bacteria | 1673 |
| 891 | nmdc:mga0n895_407618_c1 | 3300050512 | Bacteria | 1375 |
| 892 | Ga0495601_0037386 | 3300053077 | Bacteria | 3035 |
| 893 | Ga0495601_0044660 | 3300053077 | Bacteria | 2785 |
| 894 | Ga0500643_001239 | 3300053087 | Bacteria | 15130 |
| 895 | Ga0500594_0010822 | 3300053118 | Bacteria | 2122 |
| 896 | Ga0500595_008866 | 3300053119 | Bacteria | 4087 |
| 897 | Ga0500618_000498 | 3300053125 | Bacteria | 25216 |
| 898 | Ga0500559_0101026 | 3300053136 | Bacteria | 1329 |
| 899 | Ga0500568_0011042 | 3300053139 | Bacteria | 4207 |
| 900 | Ga0500573_0107549 | 3300053140 | Bacteria | 1564 |
| 901 | Ga0500586_001055 | 3300053145 | Bacteria | 5679 |
| 902 | Ga0500636_0003995 | 3300053177 | Bacteria | 8315 |
| 903 | Ga0500637_0025663 | 3300053178 | Bacteria | 3240 |
| 904 | Ga0500625_005841 | 3300053729 | Bacteria | 5185 |
| 905 | Ga0466962_0015926 | 3300061719 | Bacteria | 3628 |
| 906 | 2511247818 | 2511231003 | Bacteria | 5606035 |
| 907 | 2550694068 | 2548876994 | Bacteria | 4904866 |
| 908 | 2601671089 | 2600255292 | Bacteria | 6300551 |
| 909 | 2643787532 | 2643221554 | Bacteria | 6603920 |
| 910 | 2643797988 | 2643221556 | Bacteria | 7251154 |
| 911 | 2644213599 | 2643221638 | Bacteria | 6579467 |
| 912 | 2644356499 | 2643221664 | Bacteria | 7272945 |
| 913 | 2644473166 | 2643221684 | Bacteria | 7145183 |
| 914 | 2738738865 | 2738541280 | Bacteria | 6630198 |
| 915 | 2738825265 | 2738541297 | Bacteria | 6549566 |
| 916 | 2738844765 | 2738541300 | Bacteria | 6675882 |
| 917 | 2739149062 | 2738541357 | Bacteria | 6549408 |
| 918 | 2739190981 | 2738543003 | Bacteria | 6549560 |
| 919 | 2739276290 | 2738543018 | Bacteria | 6718814 |
| 920 | 2739317458 | 2738543026 | Bacteria | 6549408 |
| 921 | 2739335699 | 2738543029 | Bacteria | 6549249 |
| 922 | 2739345186 | 2738543030 | Bacteria | 6719714 |
| 923 | 2809144465 | 2808606418 | Bacteria | 6724496 |
| 924 | 2819543090 | 2818991436 | Bacteria | 5376622 |
| 925 | 2821133856 | 2821131069 | Bacteria | 6108407 |
| 926 | 2842716687 | 2842711865 | Bacteria | 7155354 |
| 927 | 2857547860 | 2857547612 | Bacteria | 6179999 |
| 928 | 2857553952 | 2857553236 | Bacteria | 6166726 |
| 929 | 2857560240 | 2857558681 | Bacteria | 6617694 |
| 930 | 2857565646 | 2857564685 | Bacteria | 6290584 |
| 931 | 2884816785 | 2884811622 | Bacteria | 5552861 |
| 932 | 2884837667 | 2884836552 | Bacteria | 5219991 |
| 933 | 2884853959 | 2884852848 | Bacteria | 5221161 |
| 934 | 2885081511 | 2885080285 | Bacteria | 6355622 |
| 935 | 2896154924 | 2896154374 | Bacteria | 5221518 |
| 936 | 2904429292 | 2904424332 | Bacteria | 7633521 |
| 937 | 2919481092 | 2919476304 | Bacteria | 5888696 |
| 938 | 2932412460 | 2932410948 | Bacteria | 6312192 |
| 939 | 2932419975 | 2932416698 | Bacteria | 6315112 |
| 940 | 8047677991 | 8047673197 | Bacteria | 7395230 |
| 941 | Ga0495650_0004429 | |||
| 942 | JGI25155J39150_1000076 | |||
| 943 | JGI25155J39150_1000101 | |||
| 944 | JGI25156J39149_1000032 | |||
| 945 | JGI25162J39368_1000025 | |||
| 946 | JGI25162J39368_1000263 | |||
| 947 | JGI25162J39368_1004561 | |||
| 948 | JGI25154J39366_1000095 | |||
| 949 | JGI25154J39366_1000123 | |||
| 950 | JGI25158J39367_1000321 | |||
| 951 | JGI25158J39367_1000929 | |||
| 952 | JGI25157J39369_1000388 | |||
| 953 | JGI25152J39213_1000031 | |||
| 954 | JGI25152J39213_1008059 | |||
| 955 | JGI25150J39212_1000470 | |||
| 956 | JGI25150J39212_1001102 | |||
| 957 | JGI25159J45721_1000552 | |||
| 958 | JGI25165J46597_1000054 | |||
| 959 | rootL2_10010806 | |||
| 960 | rootL2_10022331 | |||
| 961 | rootL2_10120913 | |||
| 962 | rootH1_10216592 | |||
| 963 | JGI25160J50197_1001448 | |||
| 964 | JGI25161J50226_1000465 | |||
| 965 | JGI25161J50226_1002791 | |||
| 966 | Ga0055538_1000026 | |||
| 967 | Ga0055539_1000033 | |||
| 968 | Ga0055533_1000044 | |||
| 969 | Ga0055532_1000083 | |||
| 970 | Ga0055525_1000009 | |||
| 971 | Ga0055525_1000052 | |||
| 972 | Ga0055529_1000545 | |||
| 973 | Ga0055526_1000020 | |||
| 974 | Ga0055526_1000031 | |||
| 975 | Ga0055526_1000908 | |||
| 976 | Ga0055526_1004472 | |||
| 977 | Ga0055537_1000071 | |||
| 978 | Ga0055537_1004385 | |||
| 979 | Ga0055537_1007058 | |||
| 980 | Ga0055537_1008471 | |||
| 981 | Ga0055524_1000015 | |||
| 982 | Ga0055524_1000560 | |||
| 983 | Ga0055524_1001529 | |||
| 984 | Ga0055524_1005186 | |||
| 985 | Ga0055534_1000452 | |||
| 986 | Ga0055534_1000864 | |||
| 987 | Ga0055534_1004846 | |||
| 988 | Ga0055528_1000537 | |||
| 989 | Ga0055528_1017213 | |||
| 990 | Ga0055530_10001313 | |||
| 991 | Ga0055530_10001696 | |||
| 992 | Ga0055530_10004892 | |||
| 993 | Ga0055531_10003437 | |||
| 994 | Ga0055541_1000069 | |||
| 995 | Ga0055543_1000222 | |||
| 996 | Ga0065165_1000710 | |||
| 997 | Ga0065165_1000754 | |||
| 998 | Ga0065165_1002020 | |||
| 999 | Ga0065165_1015133 | |||
| 1000 | Ga0070658_10006027 | |||
| 1001 | Ga0070666_10001066 | |||
| 1002 | Ga0070680_100418778 | |||
| 1003 | Ga0070682_100055362 | |||
| 1004 | Ga0070689_100000042 | |||
| 1005 | Ga0070688_100007002 | |||
| 1006 | Ga0070672_100003675 | |||
| 1007 | Ga0068855_100000016 | |||
| 1008 | Ga0068855_100015153 | |||
| 1009 | Ga0068855_100056433 | |||
| 1010 | Ga0068855_100121150 | |||
| 1011 | Ga0068855_100217134 | |||
| 1012 | Ga0070664_100133740 | |||
| 1013 | Ga0068857_100113744 | |||
| 1014 | Ga0068854_100245784 | |||
| 1015 | Ga0068856_100197863 | |||
| 1016 | Ga0075365_10073780 | |||
| 1017 | Ga0075362_10061128 | |||
| 1018 | Ga0075434_100421232 | |||
| 1019 | Ga0099826_10000003 | |||
| 1020 | Ga0105244_10004609 | |||
| 1021 | Ga0105240_10000952 | |||
| 1022 | Ga0105240_10001988 | |||
| 1023 | Ga0105240_10008537 | |||
| 1024 | Ga0105245_10000332 | |||
| 1025 | Ga0105243_10010095 | |||
| 1026 | Ga0105241_10033948 | |||
| 1027 | Ga0105248_10612817 | |||
| 1028 | Ga0105237_10000050 | |||
| 1029 | Ga0105237_10234803 | |||
| 1030 | Ga0105238_10011438 | |||
| 1031 | Ga0105238_10026479 | |||
| 1032 | Ga0105239_10014685 | |||
| 1033 | Ga0157373_10025853 | |||
| 1034 | Ga0157373_10041267 | |||
| 1035 | Ga0157371_10000001 | |||
| 1036 | Ga0157376_10098876 | |||
| 1037 | Ga0157376_10128880 | |||
| 1038 | Ga0182006_1000014 | |||
| 1039 | Ga0182006_1000044 | |||
| 1040 | Ga0182006_1003369 | |||
| 1041 | Ga0182007_10000011 | |||
| 1042 | Ga0182007_10001225 | |||
| 1043 | Ga0182005_1000014 | |||
| 1044 | Ga0182005_1000018 | |||
| 1045 | Ga0182005_1000540 | |||
| 1046 | Ga0213872_10000002 | |||
| 1047 | Ga0213872_10000269 | |||
| 1048 | Ga0213872_10000485 | |||
| 1049 | Ga0213875_10070975 | |||
| 1050 | Ga0209435_100013 | |||
| 1051 | Ga0209435_100072 | |||
| 1052 | Ga0209436_100375 | |||
| 1053 | Ga0209436_101106 | |||
| 1054 | Ga0209436_111218 | |||
| 1055 | Ga0209784_100020 | |||
| 1056 | Ga0209566_100020 | |||
| 1057 | Ga0209674_100035 | |||
| 1058 | Ga0209147_100030 | |||
| 1059 | Ga0209563_100015 | |||
| 1060 | Ga0209563_100038 | |||
| 1061 | Ga0207427_100721 | |||
| 1062 | Ga0209437_100066 | |||
| 1063 | Ga0209437_100317 | |||
| 1064 | Ga0209437_105114 | |||
| 1065 | Ga0209258_100542 | |||
| 1066 | Ga0207425_1000001 | |||
| 1067 | Ga0207425_1000060 | |||
| 1068 | Ga0207425_1000587 | |||
| 1069 | Ga0207425_1000620 | |||
| 1070 | Ga0209646_1000021 | |||
| 1071 | Ga0209646_1000034 | |||
| 1072 | Ga0209646_1000117 | |||
| 1073 | Ga0209026_1000022 | |||
| 1074 | Ga0209026_1001718 | |||
| 1075 | Ga0209677_100031 | |||
| 1076 | Ga0209148_1001432 | |||
| 1077 | Ga0209759_1000018 | |||
| 1078 | Ga0209759_1000324 | |||
| 1079 | Ga0209129_1000093 | |||
| 1080 | Ga0209129_1004595 | |||
| 1081 | Ga0209233_1000060 | |||
| 1082 | Ga0209565_1000006 | |||
| 1083 | Ga0209565_1001517 | |||
| 1084 | Ga0209565_1001525 | |||
| 1085 | Ga0209565_1001608 | |||
| 1086 | Ga0209565_1002784 | |||
| 1087 | Ga0209565_1004583 | |||
| 1088 | Ga0209455_1000049 | |||
| 1089 | Ga0209673_1000004 | |||
| 1090 | Ga0209130_1000044 | |||
| 1091 | Ga0209130_1000474 | |||
| 1092 | Ga0209130_1002300 | |||
| 1093 | Ga0209675_1000006 | |||
| 1094 | Ga0209675_1013731 | |||
| 1095 | Ga0209025_1003213 | |||
| 1096 | Ga0209564_1000006 | |||
| 1097 | Ga0209564_1000064 | |||
| 1098 | Ga0209564_1000134 | |||
| 1099 | Ga0209564_1003660 | |||
| 1100 | Ga0209564_1022596 | |||
| 1101 | Ga0209758_1000055 | |||
| 1102 | Ga0209050_1000085 | |||
| 1103 | Ga0209050_1000092 | |||
| 1104 | Ga0209050_1000465 | |||
| 1105 | Ga0209050_1000552 | |||
| 1106 | Ga0209256_1000005 | |||
| 1107 | Ga0209256_1000080 | |||
| 1108 | Ga0209256_1002537 | |||
| 1109 | Ga0207426_1002592 | |||
| 1110 | Ga0207426_1036384 | |||
| 1111 | Ga0209051_1024832 | |||
| 1112 | Ga0209257_1000010 | |||
| 1113 | Ga0209257_1002123 | |||
| 1114 | Ga0207680_10015242 | |||
| 1115 | Ga0207705_10005294 | |||
| 1116 | Ga0207705_10012419 | |||
| 1117 | Ga0207705_10292566 | |||
| 1118 | Ga0207695_10000896 | |||
| 1119 | Ga0207695_10007805 | |||
| 1120 | Ga0207695_10009905 | |||
| 1121 | Ga0207671_10000498 | |||
| 1122 | Ga0207657_10020139 | |||
| 1123 | Ga0207652_10001329 | |||
| 1124 | Ga0207652_10063648 | |||
| 1125 | Ga0207694_10170095 | |||
| 1126 | Ga0207687_10001406 | |||
| 1127 | Ga0207670_10000058 | |||
| 1128 | Ga0207691_10001913 | |||
| 1129 | Ga0207667_10000206 | |||
| 1130 | Ga0207667_10014671 | |||
| 1131 | Ga0207667_10131487 | |||
| 1132 | Ga0207678_10125945 | |||
| 1133 | Ga0207702_10262766 | |||
| 1134 | Ga0207648_10261934 | |||
| 1135 | Ga0207674_10060727 | |||
| 1136 | Ga0209282_1000002 | |||
| 1137 | Ga0265334_10012951 | |||
| 1138 | Ga0265334_10074724 | |||
| 1139 | Ga0265318_10000068 | |||
| 1140 | Ga0265318_10000128 | |||
| 1141 | Ga0265318_10011384 | |||
| 1142 | Ga0265338_10000560 | |||
| 1143 | Ga0265324_10037833 | |||
| 1144 | Ga0316177_1137694 | |||
| 1145 | Ga0316182_1150583 | |||
| 1146 | Ga0265330_10000031 | |||
| 1147 | Ga0265330_10000064 | |||
| 1148 | Ga0265332_10000135 | |||
| 1149 | Ga0265332_10004292 | |||
| 1150 | Ga0265328_10002328 | |||
| 1151 | Ga0265328_10021506 | |||
| 1152 | Ga0265328_10043212 | |||
| 1153 | Ga0265320_10000028 | |||
| 1154 | Ga0265320_10005243 | |||
| 1155 | Ga0265329_10005947 | |||
| 1156 | Ga0265339_10069269 | |||
| 1157 | Ga0265331_10000023 | |||
| 1158 | Ga0265331_10001382 | |||
| 1159 | Ga0265331_10004725 | |||
| 1160 | Ga0265327_10000077 | |||
| 1161 | Ga0265327_10022547 | |||
| 1162 | Ga0265316_10000898 | |||
| 1163 | Ga0307408_100000094 | |||
| 1164 | Ga0307408_100001672 | |||
| 1165 | Ga0307408_100002920 | |||
| 1166 | Ga0265313_10000126 | |||
| 1167 | Ga0265313_10014039 | |||
| 1168 | Ga0265313_10018286 | |||
| 1169 | Ga0265314_10000176 | |||
| 1170 | Ga0265314_10001620 | |||
| 1171 | Ga0265342_10002741 | |||
| 1172 | Ga0265342_10020905 | |||
| 1173 | Ga0307518_10012873 | |||
| 1174 | Ga0307414_10064118 | |||
| 1175 | Ga0395899_0000141 | |||
| 1176 | Ga0395899_0005393 | |||
| 1177 | Ga0395899_0011729 | |||
| 1178 | Ga0395899_0025446 | |||
| 1179 | Ga0395899_0042408 | |||
| 1180 | Ga0395900_0012739 | |||
| 1181 | Ga0395900_0020227 | |||
| 1182 | Ga0395900_0021953 | |||
| 1183 | Ga0395900_0035468 | |||
| 1184 | Ga0395900_0047375 | |||
| 1185 | Ga0395900_0098175 | |||
| 1186 | Ga0395900_0104040 | |||
| 1187 | Ga0395900_0173691 | |||
| 1188 | Ga0395900_0420440 | |||
| 1189 | Ga0395898_0038830 | |||
| 1190 | Ga0395898_0097514 | |||
| 1191 | Ga0395898_0289478 | |||
| 1192 | Ga0395905_0050893 | |||
| 1193 | Ga0395905_0071359 | |||
| 1194 | Ga0395905_0107996 | |||
| 1195 | Ga0395905_0116577 | |||
| 1196 | Ga0395905_0117288 | |||
| 1197 | Ga0395905_0121927 | |||
| 1198 | Ga0436364_1136587 | |||
| 1199 | Ga0395901_0000331 | |||
| 1200 | Ga0395901_0000963 | |||
| 1201 | Ga0395901_0110024 | |||
| 1202 | Ga0395901_0179634 | |||
| 1203 | Ga0436361_0152693 | |||
| 1204 | Ga0436361_0325950 | |||
| 1205 | Ga0436361_0390486 | |||
| 1206 | Ga0436361_0462569 | |||
| 1207 | Ga0436361_0495861 | |||
| 1208 | Ga0436361_0875769 | |||
| 1209 | Ga0451807_2471212 | |||
| 1210 | Ga0451843_1196518 | |||
| 1211 | Ga0439450_008783 | |||
| 1212 | Ga0450904_000388 | |||
| 1213 | Ga0451577_0013684 | |||
| 1214 | Ga0451577_0227430 | |||
| 1215 | Ga0466972_0004731 | |||
| 1216 | Ga0466972_0065196 | |||
| 1217 | Ga0466965_0010919 | |||
| 1218 | Ga0466965_0110601 | |||
| 1219 | Ga0466966_0002083 | |||
| 1220 | Ga0466966_0022529 | |||
| 1221 | Ga0466966_0059914 | |||
| 1222 | Ga0466961_0077714 | |||
| 1223 | Ga0466963_0046763 | |||
| 1224 | Ga0466964_0000224 | |||
| 1225 | Ga0466964_0000583 | |||
| 1226 | Ga0453684_0011532 | |||
| 1227 | Ga0466970_0031031 | |||
| 1228 | Ga0466957_0007577 | |||
| 1229 | Ga0466957_0015010 | |||
| 1230 | Ga0466957_0017385 | |||
| 1231 | Ga0451576_0001926 | |||
| 1232 | Ga0451576_0004769 | |||
| 1233 | Ga0466958_0004216 | |||
| 1234 | Ga0466958_0140263 | |||
| 1235 | Ga0466967_0023470 | |||
| 1236 | Ga0466967_0069170 | |||
| 1237 | Ga0466967_0522966 | |||
| 1238 | Ga0495617_000002 | |||
| 1239 | Ga0495617_000007 | |||
| 1240 | Ga0495617_000396 | |||
| 1241 | Ga0495617_000529 | |||
| 1242 | Ga0495617_007951 | |||
| 1243 | Ga0495617_017772 | |||
| 1244 | Ga0495627_000006 | |||
| 1245 | Ga0495627_000111 | |||
| 1246 | Ga0495603_0014816 | |||
| 1247 | Ga0495590_0000004 | |||
| 1248 | Ga0495590_0000007 | |||
| 1249 | Ga0495590_0000352 | |||
| 1250 | Ga0495590_0007832 | |||
| 1251 | Ga0495590_0028580 | |||
| 1252 | Ga0495590_0043940 | |||
| 1253 | Ga0495591_000062 | |||
| 1254 | Ga0495629_0011465 | |||
| 1255 | Ga0495629_0023319 | |||
| 1256 | Ga0495638_0000023 | |||
| 1257 | Ga0495638_0002863 | |||
| 1258 | Ga0495638_0003777 | |||
| 1259 | Ga0495638_0004044 | |||
| 1260 | Ga0495638_0122770 | |||
| 1261 | Ga0495651_0162472 | |||
| 1262 | Ga0495653_0000073 | |||
| 1263 | Ga0495653_0018376 | |||
| 1264 | Ga0495653_0056866 | |||
| 1265 | Ga0495650_0000015 | |||
| 1266 | Ga0495650_0000124 | |||
| 1267 | Ga0495650_0000169 | |||
| 1268 | Ga0495650_0000177 | |||
| 1269 | Ga0495650_0000538 | |||
| 1270 | Ga0495650_0001900 | |||
| 1271 | Ga0495650_0002395 | |||
| 1272 | Ga0495650_0005538 | |||
| 1273 | Ga0495650_0016593 | |||
| 1274 | Ga0495580_0027622 | |||
| 1275 | Ga0495605_0000063 | |||
| 1276 | Ga0495605_0000092 | |||
| 1277 | Ga0495605_0000174 | |||
| 1278 | Ga0495605_0001450 | |||
| 1279 | Ga0495605_0004480 | |||
| 1280 | Ga0495605_0004907 | |||
| 1281 | Ga0495605_0021101 | |||
| 1282 | Ga0495605_0024848 | |||
| 1283 | Ga0495605_0025747 | |||
| 1284 | Ga0495605_0080571 | |||
| 1285 | Ga0495605_0105521 | |||
| 1286 | Ga0495584_0000010 | |||
| 1287 | Ga0495584_0000211 | |||
| 1288 | Ga0495584_0000456 | |||
| 1289 | Ga0495584_0000756 | |||
| 1290 | Ga0495584_0000788 | |||
| 1291 | Ga0495584_0002654 | |||
| 1292 | Ga0495584_0008327 | |||
| 1293 | Ga0495584_0021307 | |||
| 1294 | Ga0495584_0034256 | |||
| 1295 | Ga0495584_0042915 | |||
| 1296 | Ga0495584_0092040 | |||
| 1297 | Ga0495585_0000006 | |||
| 1298 | Ga0495585_0000190 | |||
| 1299 | Ga0495585_0000196 | |||
| 1300 | Ga0495585_0000336 | |||
| 1301 | Ga0495585_0000564 | |||
| 1302 | Ga0495585_0002186 | |||
| 1303 | Ga0495585_0004665 | |||
| 1304 | Ga0495585_0004904 | |||
| 1305 | Ga0495585_0009103 | |||
| 1306 | Ga0495585_0043150 | |||
| 1307 | Ga0495585_0043206 | |||
| 1308 | Ga0495585_0046506 | |||
| 1309 | Ga0495585_0059966 | |||
| 1310 | Ga0495585_0066836 | |||
| 1311 | Ga0495585_0068283 | |||
| 1312 | Ga0495585_0088561 | |||
| 1313 | Ga0495585_0098985 | |||
| 1314 | Ga0495585_0099507 | |||
| 1315 | Ga0495585_0127585 | |||
| 1316 | Ga0495585_0163771 | |||
| 1317 | Ga0495594_0001314 | |||
| 1318 | Ga0495594_0003923 | |||
| 1319 | Ga0495594_0013780 | |||
| 1320 | Ga0495594_0040131 | |||
| 1321 | Ga0495594_0053204 | |||
| 1322 | Ga0495596_0000130 | |||
| 1323 | Ga0495596_0000217 | |||
| 1324 | Ga0495596_0000867 | |||
| 1325 | Ga0495596_0001456 | |||
| 1326 | Ga0495596_0001704 | |||
| 1327 | Ga0495596_0002425 | |||
| 1328 | Ga0495596_0004552 | |||
| 1329 | Ga0495596_0007723 | |||
| 1330 | Ga0495596_0011882 | |||
| 1331 | Ga0495596_0017520 | |||
| 1332 | Ga0495596_0021422 | |||
| 1333 | Ga0495596_0023080 | |||
| 1334 | Ga0495596_0024209 | |||
| 1335 | Ga0495607_0000380 | |||
| 1336 | Ga0495607_0000692 | |||
| 1337 | Ga0495607_0000740 | |||
| 1338 | Ga0495607_0000852 | |||
| 1339 | Ga0495607_0002892 | |||
| 1340 | Ga0495607_0003619 | |||
| 1341 | Ga0495607_0009387 | |||
| 1342 | Ga0495607_0015473 | |||
| 1343 | Ga0495607_0023548 | |||
| 1344 | Ga0495607_0026552 | |||
| 1345 | Ga0495607_0036460 | |||
| 1346 | Ga0495607_0091085 | |||
| 1347 | Ga0495607_0141846 | |||
| 1348 | Ga0495583_0000056 | |||
| 1349 | Ga0495583_0000084 | |||
| 1350 | Ga0495583_0000088 | |||
| 1351 | Ga0495583_0000299 | |||
| 1352 | Ga0495583_0000404 | |||
| 1353 | Ga0495583_0001506 | |||
| 1354 | Ga0495583_0001938 | |||
| 1355 | Ga0495583_0002237 | |||
| 1356 | Ga0495583_0003192 | |||
| 1357 | Ga0495583_0005086 | |||
| 1358 | Ga0495583_0006758 | |||
| 1359 | Ga0495583_0007931 | |||
| 1360 | Ga0495583_0023098 | |||
| 1361 | Ga0495583_0039154 | |||
| 1362 | Ga0495606_0000043 | |||
| 1363 | Ga0495606_0000146 | |||
| 1364 | Ga0495606_0000184 | |||
| 1365 | Ga0495606_0000291 | |||
| 1366 | Ga0495606_0002377 | |||
| 1367 | Ga0495606_0002573 | |||
| 1368 | Ga0495606_0011650 | |||
| 1369 | Ga0495606_0017285 | |||
| 1370 | Ga0495606_0018541 | |||
| 1371 | Ga0495606_0027053 | |||
| 1372 | Ga0495606_0034750 | |||
| 1373 | Ga0495606_0075850 | |||
| 1374 | Ga0495610_0000004 | |||
| 1375 | Ga0495610_0000423 | |||
| 1376 | Ga0495610_0011356 | |||
| 1377 | Ga0495610_0022485 | |||
| 1378 | Ga0495610_0022621 | |||
| 1379 | Ga0495610_0033555 | |||
| 1380 | Ga0495616_0000081 | |||
| 1381 | Ga0495616_0000111 | |||
| 1382 | Ga0495616_0000419 | |||
| 1383 | Ga0495616_0001731 | |||
| 1384 | Ga0495616_0004007 | |||
| 1385 | Ga0495616_0008370 | |||
| 1386 | Ga0495616_0016401 | |||
| 1387 | Ga0495616_0018067 | |||
| 1388 | Ga0495616_0040790 | |||
| 1389 | Ga0495616_0062010 | |||
| 1390 | Ga0495616_0062332 | |||
| 1391 | Ga0495620_0011666 | |||
| 1392 | Ga0495628_0003636 | |||
| 1393 | Ga0495631_0000226 | |||
| 1394 | Ga0495631_0003086 | |||
| 1395 | Ga0495631_0005356 | |||
| 1396 | Ga0495631_0006563 | |||
| 1397 | Ga0495631_0014389 | |||
| 1398 | Ga0495631_0020636 | |||
| 1399 | Ga0495631_0023008 | |||
| 1400 | Ga0495631_0035430 | |||
| 1401 | Ga0495631_0061083 | |||
| 1402 | Ga0495631_0089976 | |||
| 1403 | Ga0495632_0000068 | |||
| 1404 | Ga0495632_0000154 | |||
| 1405 | Ga0495632_0001164 | |||
| 1406 | Ga0495632_0002784 | |||
| 1407 | Ga0495632_0007068 | |||
| 1408 | Ga0495632_0017573 | |||
| 1409 | Ga0495632_0039196 | |||
| 1410 | Ga0495637_0000019 | |||
| 1411 | Ga0495637_0000498 | |||
| 1412 | Ga0495637_0004630 | |||
| 1413 | Ga0495637_0008473 | |||
| 1414 | Ga0495643_0000196 | |||
| 1415 | Ga0495643_0000211 | |||
| 1416 | Ga0495643_0000213 | |||
| 1417 | Ga0495643_0000227 | |||
| 1418 | Ga0495643_0005455 | |||
| 1419 | Ga0495643_0011286 | |||
| 1420 | Ga0495643_0015987 | |||
| 1421 | Ga0495643_0020435 | |||
| 1422 | Ga0495643_0023710 | |||
| 1423 | Ga0495643_0030220 | |||
| 1424 | Ga0495643_0041735 | |||
| 1425 | Ga0495643_0041937 | |||
| 1426 | Ga0495643_0062653 | |||
| 1427 | Ga0495644_0003468 | |||
| 1428 | Ga0495644_0006241 | |||
| 1429 | Ga0495644_0007236 | |||
| 1430 | Ga0495644_0007335 | |||
| 1431 | Ga0495644_0008045 | |||
| 1432 | Ga0495644_0013446 | |||
| 1433 | Ga0495644_0017425 | |||
| 1434 | Ga0495644_0019045 | |||
| 1435 | Ga0495644_0039470 | |||
| 1436 | Ga0495648_0000007 | |||
| 1437 | Ga0495648_0000084 | |||
| 1438 | Ga0495648_0000367 | |||
| 1439 | Ga0495648_0000497 | |||
| 1440 | Ga0495648_0003856 | |||
| 1441 | Ga0495648_0005495 | |||
| 1442 | Ga0495648_0006062 | |||
| 1443 | Ga0495648_0007441 | |||
| 1444 | Ga0495648_0009255 | |||
| 1445 | Ga0495648_0010304 | |||
| 1446 | Ga0495648_0039206 | |||
| 1447 | Ga0495648_0042819 | |||
| 1448 | Ga0495648_0076078 | |||
| 1449 | Ga0495663_0002462 | |||
| 1450 | Ga0495663_0007538 | |||
| 1451 | Ga0495666_0001962 | |||
| 1452 | Ga0495666_0007127 | |||
| 1453 | Ga0495666_0025001 | |||
| 1454 | Ga0495642_0000133 | |||
| 1455 | Ga0495642_0000535 | |||
| 1456 | Ga0495642_0000635 | |||
| 1457 | Ga0495642_0002841 | |||
| 1458 | Ga0495642_0007136 | |||
| 1459 | Ga0495642_0011435 | |||
| 1460 | Ga0495642_0013023 | |||
| 1461 | Ga0495642_0013331 | |||
| 1462 | Ga0495642_0015740 | |||
| 1463 | Ga0495642_0015935 | |||
| 1464 | Ga0495642_0019968 | |||
| 1465 | Ga0495642_0028281 | |||
| 1466 | Ga0495642_0034113 | |||
| 1467 | Ga0495642_0073602 | |||
| 1468 | Ga0495652_0003589 | |||
| 1469 | Ga0495652_0005611 | |||
| 1470 | Ga0495652_0013202 | |||
| 1471 | Ga0495652_0051204 | |||
| 1472 | Ga0495654_0000004 | |||
| 1473 | Ga0495654_0002324 | |||
| 1474 | Ga0495654_0005959 | |||
| 1475 | Ga0495654_0015326 | |||
| 1476 | Ga0495654_0024513 | |||
| 1477 | Ga0495654_0026219 | |||
| 1478 | Ga0495665_0039174 | |||
| 1479 | Ga0495665_0061154 | |||
| 1480 | Ga0495665_0158407 | |||
| 1481 | Ga0495586_0021137 | |||
| 1482 | Ga0495586_0026641 | |||
| 1483 | Ga0495609_0000002 | |||
| 1484 | Ga0495609_0000363 | |||
| 1485 | Ga0495609_0000518 | |||
| 1486 | Ga0495609_0001137 | |||
| 1487 | Ga0495609_0001775 | |||
| 1488 | Ga0495609_0002348 | |||
| 1489 | Ga0495609_0002975 | |||
| 1490 | Ga0495609_0005685 | |||
| 1491 | Ga0495609_0008340 | |||
| 1492 | Ga0495609_0010339 | |||
| 1493 | Ga0495609_0010893 | |||
| 1494 | Ga0495609_0029535 | |||
| 1495 | Ga0495609_0032758 | |||
| 1496 | Ga0495609_0054690 | |||
| 1497 | Ga0495609_0065662 | |||
| 1498 | Ga0495597_0000022 | |||
| 1499 | Ga0495597_0000063 | |||
| 1500 | Ga0495597_0001267 | |||
| 1501 | Ga0495597_0001274 | |||
| 1502 | Ga0495597_0001432 | |||
| 1503 | Ga0495597_0002036 | |||
| 1504 | Ga0495597_0002456 | |||
| 1505 | Ga0495597_0002765 | |||
| 1506 | Ga0495597_0002948 | |||
| 1507 | Ga0495597_0022799 | |||
| 1508 | Ga0495597_0028854 | |||
| 1509 | Ga0495597_0072189 | |||
| 1510 | Ga0495645_0002586 | |||
| 1511 | Ga0495622_0000003 | |||
| 1512 | Ga0495622_0000074 | |||
| 1513 | Ga0495622_0013694 | |||
| 1514 | Ga0495622_0029272 | |||
| 1515 | Ga0495622_0048462 | |||
| 1516 | Ga0495633_0000113 | |||
| 1517 | Ga0495633_0000421 | |||
| 1518 | Ga0495633_0001242 | |||
| 1519 | Ga0495633_0001263 | |||
| 1520 | Ga0495633_0001832 | |||
| 1521 | Ga0495633_0002519 | |||
| 1522 | Ga0495633_0003469 | |||
| 1523 | Ga0495633_0007240 | |||
| 1524 | Ga0495633_0015981 | |||
| 1525 | Ga0495633_0022590 | |||
| 1526 | Ga0495633_0028353 | |||
| 1527 | Ga0495633_0031970 | |||
| 1528 | Ga0495656_0012612 | |||
| 1529 | Ga0495656_0062731 | |||
| 1530 | Ga0495668_0000051 | |||
| 1531 | Ga0495668_0000139 | |||
| 1532 | Ga0495668_0000589 | |||
| 1533 | Ga0495668_0000617 | |||
| 1534 | Ga0495668_0001450 | |||
| 1535 | Ga0495668_0002601 | |||
| 1536 | Ga0495668_0002799 | |||
| 1537 | Ga0495668_0003830 | |||
| 1538 | Ga0495668_0004085 | |||
| 1539 | Ga0495668_0005502 | |||
| 1540 | Ga0495668_0008922 | |||
| 1541 | Ga0495668_0017919 | |||
| 1542 | Ga0495668_0029948 | |||
| 1543 | Ga0495668_0094424 | |||
| 1544 | Ga0495668_0096414 | |||
| 1545 | Ga0495634_0001242 | |||
| 1546 | Ga0495611_0000227 | |||
| 1547 | Ga0495611_0000625 | |||
| 1548 | Ga0495611_0001871 | |||
| 1549 | Ga0495611_0002481 | |||
| 1550 | Ga0495611_0006810 | |||
| 1551 | Ga0495611_0011083 | |||
| 1552 | Ga0495611_0031061 | |||
| 1553 | Ga0495611_0050875 | |||
| 1554 | Ga0495611_0072071 | |||
| 1555 | Ga0495625_0000073 | |||
| 1556 | Ga0495625_0000176 | |||
| 1557 | Ga0495625_0002486 | |||
| 1558 | Ga0495625_0005549 | |||
| 1559 | Ga0495625_0016330 | |||
| 1560 | Ga0495625_0036211 | |||
| 1561 | Ga0495625_0123871 | |||
| 1562 | Ga0495625_0178238 | |||
| 1563 | Ga0495625_0237649 | |||
| 1564 | Ga0495635_0024837 | |||
| 1565 | Ga0495635_0188722 | |||
| 1566 | Ga0495635_0280017 | |||
| 1567 | Ga0495659_0000004 | |||
| 1568 | Ga0495659_0001570 | |||
| 1569 | Ga0495659_0002496 | |||
| 1570 | Ga0495659_0016971 | |||
| 1571 | Ga0495659_0105855 | |||
| 1572 | Ga0495661_0000183 | |||
| 1573 | Ga0495661_0000377 | |||
| 1574 | Ga0495661_0001998 | |||
| 1575 | Ga0495661_0003109 | |||
| 1576 | Ga0495661_0003914 | |||
| 1577 | Ga0495661_0007957 | |||
| 1578 | Ga0495661_0009209 | |||
| 1579 | Ga0495661_0012052 | |||
| 1580 | Ga0495661_0016410 | |||
| 1581 | Ga0495661_0017343 | |||
| 1582 | Ga0495661_0020699 | |||
| 1583 | Ga0495661_0024828 | |||
| 1584 | Ga0495661_0050921 | |||
| 1585 | Ga0495661_0069543 | |||
| 1586 | Ga0495661_0083973 | |||
| 1587 | Ga0495661_0087602 | |||
| 1588 | Ga0495588_0000127 | |||
| 1589 | Ga0495588_0002680 | |||
| 1590 | Ga0495588_0009512 | |||
| 1591 | Ga0495588_0022869 | |||
| 1592 | Ga0495588_0024895 | |||
| 1593 | Ga0495588_0028437 | |||
| 1594 | Ga0495657_0137111 | |||
| 1595 | Ga0495599_0065791 | |||
| 1596 | Ga0495623_0008074 | |||
| 1597 | Ga0495623_0008515 | |||
| 1598 | Ga0495623_0056344 | |||
| 1599 | Ga0495646_0054272 | |||
| 1600 | Ga0495646_0102857 | |||
| 1601 | Ga0495669_0000036 | |||
| 1602 | Ga0495669_0000544 | |||
| 1603 | Ga0495669_0000786 | |||
| 1604 | Ga0495669_0002017 | |||
| 1605 | Ga0495613_0023563 | |||
| 1606 | Ga0495624_0025298 | |||
| 1607 | Ga0495624_0028123 | |||
| 1608 | Ga0495624_0076557 | |||
| 1609 | Ga0495670_0000490 | |||
| 1610 | Ga0495670_0001576 | |||
| 1611 | Ga0495670_0038493 | |||
| 1612 | Ga0495670_0041618 | |||
| 1613 | Ga0495671_0000067 | |||
| 1614 | Ga0495671_0000213 | |||
| 1615 | Ga0495671_0004992 | |||
| 1616 | Ga0495671_0009872 | |||
| 1617 | Ga0495671_0020398 | |||
| 1618 | Ga0495671_0021118 | |||
| 1619 | Ga0495671_0059770 | |||
| 1620 | Ga0495649_0000281 | |||
| 1621 | Ga0495649_0000597 | |||
| 1622 | Ga0495649_0005172 | |||
| 1623 | Ga0495649_0006243 | |||
| 1624 | Ga0495649_0012961 | |||
| 1625 | Ga0495649_0060689 | |||
| 1626 | Ga0495589_0000079 | |||
| 1627 | Ga0495589_0000083 | |||
| 1628 | Ga0495589_0001488 | |||
| 1629 | Ga0495589_0009391 | |||
| 1630 | Ga0495589_0013735 | |||
| 1631 | Ga0495589_0020895 | |||
| 1632 | Ga0495600_0039199 | |||
| 1633 | Ga0495600_0065389 | |||
| 1634 | Ga0495660_0000081 | |||
| 1635 | Ga0495660_0000264 | |||
| 1636 | Ga0495660_0000625 | |||
| 1637 | Ga0495660_0000784 | |||
| 1638 | Ga0495660_0002107 | |||
| 1639 | Ga0495660_0004430 | |||
| 1640 | Ga0495660_0039769 | |||
| 1641 | Ga0495660_0058308 | |||
| 1642 | Ga0495581_0020353 | |||
| 1643 | Ga0495581_0051260 | |||
| 1644 | Ga0495604_0010541 | |||
| 1645 | Ga0495604_0012089 | |||
| 1646 | Ga0495604_0031295 | |||
| 1647 | Ga0495604_0039134 | |||
| 1648 | Ga0495636_0003707 | |||
| 1649 | Ga0495636_0005753 | |||
| 1650 | Ga0495636_0010723 | |||
| 1651 | Ga0495636_0020142 | |||
| 1652 | Ga0495674_0004551 | |||
| 1653 | Ga0495672_0000041 | |||
| 1654 | Ga0495672_0000045 | |||
| 1655 | Ga0495672_0000132 | |||
| 1656 | Ga0495672_0000168 | |||
| 1657 | Ga0495672_0000182 | |||
| 1658 | Ga0495672_0000705 | |||
| 1659 | Ga0495672_0002916 | |||
| 1660 | Ga0495672_0003713 | |||
| 1661 | Ga0495672_0005367 | |||
| 1662 | Ga0495672_0013932 | |||
| 1663 | Ga0495672_0023172 | |||
| 1664 | Ga0495672_0028266 | |||
| 1665 | Ga0495672_0084352 | |||
| 1666 | Ga0495676_0000014 | |||
| 1667 | Ga0495676_0014944 | |||
| 1668 | Ga0495676_0019137 | |||
| 1669 | Ga0495676_0027281 | |||
| 1670 | Ga0495680_0115458 | |||
| 1671 | Ga0495683_0000159 | |||
| 1672 | Ga0495683_0002317 | |||
| 1673 | Ga0495683_0003896 | |||
| 1674 | Ga0495683_0004758 | |||
| 1675 | Ga0495683_0008042 | |||
| 1676 | Ga0495683_0016126 | |||
| 1677 | Ga0495683_0042916 | |||
| 1678 | Ga0495683_0061811 | |||
| 1679 | Ga0495683_0071040 | |||
| 1680 | Ga0495687_000049 | |||
| 1681 | Ga0495687_000075 | |||
| 1682 | Ga0495687_000133 | |||
| 1683 | Ga0495687_000197 | |||
| 1684 | Ga0495687_000199 | |||
| 1685 | Ga0495687_000701 | |||
| 1686 | Ga0495687_001964 | |||
| 1687 | Ga0495687_002227 | |||
| 1688 | Ga0495687_003980 | |||
| 1689 | Ga0495675_0002901 | |||
| 1690 | Ga0495675_0007616 | |||
| 1691 | Ga0495677_0000030 | |||
| 1692 | Ga0495677_0000138 | |||
| 1693 | Ga0495677_0004097 | |||
| 1694 | Ga0495677_0007122 | |||
| 1695 | Ga0495677_0008702 | |||
| 1696 | Ga0495677_0012319 | |||
| 1697 | Ga0495677_0012818 | |||
| 1698 | Ga0495677_0041321 | |||
| 1699 | Ga0495677_0063404 | |||
| 1700 | Ga0495679_001504 | |||
| 1701 | Ga0495679_003064 | |||
| 1702 | Ga0495679_004802 | |||
| 1703 | Ga0495679_018850 | |||
| 1704 | Ga0495679_032568 | |||
| 1705 | Ga0495679_032594 | |||
| 1706 | Ga0495685_000010 | |||
| 1707 | Ga0495685_002335 | |||
| 1708 | Ga0495685_011659 | |||
| 1709 | Ga0495685_016354 | |||
| 1710 | Ga0495685_031599 | |||
| 1711 | Ga0495685_033199 | |||
| 1712 | Ga0495673_0000006 | |||
| 1713 | Ga0495673_0000017 | |||
| 1714 | Ga0495673_0015116 | |||
| 1715 | Ga0495681_0000057 | |||
| 1716 | Ga0495681_0001545 | |||
| 1717 | Ga0495681_0004162 | |||
| 1718 | Ga0495681_0008290 | |||
| 1719 | Ga0495681_0008796 | |||
| 1720 | Ga0495681_0010749 | |||
| 1721 | Ga0495681_0049560 | |||
| 1722 | Ga0495686_0000400 | |||
| 1723 | Ga0495686_0000455 | |||
| 1724 | Ga0495686_0004730 | |||
| 1725 | Ga0495686_0013129 | |||
| 1726 | Ga0495686_0020754 | |||
| 1727 | Ga0495686_0048916 | |||
| 1728 | Ga0495686_0080210 | |||
| 1729 | Ga0495593_0019789 | |||
| 1730 | Ga0495593_0035580 | |||
| 1731 | Ga0495602_0001440 | |||
| 1732 | Ga0495602_0025548 | |||
| 1733 | Ga0495614_0011463 | |||
| 1734 | Ga0495615_0001527 | |||
| 1735 | Ga0495626_0000102 | |||
| 1736 | Ga0495626_0000111 | |||
| 1737 | Ga0495626_0001501 | |||
| 1738 | Ga0495626_0001547 | |||
| 1739 | Ga0495626_0002427 | |||
| 1740 | Ga0495626_0005287 | |||
| 1741 | Ga0495626_0013969 | |||
| 1742 | Ga0495626_0016819 | |||
| 1743 | Ga0495626_0016980 | |||
| 1744 | Ga0495626_0016999 | |||
| 1745 | Ga0495626_0040021 | |||
| 1746 | Ga0495626_0061097 | |||
| 1747 | Ga0496100_0109550 | |||
| 1748 | Ga0496101_0067851 | |||
| 1749 | Ga0496102_0000088 | |||
| 1750 | Ga0496102_0000159 | |||
| 1751 | Ga0496102_0020050 | |||
| 1752 | Ga0496102_0022714 | |||
| 1753 | Ga0496102_0093907 | |||
| 1754 | Ga0496102_0134780 | |||
| 1755 | Ga0496103_0000904 | |||
| 1756 | Ga0496103_0050564 | |||
| 1757 | Ga0496103_0116139 | |||
| 1758 | Ga0496104_0330407 | |||
| 1759 | Ga0496105_0186607 | |||
| 1760 | Ga0496106_0002714 | |||
| 1761 | Ga0496107_0043352 | |||
| 1762 | Ga0496109_0006947 | |||
| 1763 | Ga0496111_0030066 | |||
| 1764 | Ga0496113_0000552 | |||
| 1765 | Ga0496113_0038592 | |||
| 1766 | Ga0496113_0114812 | |||
| 1767 | Ga0496114_0022332 | |||
| 1768 | Ga0496114_0079916 | |||
| 1769 | Ga0496115_0015844 | |||
| 1770 | Ga0496115_0036967 | |||
| 1771 | Ga0496115_0041646 | |||
| 1772 | Ga0496116_0000005 | |||
| 1773 | Ga0496116_0005797 | |||
| 1774 | Ga0496116_0015162 | |||
| 1775 | Ga0496116_0065845 | |||
| 1776 | Ga0496117_0000001 | |||
| 1777 | Ga0496118_0000008 | |||
| 1778 | Ga0496121_0000029 | |||
| 1779 | Ga0496121_0003166 | |||
| 1780 | Ga0496121_0032323 | |||
| 1781 | Ga0496121_0037463 | |||
| 1782 | Ga0496121_0104595 | |||
| 1783 | Ga0496122_0000134 | |||
| 1784 | Ga0496122_0000169 | |||
| 1785 | Ga0496122_0001178 | |||
| 1786 | Ga0496122_0002235 | |||
| 1787 | Ga0496123_0000198 | |||
| 1788 | Ga0496123_0000583 | |||
| 1789 | Ga0496123_0008917 | |||
| 1790 | Ga0496123_0027069 | |||
| 1791 | Ga0496123_0117539 | |||
| 1792 | Ga0496124_0002261 | |||
| 1793 | Ga0496124_0025174 | |||
| 1794 | Ga0496124_0028866 | |||
| 1795 | Ga0496124_0043903 | |||
| 1796 | Ga0496124_0046734 | |||
| 1797 | Ga0496124_0070676 | |||
| 1798 | Ga0496124_0089330 | |||
| 1799 | Ga0496124_0159023 | |||
| 1800 | Ga0496125_0000433 | |||
| 1801 | Ga0496125_0000605 | |||
| 1802 | Ga0496125_0008347 | |||
| 1803 | Ga0496125_0037113 | |||
| 1804 | Ga0496125_0040188 | |||
| 1805 | Ga0496125_0188030 | |||
| 1806 | Ga0496126_0262316 | |||
| 1807 | Ga0495678_000042 | |||
| 1808 | Ga0495678_000070 | |||
| 1809 | Ga0495678_000105 | |||
| 1810 | Ga0495678_000147 | |||
| 1811 | Ga0495678_000363 | |||
| 1812 | Ga0495678_001845 | |||
| 1813 | Ga0495678_002051 | |||
| 1814 | Ga0495678_006491 | |||
| 1815 | Ga0495678_007503 | |||
| 1816 | Ga0495682_0000116 | |||
| 1817 | Ga0495682_0000126 | |||
| 1818 | Ga0495682_0002583 | |||
| 1819 | Ga0495682_0007570 | |||
| 1820 | Ga0495682_0013718 | |||
| 1821 | Ga0501034_0142807 | |||
| 1822 | Ga0501046_0000027 | |||
| 1823 | Ga0501227_005620 | |||
| 1824 | Ga0501269_000295 | |||
| 1825 | Ga0501279_002231 | |||
| 1826 | Ga0501279_002611 | |||
| 1827 | Ga0501035_0001519 | |||
| 1828 | Ga0501044_0162943 | |||
| 1829 | nmdc:mga0yw44_68789_c1 | |||
| 1830 | nmdc:mga07m45_99065_c1 | |||
| 1831 | nmdc:mga0n895_407618_c1 | |||
| 1832 | Ga0495601_0037386 | |||
| 1833 | Ga0495601_0044660 | |||
| 1834 | Ga0500643_001239 | |||
| 1835 | Ga0500594_0010822 | |||
| 1836 | Ga0500595_008866 | |||
| 1837 | Ga0500618_000498 | |||
| 1838 | Ga0500559_0101026 | |||
| 1839 | Ga0500568_0011042 | |||
| 1840 | Ga0500573_0107549 | |||
| 1841 | Ga0500586_001055 | |||
| 1842 | Ga0500636_0003995 | |||
| 1843 | Ga0500637_0025663 | |||
| 1844 | Ga0500625_005841 | |||
| 1845 | Ga0466962_0015926 | |||
| 1846 | 2511247818 | |||
| 1847 | 2550694068 | |||
| 1848 | 2601671089 | |||
| 1849 | 2643787532 | |||
| 1850 | 2643797988 | |||
| 1851 | 2644213599 | |||
| 1852 | 2644356499 | |||
| 1853 | 2644473166 | |||
| 1854 | 2738738865 | |||
| 1855 | 2738825265 | |||
| 1856 | 2738844765 | |||
| 1857 | 2739149062 | |||
| 1858 | 2739190981 | |||
| 1859 | 2739276290 | |||
| 1860 | 2739317458 | |||
| 1861 | 2739335699 | |||
| 1862 | 2739345186 | |||
| 1863 | 2809144465 | |||
| 1864 | 2819543090 | |||
| 1865 | 2821133856 | |||
| 1866 | 2842716687 | |||
| 1867 | 2857547860 | |||
| 1868 | 2857553952 | |||
| 1869 | 2857560240 | |||
| 1870 | 2857565646 | |||
| 1871 | 2884816785 | |||
| 1872 | 2884837667 | |||
| 1873 | 2884853959 | |||
| 1874 | 2885081511 | |||
| 1875 | 2896154924 | |||
| 1876 | 2904429292 | |||
| 1877 | 2919481092 | |||
| 1878 | 2932412460 | |||
| 1879 | 2932419975 | |||
| 1880 | 8047677991 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ehn-assembly1.cif.gz_A | human mthfd2 in complex with compound 21 and 9 | 0.7103 | 21 | 123 |
| 4pzp-assembly1.cif.gz_A | substrate-free structure of d-alanine carrier protein ligase dlta from bacillus cereus | 0.7028 | 9 | 126 |
| 3dhv-assembly1.cif.gz_A | crystal structure of dlta protein in complex with d-alanine adenylate | 0.6909 | 9 | 126 |
| 7xbv-assembly1.cif.gz_A | crystal structure of the adenylation domain of cmng in complex with ampcpp | 0.6834 | 17 | 85 |
| 3fce-assembly1.cif.gz_A | crystal structure of bacillus cereus d-alanyl carrier protein ligase dlta in complex with atp: implications for adenylation mechanism | 0.6677 | 9 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pzpA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.7028 | 9 | 126 | 3.40.50.12780 |
| af_B7EBJ6_9_283_3.40.50.12780 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.6971 | 9 | 121 | 3.40.50.12780 |
| af_Q9VDN3_1_370_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6666 | 14 | 121 | 3.40.50.2300 |
| af_A0A1D6HRG6_59_454_3.40.50.12780 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.6589 | 10 | 95 | 3.40.50.12780 |
| 5u95C02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6577 | 17 | 122 | 3.40.50.980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W2ET23-F1-model_v4 | Leucyl aminopeptidase (Aminopeptidase T) | 0.9962 | 20 | 350 |
|
| AF-A0A0Q5CN67-F1-model_v4 | Leucyl aminopeptidase | 0.9957 | 15 | 350 |
|
| AF-A0A2U2I6Y5-F1-model_v4 | Leucyl aminopeptidase | 0.9947 | 12 | 350 |
GO:0046872
|
| AF-A0A6I3SZG3-F1-model_v4 | Leucyl aminopeptidase | 0.993 | 13 | 350 |
|
| AF-A0A4Q3HSP6-F1-model_v4 | deleted | 0.9921 | 218 | 350 |
|